Synaptosomal-associated protein

Overview
NameSynaptosomal-associated protein
Smed IDSMED30024282
Length (bp)1189
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptosomal-associated protein (SMED30024282) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptosomal-associated protein (SMED30024282) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptosomal-associated protein (SMED30024282) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptosomal-associated protein (SMED30024282) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024282

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30024282SMESG000034282.1 Contig7503newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30024282SMESG000034282.1 Contig7503uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30024282SMESG000034282.1 Contig7503newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30024282SMESG000034282.1 Contig7503uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024282SMESG000034282.1 Contig7503newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024282SMESG000034282.1 Contig7503uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30024282SMESG000034282.1 SmedASXL_009321SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30024282SMESG000034282.1 dd_Smed_v4_3977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024282SMESG000034282.1 dd_Smed_v4_3977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30024282SMESG000034282.1 dd_Smed_v6_3977_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 214.542 bits (545), Expect = 1.076e-67
Identity = 108/197 (54.82%), Postives = 147/197 (74.62%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL+ +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQLDR++EGM+ INQDMK+AEKNL DL KCCGL I P NK+K  D Y K W   + G   +   R+V ++  M + GG+I ++TNDARE+EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 206          
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 213.001 bits (541), Expect = 3.972e-67
Identity = 107/197 (54.31%), Postives = 148/197 (75.13%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL+ +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMK+AEKNL DL K CGLC+ P NK+K  D Y K W   + G   +   R+V ++  M + GG+I ++TNDARE+EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 206          
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP23 (synaptosome associated protein 23 [Source:HGNC Symbol;Acc:HGNC:11131])

HSP 1 Score: 172.17 bits (435), Expect = 3.430e-51
Identity = 94/202 (46.53%), Postives = 133/202 (65.84%), Query Frame = 1
Query:  106 IQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGP-RIVIDQNGM------------GVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            IQ + +  TDESLESTRR+L +  E+++AGI T+ MLD+Q EQL+RI+EG+D+IN+DM++ EK L +LNKCCGLC+ P N+ K  +  K +K    G    + P  +V  Q G                GGYI +ITNDAREDEM++N+T+V  ++ NLK+MA+++G+ I  QN QI +I  KA  N +RI  AN +A KL+
Sbjct:    9 IQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKT-TWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLI 209          
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP23 (synaptosome associated protein 23 [Source:HGNC Symbol;Acc:HGNC:11131])

HSP 1 Score: 147.132 bits (370), Expect = 3.211e-42
Identity = 82/189 (43.39%), Postives = 115/189 (60.85%), Query Frame = 1
Query:  106 IQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            IQ + +  TDESLESTRR+L +  E+++AGI T+ MLD+Q EQL+RI+EG+D+IN+DM++ EK L +LNKCCGLC+ P N                                          ITNDAREDEM++N+T+V  ++ NLK+MA+++G+ I  QN QI +I  KA  N +RI  AN +A KL+
Sbjct:    9 IQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCN-----------------------------------------SITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLI 156          
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: SNAP23 (synaptosome associated protein 23 [Source:HGNC Symbol;Acc:HGNC:11131])

HSP 1 Score: 147.132 bits (370), Expect = 3.211e-42
Identity = 82/189 (43.39%), Postives = 115/189 (60.85%), Query Frame = 1
Query:  106 IQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            IQ + +  TDESLESTRR+L +  E+++AGI T+ MLD+Q EQL+RI+EG+D+IN+DM++ EK L +LNKCCGLC+ P N                                          ITNDAREDEM++N+T+V  ++ NLK+MA+++G+ I  QN QI +I  KA  N +RI  AN +A KL+
Sbjct:    9 IQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCN-----------------------------------------SITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLI 156          
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Match: ric-4 (Synaptosomal-associated protein [Source:UniProtKB/TrEMBL;Acc:A5PEW5])

HSP 1 Score: 244.973 bits (624), Expect = 6.146e-80
Identity = 123/209 (58.85%), Postives = 161/209 (77.03%), Query Frame = 1
Query:   61 MEGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKT-----WKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            M GD  ++ P  L+ I  KMNATTD+SLESTRRMLA+CEE+KEAGI TLVMLDDQGEQL+R +  +D INQDMK+AE +L  + KCCGLC+LPWNK   DD++KT     WKK++ G   +D PRI +  + MG QGGYITKITNDAREDEMD+N+ +VS MV NL+NMAIDM + ++ QN+Q+D+I+ KA +N+ R+ +AN++A  L+
Sbjct:    1 MSGD--DDIPEGLEAINLKMNATTDDSLESTRRMLALCEESKEAGIKTLVMLDDQGEQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWNKT--DDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKITNDAREDEMDENVQQVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESANKRAKNLI 205          
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Match: ric-4 (Synaptosomal-associated protein [Source:UniProtKB/TrEMBL;Acc:A5PEW5])

HSP 1 Score: 231.106 bits (588), Expect = 4.101e-74
Identity = 114/198 (57.58%), Postives = 152/198 (76.77%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKT-----WKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            EL+ +   ++  T ESLESTRRMLA+CEE+KEAGI TLVMLDDQGEQL+R +  +D INQDMK+AE +L  + KCCGLC+LPWNK   DD++KT     WKK++ G   +D PRI +  + MG QGGYITKITNDAREDEMD+N+ +VS MV NL+NMAIDM + ++ QN+Q+D+I+ KA +N+ R+ +AN++A  L+
Sbjct:   37 ELKGLNVGIDEKTIESLESTRRMLALCEESKEAGIKTLVMLDDQGEQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWNKT--DDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKITNDAREDEMDENVQQVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESANKRAKNLI 232          
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Match: aex-4 (t-SNARE protein aex-4 [Source:UniProtKB/Swiss-Prot;Acc:G5EEN8])

HSP 1 Score: 60.4622 bits (145), Expect = 2.351e-10
Identity = 46/193 (23.83%), Postives = 91/193 (47.15%), Query Frame = 1
Query:  136 ESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCIL-----PWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQ---------GGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            +SL+S+ +M+   ++     + T   L+DQ EQLD+I+  +  +  D+     N+  +   CG         P+   ++ + D   K+E   K  +   R   + N M            G ++ ++T DA EDE+++N+ ++   + ++KN+A+DM   +  Q  ++++I      ND  +   N +  KLL
Sbjct:   42 QSLDSSIQMIRDIDQMNVDAVQTTAALEDQDEQLDKIEANLSNVIDDLNVVSHNITAMEHYCGCGFFRILRAPFKYFRKRERD-IIKEEVLEKMTSPKLRRKEESNMMMFTNSSKRRESTGDFMKRLTCDAIEDELERNLMQIDQGLESVKNLAVDMHVQLKLQEPKLNRIEELTETNDFVVEGVNDKVKKLL 233          
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Match: snap-29 (Soluble NSF attachment protein 29 [Source:UniProtKB/Swiss-Prot;Acc:P83351])

