Cysteine-rich venom protein

Overview
NameCysteine-rich venom protein
Smed IDSMED30024253
Length (bp)698
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cysteine-rich venom protein (SMED30024253) t-SNE clustered cells

Violin plots show distribution of expression levels for Cysteine-rich venom protein (SMED30024253) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024253

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024253SMESG000044051.1 SmedASXL_000032SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024253SMESG000044051.1 SmedASXL_021893SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30024253SMESG000044051.1 Contig35594newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024253SMESG000044051.1 Contig35594uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cysteine-rich venom protein vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 115.161 bits (287), Expect = 2.765e-29
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGF-VYPSSCTG--TCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LTD EK+ M+ +HN  R+ V+PTA++M+ ++W++ L A A+ ++  CV+ H    N      G+NL+  T        DV LA+  W  E + + +  ++C+    CGH TQ++WA T  IGCG   C       E NI L+ C Y   GN+ G+  YQ G  CS CP+ Y  C+N LC
Sbjct:   28 LTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAYARQCVWGH----NKERGRRGENLFAITDEG----MDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGY-HCKNSLC 197          
BLAST of Cysteine-rich venom protein vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 115.161 bits (287), Expect = 2.765e-29
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGF-VYPSSCTG--TCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LTD EK+ M+ +HN  R+ V+PTA++M+ ++W++ L A A+ ++  CV+ H    N      G+NL+  T        DV LA+  W  E + + +  ++C+    CGH TQ++WA T  IGCG   C       E NI L+ C Y   GN+ G+  YQ G  CS CP+ Y  C+N LC
Sbjct:   28 LTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAYARQCVWGH----NKERGRRGENLFAITDEG----MDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGY-HCKNSLC 197          
BLAST of Cysteine-rich venom protein vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 115.161 bits (287), Expect = 2.765e-29
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGF-VYPSSCTG--TCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LTD EK+ M+ +HN  R+ V+PTA++M+ ++W++ L A A+ ++  CV+ H    N      G+NL+  T        DV LA+  W  E + + +  ++C+    CGH TQ++WA T  IGCG   C       E NI L+ C Y   GN+ G+  YQ G  CS CP+ Y  C+N LC
Sbjct:   28 LTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAYARQCVWGH----NKERGRRGENLFAITDEG----MDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGY-HCKNSLC 197          
BLAST of Cysteine-rich venom protein vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 103.219 bits (256), Expect = 2.771e-26
Identity = 61/177 (34.46%), Postives = 96/177 (54.24%), Query Frame = 1
Query:   61 KQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHP-AEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY---PSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENI--LITCQYWLRGNILGQ--TLYQSGVSCSNCPTPYPDCENKLC 567
            ++ ++N HN+ R  V+P A+NM+K++W++ +   A+ W++ C  QH   ED    +  G+NLY+++ P S +      A+ +W  E   FVY   P S     GH TQ++W +T  +GCG A C    PN +++     CQY   GN + +  T YQ G  C+ CP    DC+  LC
Sbjct:   37 QREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSS-----AIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYC----PNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPD---DCDKGLC 201          
BLAST of Cysteine-rich venom protein vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 103.219 bits (256), Expect = 2.771e-26
Identity = 61/177 (34.46%), Postives = 96/177 (54.24%), Query Frame = 1
Query:   61 KQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHP-AEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY---PSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENI--LITCQYWLRGNILGQ--TLYQSGVSCSNCPTPYPDCENKLC 567
            ++ ++N HN+ R  V+P A+NM+K++W++ +   A+ W++ C  QH   ED    +  G+NLY+++ P S +      A+ +W  E   FVY   P S     GH TQ++W +T  +GCG A C    PN +++     CQY   GN + +  T YQ G  C+ CP    DC+  LC
Sbjct:   37 QREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSS-----AIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYC----PNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPD---DCDKGLC 201          
BLAST of Cysteine-rich venom protein vs. Ensembl Celegans
Match: scl-7 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18539])

HSP 1 Score: 102.834 bits (255), Expect = 8.058e-27
Identity = 67/191 (35.08%), Postives = 94/191 (49.21%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMV-----------NPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYD--VDLAVLAWIKESQGFVYPSSCTGTC------GHATQILWATTSSIGCGRATCNATD--PNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCE 555