HSP 1 Score: 58.9214 bits (141), Expect = 1.237e-9
Identity = 51/205 (24.88%), Postives = 96/205 (46.83%), Query Frame = 1
Query:  127 TTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCG----------------LCILPWNK-VKRDDYDKTWKKEEAGKDNADGP---RIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            T  ESL+ST R     E +++ G ST   L +Q E+L+  ++ +D+I++  +  ++NL+ L    G                   +P +K   R     T      G     GP   R + + +   ++G        +A ++++D+N+  +S  + NL+ +  D+G  +  QN+ +D+I  KA  ND  +R+ ++Q  K+L T 
Sbjct:   46 TLQESLDSTERSRRHLENSEKIGTSTAQQLLEQREKLENTEKNLDEIHRTTQMTQRNLNSLKSFFGGMFKNKFTKKPQEPTETPTVPQSKSASRLSETATNLSSGGGSATFSGPSGQRTLTESSRSAIKGTRW-----EAMDNQIDENLDMMSANLRNLQRLGADLGKEVDSQNEMLDRIQYKAERNDGIVRDQDKQMQKILGTG 245          
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Match: Snap24 (gene:FBgn0266720 transcript:FBtr0082163)

HSP 1 Score: 233.417 bits (594), Expect = 2.565e-75
Identity = 119/207 (57.49%), Postives = 154/207 (74.40%), Query Frame = 1
Query:   76 NNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVK-RDDYDKTWKKEEAGKDNADGPRIVIDQ---NGMGV--QGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKT 678
            N EP TELQ +QFK     DESLESTRRMLA+ +E+KEAGI TLV LDDQGEQLDRI+EGMD+IN DM++AEKNL  + KCCG+C+LPW KV  +DD +  WK  + GK  A  P+ VID+    GMG   Q GY+ +ITNDAREDEMD+N+ +V+ M+ NL+NMA+DMGS +  QN+Q+D+IN K   N+ R+   N++A+ LLK+
Sbjct:    6 NAEPRTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINADMREAEKNLSGMEKCCGICVLPWKKVNIKDDGESAWKANDDGKIVASQPQRVIDERERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIRMDGVNKRANNLLKS 212          
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Match: Snap25 (gene:FBgn0011288 transcript:FBtr0111143)

HSP 1 Score: 232.646 bits (592), Expect = 5.651e-75
Identity = 118/199 (59.30%), Postives = 152/199 (76.38%), Query Frame = 1
Query:   85 PPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKR-DDYDKTWKKEEAGKDNADGP-RIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            P TEL+ +Q       DESLESTRRMLA+CEE+KEAGI TLV LDDQGEQLDRI+EGMD+IN DM++AEKNL  + KCCG+C+LP NK +   + D TWK  + GK   + P R++ D+NGM  Q GYI +ITNDAREDEM++N+ +V+ M+ NL+NMA+DMGS +  QN+QID+INRK  +N+ RI  ANQ+A +LLK
Sbjct:   14 PKTELEELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDDGTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQRAHQLLK 212          
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Match: Snap25 (gene:FBgn0011288 transcript:FBtr0304625)

HSP 1 Score: 226.483 bits (576), Expect = 1.532e-72
Identity = 113/199 (56.78%), Postives = 151/199 (75.88%), Query Frame = 1
Query:   85 PPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKR-DDYDKTWKKEEAGKDNADGP-RIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            P TEL+ +Q       DESLESTRRMLA+CEE+ E G+ ++VMLD+QGEQLDRI+EGMD+IN DM++AEKNL  + KCCG+C+LP NK +   + D TWK  + GK   + P R++ D+NGM  Q GYI +ITNDAREDEM++N+ +V+ M+ NL+NMA+DMGS +  QN+QID+INRK  +N+ RI  ANQ+A +LLK
Sbjct:   14 PKTELEELQINAQGVADESLESTRRMLALCEESAEVGMRSIVMLDEQGEQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDDGTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQRAHQLLK 212          
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Match: Snap29 (gene:FBgn0034913 transcript:FBtr0072236)

HSP 1 Score: 53.9138 bits (128), Expect = 7.033e-8
Identity = 55/231 (23.81%), Postives = 98/231 (42.42%), Query Frame = 1
Query:   73 LNNEPPTELQMIQF--KMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLC--ILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMG-------------VQGGYITKITNDAR-------------EDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            + + P    Q + +  K  A    +L+ST + L +  E +E G +T V L  Q EQL++    +D+I+  ++ ++++L  L    G     L  N+    D   T      G  ++      I+Q   G                  ++++  D               + ++D N+ E+   +S LK +A D+G  I  QN+ +D +N K  + D +I   N+  SKLLK
Sbjct:   57 ITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSGNR----DQPPTATGSPTGSQSSQEANSNINQGACGGASPSAPLSPAERYDNHPVSQLRGDPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLLK 283          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: snap25a (synaptosome associated protein 25a [Source:NCBI gene;Acc:30712])

HSP 1 Score: 201.83 bits (512), Expect = 5.896e-63
Identity = 104/196 (53.06%), Postives = 144/196 (73.47%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL  +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMKDAEKNL+DL K CGLC  P NK+K     K W   + G   +   R+V ++  M + GG+I ++T+DARE+EMD+N+ +V G++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELADMQQRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMK-SGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 204          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: snap25a (synaptosome associated protein 25a [Source:NCBI gene;Acc:30712])

HSP 1 Score: 201.06 bits (510), Expect = 9.993e-63
Identity = 103/196 (52.55%), Postives = 143/196 (72.96%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL  +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQLDR+++GM+ INQDMK+AEKNL DL KCCGL I P NK+K     K W   + G   +   R+V ++  M + GG+I ++T+DARE+EMD+N+ +V G++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELADMQQRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEDGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKMK-SGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 204          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: zgc:101731 (zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57])

HSP 1 Score: 199.134 bits (505), Expect = 7.871e-62
Identity = 103/201 (51.24%), Postives = 146/201 (72.64%), Query Frame = 1
Query:   91 TELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADG-------PRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            +E++ +Q K N  TDESLE TR M  + EE+K+AGI TLVMLD+QGEQLDRI+EG+D+IN+DMK+AEKNL D+  CCGLCI P  K+K  D++ +   ++   +N DG        R+V ++  M + GGYI ++TNDAREDEM++N+ +V  ++ NL++MA+DMG+ I  QN QI++I  KAV N+ RI  ANQ+A+KL+
Sbjct:    9 SEVEELQKKANQMTDESLEVTRNMKLLLEESKDAGIRTLVMLDEQGEQLDRIEEGLDQINKDMKEAEKNLTDMAMCCGLCIWPCTKLK--DFEASGAYKKVWGNNQDGVVSSQPSSRVVDEREKMTMSGGYIRRVTNDAREDEMEENLAQVGSILGNLRSMALDMGNEIDTQNVQIERIQSKAVVNESRINEANQRATKLI 207          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: zgc:101731 (zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57])

HSP 1 Score: 199.134 bits (505), Expect = 7.871e-62
Identity = 103/201 (51.24%), Postives = 146/201 (72.64%), Query Frame = 1
Query:   91 TELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADG-------PRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            +E++ +Q K N  TDESLE TR M  + EE+K+AGI TLVMLD+QGEQLDRI+EG+D+IN+DMK+AEKNL D+  CCGLCI P  K+K  D++ +   ++   +N DG        R+V ++  M + GGYI ++TNDAREDEM++N+ +V  ++ NL++MA+DMG+ I  QN QI++I  KAV N+ RI  ANQ+A+KL+
Sbjct:    9 SEVEELQKKANQMTDESLEVTRNMKLLLEESKDAGIRTLVMLDEQGEQLDRIEEGLDQINKDMKEAEKNLTDMAMCCGLCIWPCTKLK--DFEASGAYKKVWGNNQDGVVSSQPSSRVVDEREKMTMSGGYIRRVTNDAREDEMEENLAQVGSILGNLRSMALDMGNEIDTQNVQIERIQSKAVVNESRINEANQRATKLI 207          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: snap25b (synaptosome associated protein 25b [Source:NCBI gene;Acc:30711])

HSP 1 Score: 192.971 bits (489), Expect = 1.690e-59
Identity = 100/196 (51.02%), Postives = 142/196 (72.45%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL  +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMK+AEKNL DL   CGLC  P NK+K     ++W   + G  ++   R+V ++  M + GG+I ++TNDARE+EMD+N+ +V  ++ NL++MA+DMG+ I  QN+QID+I   A +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELNDMQARADQLGDESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLK--GGGQSWGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQRATKMLGSG 203          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: snap25 (synaptosome associated protein 25kDa [Source:NCBI gene;Acc:549255])

HSP 1 Score: 205.297 bits (521), Expect = 3.654e-64
Identity = 103/197 (52.28%), Postives = 144/197 (73.10%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL+ +Q + +   DESLESTRRML   E +K+AGI TLVMLD+QGEQL+RI+EGM++IN+DMK+AEKNL DL K CGLC+ P NK+K  D Y K W   + G   +   R+V ++  M + GG++ ++TNDARE EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  AN+ A+K+L + 
Sbjct:   10 ELEEMQRRADQLADESLESTRRMLQYVEGSKDAGIRTLVMLDEQGEQLERIEEGMEQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFVRRVTNDARETEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKARIDEANKHATKMLGSG 206          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: znf462 (zinc finger protein 462 [Source:Xenbase;Acc:XB-GENE-976911])

HSP 1 Score: 194.897 bits (494), Expect = 5.196e-60
Identity = 102/198 (51.52%), Postives = 136/198 (68.69%), Query Frame = 1
Query:  106 IQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVI--------DQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            IQ K N  TD+SLESTRRML +  E+++ GI T+ MLD+QGEQL+RI+EGMD+IN+DM++AEKNL +LNKCCGLC+ P  + K  +  + +KK    KDN D   ++          Q G+   G YI +IT D REDEMD+N+T+V  ++ NLKNMAIDMG+ +   NQQID+IN KA  N  RI  AN +A KL++
Sbjct:   17 IQLKANQVTDDSLESTRRMLNLALESQDTGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKNLTELNKCCGLCVCPGKRPKDFESGENYKKTWGSKDN-DSENVISKQPHQTNGQQGGVAQSGPYIKRITGDDREDEMDENLTQVGSILGNLKNMAIDMGNELESHNQQIDRINEKAETNKTRIDEANTRAKKLIE 213          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: snap25 (synaptosome associated protein 25kDa [Source:NCBI gene;Acc:549255])

HSP 1 Score: 184.882 bits (468), Expect = 1.851e-56
Identity = 92/180 (51.11%), Postives = 131/180 (72.78%), Query Frame = 1
Query:  145 ESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            E  RR   + +E+K+AGI TLVMLD+QGEQL+RI+EGM++IN+DMK+AEKNL DL K CGLC+ P NK+K  D Y K W   + G   +   R+V ++  M + GG++ ++TNDARE EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  AN+ A+K+L + 
Sbjct:   13 EMQRRADQLADESKDAGIRTLVMLDEQGEQLERIEEGMEQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFVRRVTNDARETEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKARIDEANKHATKMLGSG 192          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: ENSXETT00000012397.1 (synaptosomal-associated protein 25-like [Source:NCBI gene;Acc:100491227])

HSP 1 Score: 139.813 bits (351), Expect = 3.552e-39
Identity = 72/151 (47.68%), Postives = 103/151 (68.21%), Query Frame = 1
Query:  229 EQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EQLDRIDEG+D INQDM++AEKNL D+ KCCGLC     K     Y   W     G  +A   R+  ++  M + GGYI ++TNDAREDEM+ N+ +V  ++ NL++MA+D+G+ I  QN+Q++KI  K V N++RI++AN +A K+LK+ 
Sbjct:   37 EQLDRIDEGLDHINQDMREAEKNLTDMGKCCGLCSCHRLKCSAT-YRAVWGNSHDGIISAQPSRVADEREQMMMSGGYIRRVTNDAREDEMEDNLAQVGSILGNLRSMALDVGNEIDIQNKQVEKIMEK-VTNEDRIKDANTKAKKILKSV 185          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: ENSXETT00000028688.1 (synaptosomal-associated protein 25-like [Source:NCBI gene;Acc:100491227])

HSP 1 Score: 139.428 bits (350), Expect = 1.486e-38
Identity = 70/150 (46.67%), Postives = 101/150 (67.33%), Query Frame = 1
Query:  232 QLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            QLDRIDEG+D INQDM++AEKNL D+ KCCGLC     K     Y   W     G  +A   R+  ++  M + GGYI ++TNDAREDEM+ N+ +V  ++ NL++MA+D+G+ I  QN+Q++KI  K   N++RI++AN +A K+LK+ 
Sbjct:   78 QLDRIDEGLDHINQDMREAEKNLTDMGKCCGLCSCHRLKCS-ATYRAVWGNSHDGIISAQPSRVADEREQMMMSGGYIRRVTNDAREDEMEDNLAQVGSILGNLRSMALDVGNEIDIQNKQVEKIMEKVKANEDRIKDANTKAKKILKSV 226          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap25 (synaptosomal-associated protein 25 [Source:MGI Symbol;Acc:MGI:98331])

HSP 1 Score: 214.542 bits (545), Expect = 7.390e-68
Identity = 108/197 (54.82%), Postives = 147/197 (74.62%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL+ +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQLDR++EGM+ INQDMK+AEKNL DL KCCGL I P NK+K  D Y K W   + G   +   R+V ++  M + GG+I ++TNDARE+EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 206          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap25 (synaptosomal-associated protein 25 [Source:MGI Symbol;Acc:MGI:98331])

HSP 1 Score: 213.001 bits (541), Expect = 2.727e-67
Identity = 107/197 (54.31%), Postives = 148/197 (75.13%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL+ +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMK+AEKNL DL K CGLC+ P NK+K  D Y K W   + G   +   R+V ++  M + GG+I ++TNDARE+EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 206          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap23 (synaptosomal-associated protein 23 [Source:MGI Symbol;Acc:MGI:109356])

HSP 1 Score: 191.815 bits (486), Expect = 4.927e-59
Identity = 108/213 (50.70%), Postives = 144/213 (67.61%), Query Frame = 1
Query:   73 LNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEA-GKDNADGPRIVIDQ------NGMGVQ------GGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            ++N  P E   +Q + +  TDESLESTRR+L +  E+++AGI T+ MLD+QGEQL+RI+EGMD+IN+DM++AEK L +LNKCCGLCI P N+ K  +  K +K     G DN+  P  V+ +      NG   Q      GGYI +ITNDAREDEM++N+T+V  ++ NLKNMA+DMG+ I  QNQQI KI  KA  N  RI  AN +A KL+
Sbjct:    1 MDNLSPEE---VQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRTKNFESGKNYKATWGDGGDNS--PSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLI 208          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap23 (synaptosomal-associated protein 23 [Source:MGI Symbol;Acc:MGI:109356])