             ++  KQSM+N HN  RS +             +ATNM+K++W+ +L   A+N+++ C  QH  +      SYG+NL+ A     IT  D  V  AV  W+ E Q F + S+   T       GHATQ+ W+ T  +GCG   C A      +    I CQY + GN L + +Y SG  CS CP     CE
Sbjct:   18 FSEGGKQSMVNAHNAVRSSIAKGEYVAKGTKKDSATNMLKMKWDNSLAQSAQNYANGCPMQHSPDK-----SYGENLFWAYSSSPITDLDKYVQSAVDTWVSEFQMFGWNSNKFTTALWNTGIGHATQVAWSATGQVGCGAKNCGADSVRVGSYKATIVCQYKVPGNYLFKNIYNSGAKCSACPAG-TSCE 202          
BLAST of Cysteine-rich venom protein vs. Ensembl Celegans
Match: scl-8 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18540])

HSP 1 Score: 99.7525 bits (247), Expect = 1.188e-25
Identity = 66/192 (34.38%), Postives = 94/192 (48.96%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMV-----------NPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDV--DLAVLAWIKESQGFVYPSSC-------TGTCGHATQILWATTSSIGCGRATC--NATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCE 555
             ++  KQS+LN HN  RS +             +ATNM+K++W+ +LE  A+N+++ C  QH   D     + G+NLY        +  D    +A +AW  E + F + S+        TG   HATQI WA T  IGCG   C  +A       + I CQY +RGN   + +Y SG +CS CP     CE
Sbjct:   18 FSEGGKQSILNAHNDIRSRIAKGNYVAKGNRKESATNMLKMKWDSSLEQSAQNYANGCHMQHSTND----KTIGENLYWEWSGDPFSDLDKFGKIATVAWDHEFEQFGWNSNKFSLALFNTGVA-HATQIAWAPTGKIGCGVKNCGRDARRGGLFQVAIVCQYRVRGNFFFKNIYNSGATCSACPAG-TSCE 203          
BLAST of Cysteine-rich venom protein vs. Ensembl Celegans
Match: scl-1 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20608])

HSP 1 Score: 93.5893 bits (231), Expect = 2.817e-23
Identity = 64/200 (32.00%), Postives = 100/200 (50.00%), Query Frame = 1
Query:   34 VDPLLTDSEKQSMLNIHNQNRSMVNPT-----------ATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDV--DLAVLAWIKESQGFVYPSSCTGTC------GHATQILWATTSSIGCGRATC--NATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYP-DCENKLC 567
            V+   T + + S+++ HN+ RS +  +           AT+M K+  + T+ A A+N+++ C   H        + YG+NLY +     +   D   ++A  AW KE Q F + S+   T       GHATQ+ WA TSSIGCG   C  +A+  N   I + CQY   GN +G+ +Y+ G +CS+C      D  + LC
Sbjct:   12 VNAQFTSTGQSSIVDAHNKLRSAIAKSTYVAKGTKKEPATDMRKMVVDSTVAASAQNYANTCPTGHSKG-----TGYGENLYWSWTSADVGSLDSYGEIAAAAWEKEFQDFGWKSNAMDTTLFNSGIGHATQMAWANTSSIGCGVKNCGRDASMRNMNKIAVVCQYSPPGNTMGRPIYKEGTTCSSCSGSTKCDTASGLC 206          
BLAST of Cysteine-rich venom protein vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 93.2041 bits (230), Expect = 3.568e-23
Identity = 67/207 (32.37%), Postives = 106/207 (51.21%), Query Frame = 1
Query:    1 LIFTVFFHFQIVDPLLTDSEKQSMLNIHNQNRSMV-----------NPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDL----AVLAWIKESQGFVYPSSC------TGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCEN 558
            LI  + F F       +++ K  +L+ HN  RS +            P+A+NM+KL W+ TLE  A+++S+ C    P   +A+ ++ G+N+Y  T P  +T  D +L    +   W  E Q F +  +           GHATQ+ WATT+ IGCG + C ++D      ++ C Y   GN +G  +Y+SG +CSNCP    +CE+
Sbjct:    7 LICLLIFSFCETLCEFSETGKNYILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGC----PTGHSASRANIGENMYWWTSPV-VTQTDAELLGNRSANLWESEFQRFGWNGNLLTEELFNSGIGHATQMAWATTNKIGCGISKC-SSDSFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDG-TNCES 206          
BLAST of Cysteine-rich venom protein vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 89.7373 bits (221), Expect = 6.858e-22
Identity = 61/185 (32.97%), Postives = 91/185 (49.19%), Query Frame = 1
Query:   61 KQSMLNIHNQNRSMV-----------NPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAV--LAWIKESQGFVYPSSC-------TGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCE 555
            + ++LN+HN  RS +            P A++M+K++W+ T+ A A+ +++ C   H        +  G+NLY      +IT  D   A    AW KE Q + + S+        TG  GHATQ+ WA T+ IGCG   C         + + CQY  +GN L Q +Y SG +CS CP+    CE
Sbjct:   24 QAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGA-----AGLGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGI-GHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSG-TSCE 201          
BLAST of Cysteine-rich venom protein vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 82.0333 bits (201), Expect = 5.892e-18
Identity = 53/176 (30.11%), Postives = 83/176 (47.16%), Query Frame = 1
Query:   28 QIVDPLLTDSEKQSMLNIHNQNRSMV-------NPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYL--ATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGV-SCS 525
            +I+   +T  E+  +L  HN+ R +V        P A NM ++ W+  L A A+ W+  C F+H         + GQNL +  +T P      D    + +W  E Q + +  + +   GH +Q++W  TS +GCG A     D +  N L  C Y   GN++G   Y+ G  SCS
Sbjct:   26 KIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPKTGHYSQLVWGETSLVGCGYAEYK--DTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCS 199          
BLAST of Cysteine-rich venom protein vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 55.8398 bits (133), Expect = 5.109e-9