HSP 1 Score: 191.815 bits (486), Expect = 4.927e-59
Identity = 108/213 (50.70%), Postives = 144/213 (67.61%), Query Frame = 1
Query:   73 LNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEA-GKDNADGPRIVIDQ------NGMGVQ------GGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            ++N  P E   +Q + +  TDESLESTRR+L +  E+++AGI T+ MLD+QGEQL+RI+EGMD+IN+DM++AEK L +LNKCCGLCI P N+ K  +  K +K     G DN+  P  V+ +      NG   Q      GGYI +ITNDAREDEM++N+T+V  ++ NLKNMA+DMG+ I  QNQQI KI  KA  N  RI  AN +A KL+
Sbjct:    1 MDNLSPEE---VQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRTKNFESGKNYKATWGDGGDNS--PSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLI 208          
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Match: Snap23 (synaptosomal-associated protein 23 [Source:MGI Symbol;Acc:MGI:109356])

HSP 1 Score: 188.734 bits (478), Expect = 1.416e-57
Identity = 107/222 (48.20%), Postives = 143/222 (64.41%), Query Frame = 1
Query:   73 LNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD--YDKTWKKEEAGKDN----ADG----PRIVID------------QNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            ++N  P E   +Q + +  TDESLESTRR+L +  E+++AGI T+ MLD+QGEQL+RI+EGMD+IN+DM++AEK L +LNKCCGLCI P N+    D  ++   K  E+GK+      DG    P  V+             Q      GGYI +ITNDAREDEM++N+T+V  ++ NLKNMA+DMG+ I  QNQQI KI  KA  N  RI  AN +A KL+
Sbjct:    1 MDNLSPEE---VQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRFSVGDCFFETRTKNFESGKNYKATWGDGGDNSPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLI 219          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|P36975|SNP25_DROME (Synaptosomal-associated protein 25 OS=Drosophila melanogaster OX=7227 GN=Snap25 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 5.664e-74
Identity = 118/199 (59.30%), Postives = 152/199 (76.38%), Query Frame = 1
Query:   85 PPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKR-DDYDKTWKKEEAGKDNADGP-RIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            P TEL+ +Q       DESLESTRRMLA+CEE+KEAGI TLV LDDQGEQLDRI+EGMD+IN DM++AEKNL  + KCCG+C+LP NK +   + D TWK  + GK   + P R++ D+NGM  Q GYI +ITNDAREDEM++N+ +V+ M+ NL+NMA+DMGS +  QN+QID+INRK  +N+ RI  ANQ+A +LLK
Sbjct:   14 PKTELEELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDDGTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQRAHQLLK 212          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|P60881|SNP25_RAT (Synaptosomal-associated protein 25 OS=Rattus norvegicus OX=10116 GN=Snap25 PE=1 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.908e-66
Identity = 107/197 (54.31%), Postives = 148/197 (75.13%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL+ +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMK+AEKNL DL K CGLC+ P NK+K  D Y K W   + G   +   R+V ++  M + GG+I ++TNDARE+EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 206          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|Q5R1X1|SNP25_PANTR (Synaptosomal-associated protein 25 OS=Pan troglodytes OX=9598 GN=SNAP25 PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.908e-66
Identity = 107/197 (54.31%), Postives = 148/197 (75.13%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL+ +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMK+AEKNL DL K CGLC+ P NK+K  D Y K W   + G   +   R+V ++  M + GG+I ++TNDARE+EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 206          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|P60879|SNP25_MOUSE (Synaptosomal-associated protein 25 OS=Mus musculus OX=10090 GN=Snap25 PE=1 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.908e-66
Identity = 107/197 (54.31%), Postives = 148/197 (75.13%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL+ +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMK+AEKNL DL K CGLC+ P NK+K  D Y K W   + G   +   R+V ++  M + GG+I ++TNDARE+EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 206          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|P60877|SNP25_MACMU (Synaptosomal-associated protein 25 OS=Macaca mulatta OX=9544 GN=SNAP25 PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.908e-66
Identity = 107/197 (54.31%), Postives = 148/197 (75.13%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD-YDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL+ +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMK+AEKNL DL K CGLC+ P NK+K  D Y K W   + G   +   R+V ++  M + GG+I ++TNDARE+EMD+N+ +VSG++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 206          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A4PBU6 (Synaptosomal-associated protein OS=Dugesia japonica OX=6161 GN=DjSNAP-25 PE=2 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 2.085e-144
Identity = 206/207 (99.52%), Postives = 207/207 (100.00%), Query Frame = 1
Query:   61 MEGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            MEGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKA+NNDERIRNANQQASKLLKTA
Sbjct:    1 MEGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAINNDERIRNANQQASKLLKTA 207          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A4Z2DL83 (Synaptosomal-associated protein OS=Schistosoma japonicum OX=6182 GN=EWB00_011215 PE=3 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 2.853e-98
Identity = 149/198 (75.25%), Postives = 171/198 (86.36%), Query Frame = 1
Query:   85 PPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKV-KRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            P TE + I+FKMN TTDESLES+RRM+A+CEEAKEAGISTLVMLDDQGEQLDRI+EGMD+INQDMKDAEKNLDDLNKCCGLC+LPWNKV K+DDY K  K E+      DGPRI++DQNGMG  GGYIT+ITNDAREDEMDQN+ EVSGM+ NL+NMAIDMGS I QQN Q+++I  KA +N ERI+ AN+QASKLLK
Sbjct:    7 PLTEYEQIKFKMNQTTDESLESSRRMMALCEEAKEAGISTLVMLDDQGEQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWNKVKKKDDYTKQLKDEDM--RGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDQNLQEVSGMIGNLRNMAIDMGSEINQQNVQVERIQIKAKSNAERIKKANEQASKLLK 202          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A4V3SEF9 (Synaptosomal-associated protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006402 PE=3 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 4.981e-98
Identity = 149/198 (75.25%), Postives = 171/198 (86.36%), Query Frame = 1
Query:   85 PPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKV-KRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            P TE + I+FKMN TTDESLE++RRM+AMCEEAKEAGISTLVMLDDQGEQLDRI+EGMD+INQDMKDAEKNLDDLNKCCGLC+LPWNKV K+DDY K  K E+  +   DGPRI++DQNGMG  GGYIT+ITNDAREDEMD N+ EVSGM+ NL+NMAIDMGS I QQN QI++I  KA +N ERI+ AN+QASKLLK
Sbjct:    7 PMTEFEQIKFKMNQTTDESLEASRRMMAMCEEAKEAGISTLVMLDDQGEQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWNKVKKKDDYTKQLKDEDM-RGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNVQIERIQIKAKSNAERIKKANEQASKLLK 203          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: G4V9U7 (Synaptosomal-associated protein OS=Schistosoma mansoni OX=6183 GN=Smp_034120 PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 7.096e-98
Identity = 148/198 (74.75%), Postives = 171/198 (86.36%), Query Frame = 1
Query:   85 PPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKV-KRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            P TE + I+FKMN TTDESLE++RRM+A+CEEAKEAGISTLVMLDDQGEQLDRI+EGMD+INQDMKDAEKNLDDLNKCCGLC+LPWNKV K+DDY K  K E+      DGPRI++DQNGMG  GGYIT+ITNDAREDEMDQN+ EVSGM+ NL+NMAIDMGS I QQN Q+++I  KA +N ERI+ AN+QASKLLK
Sbjct:   11 PMTEYEQIKFKMNQTTDESLEASRRMMALCEEAKEAGISTLVMLDDQGEQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWNKVKKKDDYTKQLKDEDM--RGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDQNLQEVSGMIGNLRNMAIDMGSEINQQNVQVERIQIKAKSNAERIKKANEQASKLLK 206          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A504Z4T2 (Synaptosomal-associated protein OS=Fasciola gigantica OX=46835 GN=FGIG_05049 PE=3 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 4.747e-97
Identity = 147/198 (74.24%), Postives = 171/198 (86.36%), Query Frame = 1
Query:   85 PPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKV-KRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            P TEL+ I+FKMN TTDESLE++RRM+A+CEEAKEAGISTLVMLDDQGEQLDRI+EGMD+INQDMKDAEKNLDDLNKCCGLC+LPW KV K+DDY K  K E+  +   DGPRI++DQNGMG  GGYIT+ITNDAREDEMD N+ EVSGM+ NL+NMAIDMGS I QQN Q+++I  KA +N ERI+ AN+QASKLLK
Sbjct:    7 PMTELEQIRFKMNQTTDESLEASRRMMALCEEAKEAGISTLVMLDDQGEQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWKKVKKKDDYTKQLKDEDM-RGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNAQVERIQIKARSNAERIKKANEQASKLLK 203          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:103043918])

HSP 1 Score: 203.756 bits (517), Expect = 9.212e-64
Identity = 105/196 (53.57%), Postives = 145/196 (73.98%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL  +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMKDAEKNL+DL K CGLC  P NK+K     K W   + G  N+   R+V ++  M + GG+I ++T+DARE+EMD+N+ +V G++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELSDMQQRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMK-SGGSKAWGNNQDGVVNSQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMDKAESNKTRIDEANQRATKMLGSG 204          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap25b (synaptosomal-associated protein 25-B [Source:NCBI gene;Acc:103032718])

HSP 1 Score: 193.356 bits (490), Expect = 8.460e-60
Identity = 100/196 (51.02%), Postives = 142/196 (72.45%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL  +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMK+AEKNL DL   CGLC  P NK+K     ++W   + G  ++   R+V ++  M + GG+I ++TNDARE+EMD+N+ +V  ++ NL++MA+DMG+ I  QN+QID+I   A +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELTNLQERADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLK--GGGQSWGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQRATKMLGSG 203          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap25b (synaptosomal-associated protein 25-B [Source:NCBI gene;Acc:103032718])

HSP 1 Score: 193.356 bits (490), Expect = 8.460e-60
Identity = 100/196 (51.02%), Postives = 142/196 (72.45%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL  +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMK+AEKNL DL   CGLC  P NK+K     ++W   + G  ++   R+V ++  M + GG+I ++TNDARE+EMD+N+ +V  ++ NL++MA+DMG+ I  QN+QID+I   A +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELTNLQERADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLK--GGGQSWGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQRATKMLGSG 203          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap23.1 (synaptosomal-associated protein 23-like [Source:NCBI gene;Acc:103046345])

HSP 1 Score: 184.111 bits (466), Expect = 1.147e-55
Identity = 104/211 (49.29%), Postives = 139/211 (65.88%), Query Frame = 1
Query:   97 LQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDD----YDKTWKKEEAGKDNAD---GPRIVID------QNGMGV------QGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            ++ I  + N  TDESLESTRRML M EE+KE G  T+ MLD QGEQL R+++GMD+IN+DMK AEKNL DL+KCCGLC+ P ++V+  +    Y +TW     G DNA    G   V+       +NG          G YI +ITNDAREDEM++N+ +V  ++ NLK+MA+DMG+ I +QN+ +D+I  KA  N  RI  ANQ+A+KLL
Sbjct:   29 VEEITMRANQVTDESLESTRRMLQMAEESKETGTKTMEMLDQQGEQLKRVEQGMDQINKDMKAAEKNLTDLSKCCGLCVCPCDRVRSIENDGRYKRTWG---TGSDNASIEGGEGGVVSSQPTAARNGQAAGPVSSSGGPYIKRITNDAREDEMEENLDQVGSIIGNLKSMALDMGNEIDKQNKTVDRIIDKADMNKARIDEANQRANKLL 236          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: snap25b (synaptosomal-associated protein 25-B [Source:NCBI gene;Acc:103032718])

HSP 1 Score: 182.185 bits (461), Expect = 2.017e-55
Identity = 94/196 (47.96%), Postives = 142/196 (72.45%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL  +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+R+++GM+ IN+DM +AEK+L D+ KCCGL + P +K+K     ++W   + G  ++   R+V ++  M + GG+I ++TNDARE+EMD+N+ +V  ++ NL++MA+DMG+ I  QN+QID+I   A +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELTNLQERADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERVEDGMNHINKDMMEAEKSLKDVGKCCGL-VCPCDKLK--GGGQSWGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQRATKMLGSG 202          
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009891.1 (pep scaffold:Pmarinus_7.0:GL477783:18017:27879:1 gene:ENSPMAG00000008937.1 transcript:ENSPMAT00000009891.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.787 bits (569), Expect = 3.651e-72
Identity = 117/203 (57.64%), Postives = 156/203 (76.85%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQG--EQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKR----DDYDKTWKKEEAGKD---NADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            ELQ IQ K N  TDESLESTRRM+ + EE+K+AGI TLVMLD+QG  EQLDR++EG+D+INQDM++AEKNL DL+KCCGLC+ P  K++     D Y KTW    +G+D   ++   R++ ++  M V GG+I ++TNDAREDEM+ N+ +VSG+VSNL++MA+DMG+ I  QN+QIDKIN+KA  N  RI +ANQQA+K+LK
Sbjct:   10 ELQSIQMKANEVTDESLESTRRMIRLAEESKDAGIRTLVMLDEQGDTEQLDRVEEGLDQINQDMREAEKNLTDLSKCCGLCVCPCKKIRNFEMGDAYKKTWN---SGQDIVVSSQPARVMDEREQMQVSGGFIKRVTNDAREDEMEDNLVQVSGLVSNLRHMAVDMGNEIDMQNKQIDKINQKAELNRSRIDDANQQANKMLK 209          
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 205.297 bits (521), Expect = 5.707e-65
Identity = 104/199 (52.26%), Postives = 146/199 (73.37%), Query Frame = 1
Query:   91 TELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNK--VKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            +EL+ +Q + +  TDESLESTRRML + +E+KEAGI TLVMLD+QGEQLD+I+EGMD+IN+DMK+AEKNL DL KCCGLC  P  K     D Y K W   + G  +     ++ D+  M   GG+I ++TNDARE++M++N+ +VSGM+ NL++MA+DMG+ I  QN+Q+D+I  KA +N  RI +ANQ+A+K+L + 
Sbjct:    9 SELEKMQERADQVTDESLESTRRMLQLVDESKEAGIRTLVMLDEQGEQLDKIEEGMDQINKDMKEAEKNLTDLGKCCGLCACPCEKKISSCDAYKKAWGNNQDGVVSNQPAHVMDDREQMACSGGFIRRVTNDARENDMEENLEQVSGMIGNLRHMAMDMGNEIDMQNRQLDRIMEKADSNKARIDDANQRATKILGSG 207          
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 185.267 bits (469), Expect = 7.015e-58
Identity = 91/161 (56.52%), Postives = 123/161 (76.40%), Query Frame = 1
Query:  136 ESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKR----DDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKI 606
            +SLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EG+D+IN+DMK+AEKNL DL KCCGLC  P  K+K     D Y K W K+E G  ++   R+  ++  M + GGYI K+TNDARE EMD N+ +VSG++ NL++MA+DMG+ I  QN+Q+++I
Sbjct:    1 QSLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGLDQINKDMKEAEKNLSDLGKCCGLCSCPCEKLKNFESGDAYKKVWGKKEDGVVSSQPARVCDEREQMAMSGGYIRKVTNDARETEMDDNLEQVSGIIGNLRHMALDMGNEIDTQNRQLERI 161          
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Match: snap23.1 (synaptosome associated protein 23.1 [Source:ZFIN;Acc:ZDB-GENE-040426-883])