Identity = 45/180 (25.00%), Postives = 77/180 (42.78%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNP-------TATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSY-GQNL--YLATRPKSITPYDVDLAVLAWIKE----SQGFV---YPSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCP 534
            +++  +Q +L++HN  RS +         +A +M  L+W+  LE +A   +  C F H    N     + GQN+  +   R        +   V+ W +E    +Q F+   +P       GH T ++    + +GC          N    ++TC Y    NI  + +YQSG + S CP
Sbjct:   91 MSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDY-NNIFNEPIYQSGPAGSKCP 269          
BLAST of Cysteine-rich venom protein vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 50.8322 bits (120), Expect = 2.409e-7
Identity = 47/178 (26.40%), Postives = 77/178 (43.26%), Query Frame = 1
Query:   52 DSEKQSMLNIHNQNRSMVN-------PTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNA-AYSSYGQNL-YLATRPKSITPYDVDLAVLAWIKESQGFV------YPSSCTGTCGHATQILWATTSSIGCGRATCNATDPNN-ENILITCQYWLRGNILGQTLYQSGVSCSNCPT 537
            D+    +L +HN+ R+++        P+A  M  + W+ TL  LA   +  C   H    N   Y   GQNL  L TR   +  + +   + AW  E++         Y        GH T ++    + +GC  A    TD NN +  L+ C Y +  N++   +Y++G + S C T
Sbjct:   58 DAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSVDVAVF-LRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGC--AIARFTDANNVQATLLACNYAVT-NVVNNPVYRAGTAASECTT 231          
BLAST of Cysteine-rich venom protein vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0333658)

HSP 1 Score: 46.2098 bits (108), Expect = 9.012e-6
Identity = 49/182 (26.92%), Postives = 81/182 (44.51%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVN-------PTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNA-AYSSYGQNLYLAT--RPKSITPYDVDLAVLAWIKES----QGFV--YPSSCTG-TCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQS-GVSCSNCPT 537
            L+ +EK +++   N+ R+ +          A  M  ++WN  L  LA      C  +H    N  A+   GQNL       P ++T Y ++  V  W  E+    Q ++  YPS+  G   GH T ++    + +GC  AT + +  + +  L+ C Y    N+LG  +Y S   + S C T
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAFDWSGQNLAWMGYYNPLNVTHY-LEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNY-AATNVLGIKMYSSCSKAASKCTT 233          
BLAST of Cysteine-rich venom protein vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0073937)

HSP 1 Score: 46.2098 bits (108), Expect = 9.012e-6
Identity = 49/182 (26.92%), Postives = 81/182 (44.51%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVN-------PTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNA-AYSSYGQNLYLAT--RPKSITPYDVDLAVLAWIKES----QGFV--YPSSCTG-TCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQS-GVSCSNCPT 537
            L+ +EK +++   N+ R+ +          A  M  ++WN  L  LA      C  +H    N  A+   GQNL       P ++T Y ++  V  W  E+    Q ++  YPS+  G   GH T ++    + +GC  AT + +  + +  L+ C Y    N+LG  +Y S   + S C T
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAFDWSGQNLAWMGYYNPLNVTHY-LEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNY-AATNVLGIKMYSSCSKAASKCTT 233          
BLAST of Cysteine-rich venom protein vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 103.219 bits (256), Expect = 2.687e-26
Identity = 62/179 (34.64%), Postives = 96/179 (53.63%), Query Frame = 1
Query:   43 LLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNL-YLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGT-CGHATQILWATTSSIGCGRATCNAT----DPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENK 561
             ++  +  ++L+ HN+ RS V P A NM  + W++ L   AE W+S C+++H       +   GQNL  ++ R KSI    +DL V +W  E   F YPS C+G+ C H TQ++WA ++ IGC    C+          +  L+ C Y ++GN +G+  Y+ G  CS CP+ Y    NK
Sbjct:   60 FISGKDMTALLDYHNRVRSQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQH--IGQNLSIISGRYKSI----IDL-VKSWYDERHSFSYPSRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNK 231          
BLAST of Cysteine-rich venom protein vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 103.219 bits (256), Expect = 2.687e-26
Identity = 62/179 (34.64%), Postives = 96/179 (53.63%), Query Frame = 1
Query:   43 LLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNL-YLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGT-CGHATQILWATTSSIGCGRATCNAT----DPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENK 561
             ++  +  ++L+ HN+ RS V P A NM  + W++ L   AE W+S C+++H       +   GQNL  ++ R KSI    +DL V +W  E   F YPS C+G+ C H TQ++WA ++ IGC    C+          +  L+ C Y ++GN +G+  Y+ G  CS CP+ Y    NK
Sbjct:   60 FISGKDMTALLDYHNRVRSQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQH--IGQNLSIISGRYKSI----IDL-VKSWYDERHSFSYPSRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNK 231          
BLAST of Cysteine-rich venom protein vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 102.449 bits (254), Expect = 4.396e-26
Identity = 64/202 (31.68%), Postives = 97/202 (48.02%), Query Frame = 1
Query:    4 IFTVFFHFQIVDPLLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAA------YSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSS-CTG--TCGHATQILWATTSSIGCGRATC-----NATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            +F+  + F I D    D      +  HNQNRS V+PTA NM  + W+  L   A  W+  C+F+H      A      +++ G+N++ A  P S   + V  AV +W+ E + + Y ++ C     CGH TQ++WA +  +GC   TC          N + ++  C Y   GN  G++ Y+ G SCS C      CE  LC
Sbjct:   17 VFSSEYLFDITDRAFIDE----CVREHNQNRSSVSPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIW-AGAPYS--RFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGS-DKCERNLC 210          
BLAST of Cysteine-rich venom protein vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 101.679 bits (252), Expect = 1.395e-25
Identity = 64/202 (31.68%), Postives = 97/202 (48.02%), Query Frame = 1
Query:    4 IFTVFFHFQIVDPLLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAA------YSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSS-CTG--TCGHATQILWATTSSIGCGRATC-----NATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            +F+  + F I D    D      +  HNQNRS V+PTA NM  + W+  L   A  W+  C+F+H      A      +++ G+N++ A  P S   + V  AV +W+ E + + Y ++ C     CGH TQ++WA +  +GC   TC          N + ++  C Y   GN  G++ Y+ G SCS C      CE  LC
Sbjct:   25 VFSSEYLFDITDRAFIDE----CVREHNQNRSSVSPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIW-AGAPYS--RFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGS-DKCERNLC 218          
BLAST of Cysteine-rich venom protein vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 95.1301 bits (235), Expect = 3.330e-22
Identity = 61/187 (32.62%), Postives = 90/187 (48.13%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY----------PSSCTG-TCGHATQILWATTSSIGCGRATCNATDPNNE----NILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPD-CENKLC 567
            S+++ +L +HN+ R  V PTA+NM  + W+  LE  A +W+  C ++H  +D     S GQNL +         Y V     AW  E + + Y          P  C+G  C H TQ++WATT+ +GC    C   +   E     + + C Y  +GN +G+  YQ G  CS CP  Y   C + LC
Sbjct:   63 SDREEILKLHNKLRGEVYPTASNMEYMIWDDELERSATSWAEQCQWEHGPQD--LLMSIGQNLAVHWGRYRSPAYHVQ----AWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCPPSYGGVCRDNLC 243          
BLAST of Cysteine-rich venom protein vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 5.434e-24
Identity = 59/176 (33.52%), Postives = 97/176 (55.11%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSC---TGTCGHATQILWATTSSIGCGRATCNATDP-NNENI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
             EK+ +L+ HN  RS   P+A++MIKL W+  LEA+A++++  C+++H    N      G+NL++     S +  DV L +  W KE   + + +        CGH TQ++WA T  +GCG+  C   +  ++EN+ L+ C Y   GN  G++ Y+ G  C+ CP+ +  C   LC
Sbjct:   33 EEKRIILDKHNFYRSQTEPSASDMIKLTWDSALEAMAKSYAEKCIWEH----NKDRGFIGENLFVM----SGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDHV-CIGSLC 199          
BLAST of Cysteine-rich venom protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 99.3673 bits (246), Expect = 1.641e-23
Identity = 60/187 (32.09%), Postives = 93/187 (49.73%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY----------PSSCTG-TCGHATQILWATTSSIGCGRATCNAT----DPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPY-PDCENKLC 567
            ++K+ ++ +HN+ R  V+P+A+NM  + W+  LE  AE W+  C+++H     A   S GQNL +         Y V     +W  E + + Y          P  C+G  C H TQI+WATT+ +GC    C       D     + + C Y  +GN +G+  Y++G  CS CP  Y  +C+N LC
Sbjct:   55 TDKEEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEECIWEHGP--TALLMSIGQNLAVHWGRYRQPAYHVQ----SWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Cysteine-rich venom protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 99.3673 bits (246), Expect = 1.736e-23
Identity = 60/187 (32.09%), Postives = 93/187 (49.73%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY----------PSSCTG-TCGHATQILWATTSSIGCGRATCNAT----DPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPY-PDCENKLC 567
            ++K+ ++ +HN+ R  V+P+A+NM  + W+  LE  AE W+  C+++H     A   S GQNL +         Y V     +W  E + + Y          P  C+G  C H TQI+WATT+ +GC    C       D     + + C Y  +GN +G+  Y++G  CS CP  Y  +C+N LC
Sbjct:   55 TDKEEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEECIWEHGP--TALLMSIGQNLAVHWGRYRQPAYHVQ----SWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Cysteine-rich venom protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 98.9821 bits (245), Expect = 1.904e-23
Identity = 60/187 (32.09%), Postives = 93/187 (49.73%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY----------PSSCTG-TCGHATQILWATTSSIGCGRATCNAT----DPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPY-PDCENKLC 567
            ++K+ ++ +HN+ R  V+P+A+NM  + W+  LE  AE W+  C+++H     A   S GQNL +         Y V     +W  E + + Y          P  C+G  C H TQI+WATT+ +GC    C       D     + + C Y  +GN +G+  Y++G  CS CP  Y  +C+N LC
Sbjct:   55 TDKEEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEECIWEHGP--TALLMSIGQNLAVHWGRYRQPAYHVQ----SWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Cysteine-rich venom protein vs. Ensembl Xenopus