HSP 1 Score: 152.14 bits (383), Expect = 1.479e-44
Identity = 89/197 (45.18%), Postives = 130/197 (65.99%), Query Frame = 1
Query:  106 IQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQ-------GGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            +Q K N  TDESLE+TRRM  M  E +  G +TLVML++QGEQL+ I+  +D IN+DMK+A+K +  ++KCCGLCI P NK+K  D    +K    G  + +  ++V +Q G   Q       G +I +IT+D REDEM++N+ E+  ++ NLK MA++MG+ + QQN Q++++N KA  N  RI  +NQ A+KLLK
Sbjct:   10 VQIKANQLTDESLEATRRMRNMVVETQATGANTLVMLNEQGEQLNTIEHNLDHINEDMKEADKYIRQMSKCCGLCICPCNKMKSSDNKGAYKPAVWGSISKE--KVVSEQPGKAGQQGQPQASGPFIKRITDDDREDEMEENLQEIGDIIGNLKGMALNMGNELDQQNTQLERLNEKAELNTSRINQSNQNATKLLK 204          
BLAST of Synaptosomal-associated protein vs. Ensembl Nematostella
Match: EDO42967 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S070])

HSP 1 Score: 192.971 bits (489), Expect = 3.320e-60
Identity = 98/196 (50.00%), Postives = 134/196 (68.37%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            E+  +Q + +  TDESLESTRRML M EE+++ GI T+VM+D+QGEQLDR++EG+D+IN DMK+AE+NL  + KCCGLC+ PW K KR +   T+KK      N DG R                 ITND REDEMD+N+ +VS ++ NLK+MA+DMG  +  QN+Q+D+IN KA +ND RI  AN++A  +L+ A
Sbjct:   10 EIARMQMRGDEMTDESLESTRRMLRMAEESQDTGIKTMVMIDEQGEQLDRVEEGLDQINADMKEAERNLTGMEKCCGLCVCPWKKSKRYEKSDTYKKAFKNNHNEDGVR-----------------ITNDDREDEMDENLGQVSNIIGNLKSMAVDMGQELETQNRQLDRINAKAESNDTRIHVANKRARDILRNA 188          
BLAST of Synaptosomal-associated protein vs. Ensembl Nematostella
Match: EDO26910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAR1])

HSP 1 Score: 84.3445 bits (207), Expect = 1.146e-20
Identity = 34/56 (60.71%), Postives = 48/56 (85.71%), Query Frame = 1
Query:  181 AKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNK 348
            +++ GI T+VM+D+QGEQLDR++EG+D+IN DMK+AE+NL  + KCCGLC+ PW K
Sbjct:    1 SQDTGIKTMVMIDEQGEQLDRVEEGLDQINADMKEAERNLTGMEKCCGLCVCPWKK 56          
BLAST of Synaptosomal-associated protein vs. Ensembl Nematostella
Match: EDO39859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8P1])

HSP 1 Score: 67.3958 bits (163), Expect = 5.178e-13
Identity = 61/224 (27.23%), Postives = 101/224 (45.09%), Query Frame = 1
Query:   61 MEGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCI-----LPWNKVKRDDYDKTWKKEEAGKDN---------------ADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLL 672
            ME D  +     L  IQ ++    + SL+ST+R LA+ +++ +  I T   L  QGEQLDR ++ +D I+ DM  A +N+  +    G         P   V  ++   +      GK++                D P    D + +   G   +K   D  E ++D N+  ++  +S LK  A+ +G  I +QN Q+D+I  KA   D +I  A +   K+L
Sbjct:    1 MEDDFEH---VNLNSIQQQIRIAQERSLDSTKRSLALIDDSHDVAIKTAEELQYQGEQLDRTEKNLDHIHNDMAVANRNIKSMKSIWGTMTNYFKKAPKQTVTENENKSSHVSHMLGKESCEFSTSDAERETYGYGDKPARPHDTSSLQRSGLTTSK---DPYERQLDANLDLMARGLSRLKEDALCLGGEIERQNTQLDRITDKAERADFKIDKARKDIKKML 218          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:101165368])

HSP 1 Score: 201.445 bits (511), Expect = 5.963e-63
Identity = 104/196 (53.06%), Postives = 143/196 (72.96%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL  +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DMKDAEKNL+DL K CGLC  P NK+K     K W   + G   +   R+V ++  M + GG+I ++T DARE+EMD+N+ +V G++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELSDMQQRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMK-SGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTEDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 204          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: ENSORLT00000040742.1 (synaptosomal-associated protein 25-A [Source:NCBI gene;Acc:101170749])

HSP 1 Score: 199.904 bits (507), Expect = 3.232e-62
Identity = 107/207 (51.69%), Postives = 150/207 (72.46%), Query Frame = 1
Query:   64 EGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNAD-GPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            E D+ NE    L  +Q + +  TDESLESTRRMLAM EE+K+AGI TLVMLD+QGEQL+RI+EGMD+IN+DM DAEKNL++L + CGLC  P NK+K     + W   + G  N+  G R++ ++  M + GG+I ++T+DARE+EMD+N+ +V G++ NL++MA+DMG  I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:    4 EADMRNE----LADLQTRADQITDESLESTRRMLAMVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMMDAEKNLNNLGQFCGLCSCPCNKIK--GGGQAWGGNQDGVVNSQPGARVMDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRIMDKADSNKTRIDEANQRATKMLGSG 204          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:101165368])

HSP 1 Score: 199.134 bits (505), Expect = 6.367e-62
Identity = 102/196 (52.04%), Postives = 141/196 (71.94%), Query Frame = 1
Query:   94 ELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            EL  +Q + +   DESLESTRRML + EE+K+AGI TLVMLD+QGEQLDR+++GM+ INQDMK+AEKNL DL  CCGL I P NK+K     K W   + G   +   R+V ++  M + GG+I ++T DARE+EMD+N+ +V G++ NL++MA+DMG+ I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:   10 ELSDMQQRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEDGMNHINQDMKEAEKNLKDLGNCCGLFICPCNKMK-SGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTEDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG 204          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: ENSORLT00000043933.1 (synaptosomal-associated protein 25-A [Source:NCBI gene;Acc:101170749])

HSP 1 Score: 190.66 bits (483), Expect = 1.005e-58
Identity = 102/207 (49.28%), Postives = 147/207 (71.01%), Query Frame = 1
Query:   64 EGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNAD-GPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            E D+ NE    L  +Q + +  TDESLESTRRMLAM EE+K+AGI TLVMLD+QGEQLDR++EGM+K+N D+K+AEK+L D+ +CCGL      K+K     + W   + G  N+  G R++ ++  M + GG+I ++T+DARE+EMD+N+ +V G++ NL++MA+DMG  I  QN+QID+I  KA +N  RI  ANQ+A+K+L + 
Sbjct:    4 EADMRNE----LADLQTRADQITDESLESTRRMLAMVEESKDAGIRTLVMLDEQGEQLDRVEEGMNKVNADLKEAEKDLKDIGQCCGLICPCIKKIK--GGGQAWGGNQDGVVNSQPGARVMDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRIMDKADSNKTRIDEANQRATKMLGSG 204          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: ENSORLT00000014272.2 (synaptosome associated protein 23 [Source:NCBI gene;Acc:101165519])

HSP 1 Score: 184.111 bits (466), Expect = 5.910e-56
Identity = 104/214 (48.60%), Postives = 141/214 (65.89%), Query Frame = 1
Query:   97 LQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEA-----GKDNADGPRIVIDQ-----NGMGVQ-----------GGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            ++ +  + N  TDESLESTRRM  + EE++E G  TL MLD QGEQL R++EGM++IN+DMK AEKNL+DLNKCCGLC  P ++V   + D+ +KK        G+++ DG ++V  Q     NG   Q           G YI ++TNDAREDEM++N+  V G++SNLK MA+ MG  I +QN QID+I  KA  N  RI +ANQ+A+KL+K
Sbjct:    6 VEQMALRANQLTDESLESTRRMRQLAEESQETGGKTLDMLDMQGEQLKRVEEGMEQINEDMKQAEKNLNDLNKCCGLCTCPCDRVTSLENDQRYKKTWGTGGLEGENDGDGSKVVSRQPSRTRNGQPAQTAARGTAAAPSGPYIQRVTNDAREDEMEENLEAVGGIISNLKGMAMTMGHEIDKQNVQIDRITDKADMNKMRIDDANQRANKLIK 219          
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Match: SMESG000034282.1 (SMESG000034282.1)

HSP 1 Score: 418.698 bits (1075), Expect = 2.390e-148
Identity = 207/207 (100.00%), Postives = 207/207 (100.00%), Query Frame = 1
Query:   61 MEGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 681
            MEGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA
Sbjct:    1 MEGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLKTA 207          
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Match: SMESG000005619.1 (SMESG000005619.1)

HSP 1 Score: 281.182 bits (718), Expect = 5.204e-94
Identity = 138/202 (68.32%), Postives = 168/202 (83.17%), Query Frame = 1
Query:   70 DLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 675
            D+NNEPPTE+Q+IQ K+N+TTDESLESTRRML +CEEAKEAGISTLVMLDDQGEQLDR++EGMDKIN+D+KDAEKNL+DLNKCCGL  LPW K KR+   K    E  G  NADGPR+ +D    G QGGYITKITNDARE EMDQN+ EV+G++ NL+NMAIDMG+ I+QQ++QID+IN++A  N  RI  A+++ +KLLK
Sbjct:   13 DINNEPPTEMQLIQLKINSTTDESLESTRRMLNLCEEAKEAGISTLVMLDDQGEQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNG--NADGPRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASEKTTKLLK 212          
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Match: SMESG000034721.1 (SMESG000034721.1)