Match: stn1 (STN1, CST complex subunit [Source:Xenbase;Acc:XB-GENE-988862])

HSP 1 Score: 91.2781 bits (225), Expect = 9.213e-22
Identity = 62/180 (34.44%), Postives = 92/180 (51.11%), Query Frame = 1
Query:   49 TDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSY--GQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY---PSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILG--QTLYQSGVSCSNCPTPYPDCENKLC 567
            T + +Q +++ HN  R  VNP+A NM+K+ W++   + A  WS+ C   H        S    G+N+++A+ P S        A+ AW  ESQ F Y   P+S     GH TQ++W  +  +GC  + C     NN+ I + CQY   GN L    T Y+SG +C +CP     C+N LC
Sbjct:   30 TSTVQQVIVDTHNGYRRSVNPSARNMLKMMWSEAAASNAATWSATCPAAHSPTSQRTISGVTCGENIFIASYPASW-----QEAITAWNSESQYFQYGVGPTSSNQVTGHYTQLVWYNSYMVGCAVSNC-----NNQYIYV-CQYCPMGNNLNTITTPYKSGPACGDCPGA---CDNGLC 195          
BLAST of Cysteine-rich venom protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 115.931 bits (289), Expect = 3.040e-31
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTG---TCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LT+ EKQ+M+++HNQ R+ V+P A++M++++W+  L A A+ ++  CV+ H    N      G+NL+  T        DV LAV  W +E + + + ++       CGH TQ++W+ T  IGCG   C       E NI L+ C Y   GN+ G+  YQ G  CS CP  Y  CEN LC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRRGENLFAITDEG----MDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGY-SCENSLC 199          
BLAST of Cysteine-rich venom protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 116.701 bits (291), Expect = 3.288e-31
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSC---TGTCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LT+ EKQ+M+++HNQ R+ V+P A++M++++W+  L A A+ ++  CV+ H    N      G+NL+  T        DV LAV  W +E + + + ++       CGH TQ++W+ T  IGCG   C       E NI L+ C Y   GN+ G+  YQ G  CS CP  Y  CEN LC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRRGENLFAITDEG----MDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGY-SCENSLC 199          
BLAST of Cysteine-rich venom protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 116.701 bits (291), Expect = 3.288e-31
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSC---TGTCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LT+ EKQ+M+++HNQ R+ V+P A++M++++W+  L A A+ ++  CV+ H    N      G+NL+  T        DV LAV  W +E + + + ++       CGH TQ++W+ T  IGCG   C       E NI L+ C Y   GN+ G+  YQ G  CS CP  Y  CEN LC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRRGENLFAITDEG----MDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGY-SCENSLC 199          
BLAST of Cysteine-rich venom protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 117.857 bits (294), Expect = 3.510e-30
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSC---TGTCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LT+ EKQ+M+++HNQ R+ V+P A++M++++W+  L A A+ ++  CV+ H    N      G+NL+  T        DV LAV  W +E + + + ++       CGH TQ++W+ T  IGCG   C       E NI L+ C Y   GN+ G+  YQ G  CS CP  Y  CEN LC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRRGENLFAITDEG----MDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGY-SCENSLC 199          
BLAST of Cysteine-rich venom protein vs. Ensembl Mouse
Match: Glipr1l1 (GLI pathogenesis-related 1 like 1 [Source:MGI Symbol;Acc:MGI:1916536])

HSP 1 Score: 98.5969 bits (244), Expect = 1.078e-24
Identity = 69/189 (36.51%), Postives = 89/189 (47.09%), Query Frame = 1
Query:   31 IVDPLLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQH------PAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYP-SSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENI---LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            I DP   D+     LNIHN+ R  V P A +M +L W+Q L  LA+ W+  C   H        E    Y   G+N+YL        P DV   V+ W  ES+ F +  ++C+  CGH TQ++WA T  IGC  + C    PN +     L  C Y   GN +G   Y  G SCS C      CEN LC
Sbjct:   36 ITDPKFIDA----FLNIHNELRRKVQPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGR--IETQPEDV---VINWYNESKYFNFDFNTCSEMCGHYTQVVWAKTVKIGCAVSNC----PNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMCGQ--KTCENSLC 209          
BLAST of Cysteine-rich venom protein vs. UniProt/SwissProt
Match: sp|Q9ET66|PI16_MOUSE (Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 2.455e-29
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSC---TGTCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LT+ EKQ+M+++HNQ R+ V+P A++M++++W+  L A A+ ++  CV+ H    N      G+NL+  T        DV LAV  W +E + + + ++       CGH TQ++W+ T  IGCG   C       E NI L+ C Y   GN+ G+  YQ G  CS CP  Y  CEN LC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRRGENLFAITDEG----MDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGY-SCENSLC 199          
BLAST of Cysteine-rich venom protein vs. UniProt/SwissProt
Match: sp|Q6UXB8|PI16_HUMAN (Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=PI16 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.328e-28
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGF-VYPSSCTG--TCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LTD EK+ M+ +HN  R+ V+PTA++M+ ++W++ L A A+ ++  CV+ H    N      G+NL+  T        DV LA+  W  E + + +  ++C+    CGH TQ++WA T  IGCG   C       E NI L+ C Y   GN+ G+  YQ G  CS CP+ Y  C+N LC
Sbjct:   28 LTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAYARQCVWGH----NKERGRRGENLFAITDEG----MDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGY-HCKNSLC 197          
BLAST of Cysteine-rich venom protein vs. UniProt/SwissProt
Match: sp|Q58D34|PI16_BOVIN (Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI16 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.563e-27
Identity = 67/178 (37.64%), Postives = 94/178 (52.81%), Query Frame = 1
Query:   49 TDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCTG--TCGHATQILWATTSSIGCGRATCNATDPNNE-NI-LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            ++ EK  M+ +HN  R+ V+P ATNM++++W++ L A A+ ++  CV+ H    N      G+NL+  T        DV LA+  W  E + +   + SC     CGH TQ++WA T  IGCG   C       E NI L+ C Y   GN+ GQ  YQ G  CS CP  Y  C+N LC
Sbjct:   29 SEEEKHVMVELHNLYRTQVSPPATNMLQMRWDEELAAFAKAYAQQCVWGH----NKERGRRGENLFAITGEG----LDVPLAMEEWHHEREHYNLSAISCAAGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEGTPCSQCPLGY-HCKNSLC 197          
BLAST of Cysteine-rich venom protein vs. UniProt/SwissProt
Match: sp|P16562|CRIS2_HUMAN (Cysteine-rich secretory protein 2 OS=Homo sapiens OX=9606 GN=CRISP2 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.331e-25
Identity = 61/177 (34.46%), Postives = 96/177 (54.24%), Query Frame = 1
Query:   61 KQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHP-AEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY---PSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENI--LITCQYWLRGNILGQ--TLYQSGVSCSNCPTPYPDCENKLC 567
            ++ ++N HN+ R  V+P A+NM+K++W++ +   A+ W++ C  QH   ED    +  G+NLY+++ P S +      A+ +W  E   FVY   P S     GH TQ++W +T  +GCG A C    PN +++     CQY   GN + +  T YQ G  C+ CP    DC+  LC
Sbjct:   37 QREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSS-----AIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYC----PNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPD---DCDKGLC 201          
BLAST of Cysteine-rich venom protein vs. UniProt/SwissProt
Match: sp|Q8JI39|CRVP_PROFL (Cysteine-rich venom protein triflin OS=Protobothrops flavoviridis OX=88087 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.516e-25
Identity = 63/178 (35.39%), Postives = 93/178 (52.25%), Query Frame = 1
Query:   61 KQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSY--GQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY-----PSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTL--YQSGVSCSNCPTPYPDCENKLC 567
            +  ++++HN  R  VNPTA+NM+K++W     A AE W+  C+  H + D+        G+N+Y+AT P   T  D+   + AW  E + F Y     PS      GH TQI+W  +   GC  A C ++     +    CQY   GNI+G+T   Y+SG  C +CP+   DC+N LC
Sbjct:   34 QNEIIDLHNSLRRSVNPTASNMLKMEWYPEAAANAERWAYRCIESHSSRDSRVIGGIKCGENIYMATYPAKWT--DI---IHAWHGEYKDFKYGVGAVPSD--AVIGHYTQIVWYKSYRAGCAAAYCPSS---KYSYFYVCQYCPAGNIIGKTATPYKSGPPCGDCPS---DCDNGLC 198          
BLAST of Cysteine-rich venom protein vs. TrEMBL
Match: A0A564YKT8 (SCP domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7413 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.511e-36
Identity = 70/179 (39.11%), Postives = 106/179 (59.22%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCTGTCGHATQILWATTSSIGCGRATCN----ATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            L D+E+  +L+ HN  RS+V+P+A+NM+++ +N TLE+LA+ W + CV++HP   +  YS YGQNL + T     +  ++   V  W KE   + Y + +C+ TCGH TQ++WA +  IGC   TC      +    +   I CQY   GN +GQ  Y++G  CS+CP+ Y  C N LC
Sbjct:   19 LNDTERTQILSDHNGFRSIVSPSASNMLQMSYNTTLESLAQKWVNYCVWKHPGTSDVEYSGYGQNLGMTTA----SSLNLQTIVDMWDKEKADYTYSTNTCSKTCGHYTQVVWAKSLQIGCAYQTCTNFSIGSKTYPKAFFIACQYSPPGNYIGQKPYENGTPCSHCPSGYESCVNNLC 193          
BLAST of Cysteine-rich venom protein vs. TrEMBL
Match: A0A0R3WLM2 (SCP domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1647 PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.695e-32
Identity = 72/185 (38.92%), Postives = 98/185 (52.97%), Query Frame = 1
Query:    7 FTVFFHFQIVDPLLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSY---GQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCTGTCGHATQILWATTSSIGCGRATCNATDP--NNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPY 543
             TV     IV PL TD E+  ML  H   R  V P A+NM+ ++++  LEALA+ W+S C F+HP  D+  Y  Y   GQN+ L    K         AV  W  E + + Y S +C G CGH TQ++WA+++ +GC    C+  +P  +N      CQY   GNI G+  Y+ G SCS CP  Y
Sbjct:   80 LTVLLSASIVCPLPTDVERAQMLEAHLVVREKVYPPASNMLLMEYSSELEALADRWASRCKFEHP--DDRYYPEYKGLGQNIALVGGAKP----SFTEAVCGWKDEVKDYDYFSGTCNGVCGHYTQMVWASSNLVGCAMRQCDYMEPSWSNPQYFTVCQYKPAGNIYGEKPYEYGASCSKCPDGY 258          