HSP 1 Score: 189.119 bits (479), Expect = 5.962e-59
Identity = 90/132 (68.18%), Postives = 110/132 (83.33%), Query Frame = 1
Query:   85 PPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKV---KRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITK 471
            P TE ++IQ ++   T ++L+STRRML +CEEAKE+G+ TLVMLDDQGEQLDRI+EG+DKIN+DMKDAEKNLDDLNKCCGLCI+PW KV   ++ DY+KTWK +E GKDN   PRIV+DQNG G  GGYIT+
Sbjct:   24 PMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITR 155          
The following BLAST results are available for this feature:
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNAP251.076e-6754.82synaptosome associated protein 25 [Source:HGNC Sym... [more]
SNAP253.972e-6754.31synaptosome associated protein 25 [Source:HGNC Sym... [more]
SNAP233.430e-5146.53synaptosome associated protein 23 [Source:HGNC Sym... [more]
SNAP233.211e-4243.39synaptosome associated protein 23 [Source:HGNC Sym... [more]
SNAP233.211e-4243.39synaptosome associated protein 23 [Source:HGNC Sym... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ric-46.146e-8058.85Synaptosomal-associated protein [Source:UniProtKB... [more]
ric-44.101e-7457.58Synaptosomal-associated protein [Source:UniProtKB... [more]
aex-42.351e-1023.83t-SNARE protein aex-4 [Source:UniProtKB/Swiss-Pro... [more]
snap-291.237e-924.88Soluble NSF attachment protein 29 [Source:UniProt... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Snap242.565e-7557.49gene:FBgn0266720 transcript:FBtr0082163[more]
Snap255.651e-7559.30gene:FBgn0011288 transcript:FBtr0111143[more]
Snap251.532e-7256.78gene:FBgn0011288 transcript:FBtr0304625[more]
Snap297.033e-823.81gene:FBgn0034913 transcript:FBtr0072236[more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap25a5.896e-6353.06synaptosome associated protein 25a [Source:NCBI ge... [more]
snap25a9.993e-6352.55synaptosome associated protein 25a [Source:NCBI ge... [more]
zgc:1017317.871e-6251.24zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57][more]
zgc:1017317.871e-6251.24zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57][more]
snap25b1.690e-5951.02synaptosome associated protein 25b [Source:NCBI ge... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap253.654e-6452.28synaptosome associated protein 25kDa [Source:NCBI ... [more]
znf4625.196e-6051.52zinc finger protein 462 [Source:Xenbase;Acc:XB-GEN... [more]
snap251.851e-5651.11synaptosome associated protein 25kDa [Source:NCBI ... [more]
ENSXETT00000012397.13.552e-3947.68synaptosomal-associated protein 25-like [Source:NC... [more]
ENSXETT00000028688.11.486e-3846.67synaptosomal-associated protein 25-like [Source:NC... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snap257.390e-6854.82synaptosomal-associated protein 25 [Source:MGI Sym... [more]
Snap252.727e-6754.31synaptosomal-associated protein 25 [Source:MGI Sym... [more]
Snap234.927e-5950.70synaptosomal-associated protein 23 [Source:MGI Sym... [more]
Snap234.927e-5950.70synaptosomal-associated protein 23 [Source:MGI Sym... [more]
Snap231.416e-5748.20synaptosomal-associated protein 23 [Source:MGI Sym... [more]
back to top
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P36975|SNP25_DROME5.664e-7459.30Synaptosomal-associated protein 25 OS=Drosophila m... [more]
sp|P60881|SNP25_RAT1.908e-6654.31Synaptosomal-associated protein 25 OS=Rattus norve... [more]
sp|Q5R1X1|SNP25_PANTR1.908e-6654.31Synaptosomal-associated protein 25 OS=Pan troglody... [more]
sp|P60879|SNP25_MOUSE1.908e-6654.31Synaptosomal-associated protein 25 OS=Mus musculus... [more]
sp|P60877|SNP25_MACMU1.908e-6654.31Synaptosomal-associated protein 25 OS=Macaca mulat... [more]
back to top
BLAST of Synaptosomal-associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4PBU62.085e-14499.52Synaptosomal-associated protein OS=Dugesia japonic... [more]
A0A4Z2DL832.853e-9875.25Synaptosomal-associated protein OS=Schistosoma jap... [more]
A0A4V3SEF94.981e-9875.25Synaptosomal-associated protein OS=Opisthorchis fe... [more]
G4V9U77.096e-9874.75Synaptosomal-associated protein OS=Schistosoma man... [more]
A0A504Z4T24.747e-9774.24Synaptosomal-associated protein OS=Fasciola gigant... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap25a9.212e-6453.57synaptosome associated protein 25 [Source:NCBI gen... [more]
snap25b8.460e-6051.02synaptosomal-associated protein 25-B [Source:NCBI ... [more]
snap25b8.460e-6051.02synaptosomal-associated protein 25-B [Source:NCBI ... [more]
snap23.11.147e-5549.29synaptosomal-associated protein 23-like [Source:NC... [more]
snap25b2.017e-5547.96synaptosomal-associated protein 25-B [Source:NCBI ... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009891.13.651e-7257.64pep scaffold:Pmarinus_7.0:GL477783:18017:27879:1 g... [more]
SNAP255.707e-6552.26synaptosome associated protein 25 [Source:HGNC Sym... [more]
SNAP257.015e-5856.52synaptosome associated protein 25 [Source:HGNC Sym... [more]
snap23.11.479e-4445.18synaptosome associated protein 23.1 [Source:ZFIN;A... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO429673.320e-6050.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269101.146e-2060.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398595.178e-1327.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap25a5.963e-6353.06synaptosome associated protein 25 [Source:NCBI gen... [more]
ENSORLT00000040742.13.232e-6251.69synaptosomal-associated protein 25-A [Source:NCBI ... [more]
snap25a6.367e-6252.04synaptosome associated protein 25 [Source:NCBI gen... [more]
ENSORLT00000043933.11.005e-5849.28synaptosomal-associated protein 25-A [Source:NCBI ... [more]
ENSORLT00000014272.25.910e-5648.60synaptosome associated protein 23 [Source:NCBI gen... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000034282.12.390e-148100.00SMESG000034282.1[more]
SMESG000005619.15.204e-9468.32SMESG000005619.1[more]
SMESG000034721.15.962e-5968.18SMESG000034721.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024282 ID=SMED30024282|Name=Synaptosomal-associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1189bp
CTTTAATTAAGTTCAAATTGAAAACATTTAATAAATTCATTCTAAACAAT
AAATCACAGAATGGAAGGCGATCTTAATAATGAACCACCGACCGAGTTAC
AGATGATTCAATTTAAGATGAATGCGACCACAGATGAGTCTTTGGAAAGT
ACAAGAAGAATGCTGGCAATGTGCGAAGAGGCAAAAGAGGCGGGAATTTC
AACATTAGTTATGCTTGATGATCAAGGAGAACAACTCGATAGGATCGACG
AGGGCATGGATAAAATCAACCAGGATATGAAGGACGCAGAGAAAAATTTA
GATGATTTGAATAAATGCTGTGGATTGTGCATTTTGCCTTGGAACAAAGT
GAAGCGTGACGATTATGACAAAACTTGGAAGAAAGAGGAAGCCGGAAAAG
ACAACGCAGACGGTCCGAGGATTGTAATTGATCAAAATGGAATGGGCGTG
CAAGGGGGATACATCACAAAAATTACAAACGATGCGAGAGAAGATGAGAT
GGATCAAAACATCACAGAGGTGTCGGGAATGGTGAGTAACCTGAAGAACA
TGGCCATCGATATGGGGAGCTCTATAGCACAGCAAAATCAACAAATCGAC
AAGATCAATAGAAAAGCTGTCAACAATGATGAGCGCATCAGGAATGCAAA
TCAACAAGCATCGAAATTATTAAAAACTGCTTAATGTGAATATCGGCTGG
CATTTTAAAGCATTATCGTTTGGAAAATTGCAAAATATATATTTATTAAT
GTTTTATAAACTGATTAAGATTTGGAAAGTTTCTTATTTGTCTGCTGATT
TATTTTTTCGATTTTTCTGTAATTTTCTTTCCTCTATTTTAATTATATTT
CTCTTCTATTAGTGTACGGAATACTCATGGAATAATGTATAATAGGGAAC
TATGCCAACAATGCAATTATGCAAGCGGTGAGGATGTTGCGGAGAATTAG
TTGATTGATATATATGTGTGAGTGTGATATTGGGGCTGGTTTGTGTATTG
CACGTGTCCGTTGAGGAGGCATCGAGATCGATTTGTCAATTGTCATTGAC
ATTGCGTCATAATTCTTCCTAACTAATGTTTAATAATTGAGTTTTCGCTT
TTATGATTAACATTTGCTTATAAATTATGATTATTGTTATTATTAAGTAG
ACATCTCATTTAGTGCATTTAGATATTTGAGAATGTTCC
back to top

protein sequence of SMED30024282-orf-1

>SMED30024282-orf-1 ID=SMED30024282-orf-1|Name=SMED30024282-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
MEGDLNNEPPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLV
MLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKVKRD
DYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQN
ITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQA
SKLLKTA*
back to top
Aliases
The feature 'Synaptosomal-associated protein' has the following synonyms
Synonym
Dj-SNAP-25
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000149SNARE binding
GO:0005249voltage-gated potassium channel activity
GO:0017075syntaxin-1 binding
GO:0005515protein binding
GO:0005484SNAP receptor activity
GO:0019905syntaxin binding
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0016082synaptic vesicle priming
GO:0031629synaptic vesicle fusion to presynaptic active zone membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000727T_SNARE_dom
IPR000928SNAP-25_dom
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0031201SNARE complex
GO:0098793presynapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 59..86
NoneNo IPR availableCOILSCoilCoilcoord: 172..199
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 121..206
e-value: 1.0E-29
score: 104.4
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 5..84
e-value: 2.2E-34
score: 119.3
NoneNo IPR availablePANTHERPTHR19305:SF14SYNAPTOSOMAL-ASSOCIATED PROTEIN-RELATEDcoord: 13..205
NoneNo IPR availablePANTHERPTHR19305SYNAPTOSOMAL ASSOCIATED PROTEINcoord: 13..205
NoneNo IPR availableCDDcd15889SNARE_SNAP25N_23Ncoord: 18..82
e-value: 1.64392E-31
score: 107.336
NoneNo IPR availableSUPERFAMILYSSF58038SNARE fusion complexcoord: 11..81
NoneNo IPR availableSUPERFAMILYSSF58038SNARE fusion complexcoord: 132..204
IPR000727Target SNARE coiled-coil homology domainSMARTSM00397tSNARE_6coord: 16..83
e-value: 1.3E-10
score: 51.2
coord: 136..203
e-value: 5.8E-12
score: 55.7
IPR000727Target SNARE coiled-coil homology domainPROSITEPS50192T_SNAREcoord: 21..83
score: 14.853
IPR000727Target SNARE coiled-coil homology domainPROSITEPS50192T_SNAREcoord: 141..203
score: 17.743
IPR000928SNAP-25 domainPFAMPF00835SNAP-25coord: 93..142
e-value: 4.4E-14
score: 52.5