BLAST of Cysteine-rich venom protein vs. TrEMBL
Match: A0A0R3ST83 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8581 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.095e-31
Identity = 70/203 (34.48%), Postives = 106/203 (52.22%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKL------------------------QWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCTGTCGHATQILWATTSSIGCGRATCN----ATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            L D+E+  +L+ HN  RS+V+P+A+NM+++                         +N TLE+LA+ W + CV++HP   +  YS YGQNL + T     +  ++   V  W KE   + Y + +C+ TCGH TQ++WA +  IGC   TC      +    +   I CQY   GN +GQ  Y++G  CS+CP+ Y  C N LC
Sbjct:   19 LNDTERTQILSDHNGFRSIVSPSASNMLQMVTVLLSVASAIYLQACLFYYILLQSYNTTLESLAQKWVNYCVWKHPGTSDVEYSGYGQNLGMTTA----SSLNLQTIVDMWDKEKADYTYSTNTCSKTCGHYTQVVWAKSLQIGCAYQTCTNFSIGSKTYPKAFFIACQYSPPGNYIGQKPYENGTPCSHCPSGYESCVNNLC 217          
BLAST of Cysteine-rich venom protein vs. TrEMBL
Match: A0A210PN75 (Peptidase inhibitor 16 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14275 PE=3 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.712e-29
Identity = 62/181 (34.25%), Postives = 105/181 (58.01%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPA--EDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCTGTCGHATQILWATTSSIGCGRATCNATDPNNE----NILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            L++ +KQ +++ HN+ RS V+P A NM+K+ W+  L  +A++++  CV+ H A   D  ++S  G+NL+L +       Y+ +  V +W+ E + + Y +  CT  CGH TQ++W  +  +GCG A CN+    +     ++++ C Y   GN  G T Y  G SCS+CP+    C+N+LC
Sbjct:   53 LSEGQKQDLVDYHNKARSEVSPRAANMLKMSWSNELATVAQSYAERCVWSHNAARSDAPSFSYVGENLFLTS-----GTYNGEGVVDSWVSEVKNYNYATLGCTSVCGHYTQVVWHDSEFVGCGAARCNSVSGLSSGWTNSVIVVCNYGKGGNYRGATPYTQGKSCSSCPSGKV-CQNRLC 227          
BLAST of Cysteine-rich venom protein vs. TrEMBL
Match: A0A0R3WJL8 (SCP domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS874 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.135e-29
Identity = 73/195 (37.44%), Postives = 106/195 (54.36%), Query Frame = 1
Query:    1 LIFTVFFHFQIVDPLLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHP-AEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCT-GT-CGHATQILWATTSSIGCGRATCNATDPN--NENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LI T+     +     T+ E++ +L+ HN  R+ VNP+ATNM+++ ++  LE LA +W + C F+HP +     Y+  GQNL L          ++      W  E  G+ Y S +CT GT CGH  Q++WAT+  +GC    C++  PN  +   L+TCQY   GN +G   Y SG+SCS CP     C NKLC
Sbjct:    4 LICTLLLVSLVASEAPTEQERKDLLDFHNNKRATVNPSATNMLEMVYSAELEKLAIDWVAKCKFEHPNSSQYPQYNGIGQNLALTGG----VGRNLVSQATQWWNEVSGYTYGSNACTVGTVCGHYIQMVWATSEELGCAVKQCDSLMPNWPSPVFLLTCQYKPAGNYIGIRPYTSGISCSQCPVG-TTCVNKLC 193          
BLAST of Cysteine-rich venom protein vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 107.842 bits (268), Expect = 4.081e-28
Identity = 57/178 (32.02%), Postives = 95/178 (53.37%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQH-PAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGT---CGHATQILWATTSSIGCGRATCNATDP---NNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
             ++Q ++N+HN +RS V P A +MI ++W+  L  +A+ +++ C+++H P   N      G+NL++ T      P D++ A+  W  E + + Y ++       CGH TQ++WA T  +GCG   C   +     N  +L+ C Y   GN +GQ  YQ G  CS CP    +C ++ C
Sbjct:   28 EDQQRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNIM----GENLFITT-----GPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLV-CNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Cysteine-rich venom protein vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 107.071 bits (266), Expect = 6.513e-28
Identity = 57/178 (32.02%), Postives = 95/178 (53.37%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQH-PAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGT---CGHATQILWATTSSIGCGRATCNATDP---NNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
             ++Q ++N+HN +RS V P A +MI ++W+  L  +A+ +++ C+++H P   N      G+NL++ T      P D++ A+  W  E + + Y ++       CGH TQ++WA T  +GCG   C   +     N  +L+ C Y   GN +GQ  YQ G  CS CP    +C ++ C
Sbjct:   28 EDQQRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNIM----GENLFITT-----GPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLV-CNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Cysteine-rich venom protein vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 107.071 bits (266), Expect = 1.326e-27
Identity = 57/178 (32.02%), Postives = 95/178 (53.37%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQH-PAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGT---CGHATQILWATTSSIGCGRATCNATDP---NNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
             ++Q ++N+HN +RS V P A +MI ++W+  L  +A+ +++ C+++H P   N      G+NL++ T      P D++ A+  W  E + + Y ++       CGH TQ++WA T  +GCG   C   +     N  +L+ C Y   GN +GQ  YQ G  CS CP    +C ++ C
Sbjct:   28 EDQQRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNIM----GENLFITT-----GPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLV-CNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Cysteine-rich venom protein vs. Ensembl Cavefish
Match: r3hdml (R3H domain containing like [Source:NCBI gene;Acc:103046222])

HSP 1 Score: 103.219 bits (256), Expect = 2.116e-26
Identity = 61/178 (34.27%), Postives = 98/178 (55.06%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLAT-RPKSITPYDVDLAVLAWIKESQGFVYPSSCTGT-CGHATQILWATTSSIGCGRATCNAT----DPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENK 561
            ++  +  ++L  HN+ RS V P A NM  + W++ L   AE+W+S C++ H       Y   GQNL +++ R +S+    ++L V +W  E   F YP+ CTG+ C H TQ++WA+T+ IGC    C+          +  L+ C Y ++GN +G+  Y++G  CS CP+ Y    NK
Sbjct:   62 VSSRDMTALLEYHNRVRSQVFPPAANMEYMVWDERLAKSAESWASQCIWDHGPSHVMKY--MGQNLSISSGRYRSV----IEL-VRSWHDEKNSFSYPNRCTGSVCSHYTQMVWASTNRIGCAINRCSNMYVFGSTWKQATLLVCNYSIKGNWVGEAPYKTGKPCSACPSVYGGSCNK 232          
BLAST of Cysteine-rich venom protein vs. Ensembl Cavefish
Match: ENSAMXT00000032496.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:32321795:32342374:-1 gene:ENSAMXG00000031919.1 transcript:ENSAMXT00000032496.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 1.310e-24
Identity = 59/175 (33.71%), Postives = 88/175 (50.29%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSY--GQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGT--CGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            S +  ++N+HN  R  V+P+ATNM+K+ W++     A+NW++ C   H         +Y  G+NL+ +T     T       V AW  E   +VYP+    T   GH TQ++W ++ S+GCG A C +      N    C Y+  GN  G   Y  G SC+ CP     C++KLC
Sbjct:   41 SVQDEIVNLHNVFRRGVSPSATNMLKMNWSREAAVSAQNWANTCSMVHGDPSTRMLGTYQMGENLFKSTGMVKWTS-----VVTAWHNEVANYVYPTGSANTQPIGHYTQVVWYSSYSVGCGAAKCGS------NYFYVCHYYRAGNFKGVAPYTQGQSCAACPGA---CDDKLC 201          
BLAST of Cysteine-rich venom protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 1.157e-21
Identity = 57/192 (29.69%), Postives = 88/192 (45.83%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS----------SCTG-TCGHATQILWATTSSIGCGRATC------NATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPY-PDCENKLC 567
            + D E++++   HN+ R+ V+P A +M  + W+  L  +AE W+  C + H   D     + GQNL +    +    Y V     AW  E + + YP           +C G  C H TQ++WA +  +GC   TC      +A  P    + + C Y  +GN +G+  Y+ G  CS CP  Y   C   LC
Sbjct:    1 IADDERRALTEYHNRLRASVHPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSDQ--LDAIGQNLAVYVGSERPLAYHVQ----AWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPY--ALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of Cysteine-rich venom protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 9.219e-18
Identity = 55/179 (30.73%), Postives = 83/179 (46.37%), Query Frame = 1
Query:   79 IHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSS----------CTGT-CGHATQILWATTSSIGCGRATCNATDPNNE----NILITCQYWLRGNILGQTLYQSGVSCSNCPTPY-PDCENKLC 567
            +HN+ R  V+P ++NM  + W + L   A  +   C+     +  A     GQ  +L+ RP S         V AW  E++ + YP            C G  C H TQ++WATT+ +GC   TC   +   +     + + C Y  +GN +G + Y+SG +CS CP  Y   C N LC
Sbjct:    2 LHNKLRGEVHPPSSNMEYMAWVKKLIKEAARYPGRCLRL--MQPMAMIHFLGQPHWLSHRPPS-------FHVQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRNNLC 171          
BLAST of Cysteine-rich venom protein vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 75.485 bits (184), Expect = 9.314e-17
Identity = 51/174 (29.31%), Postives = 86/174 (49.43%), Query Frame = 1
Query:   70 MLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSY--GQNLYLATRPKSITPYDVDLAVLAWIKE--SQGFVYP--SSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQ--TLYQSGVSCSNCPTPYPDCENKLC 567
            ++++HN  R  V P+A NM+++ W +     A +W++ C F H  +     + +  G+N+++++      P+  + A+  W  E  S GF Y   S+ TG  GH TQ++W  +  +GC    C   +P     L  C Y   GN+  +    Y  G SC++CP    +C N LC
Sbjct:   47 IVDLHNDLRRNVTPSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWTCGENIFMSS-----APFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYC-PKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTSCASCPK---NCVNNLC 211          
BLAST of Cysteine-rich venom protein vs. Ensembl Sea Lamprey
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 60.4622 bits (145), Expect = 4.433e-11
Identity = 47/169 (27.81%), Postives = 75/169 (44.38%), Query Frame = 1
Query:   58 EKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSL-CVFQHPAEDNAA-----------------YSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCT--GTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTL 501
            E  ++ ++HN+ R+ V P+A NM K++W+ +L  +A  W+++ C     AE  +A                        + L   P   T +   LA  +W  E Q + Y    C    TC H TQ++WA+ S +GC +  C   DP +      C Y L GN +  +L
Sbjct:   49 EAFALESLHNKLRATVQPSAANMEKMEWDDSLAQVAHEWAAVACENPRAAEGTSAEIPEKPGIQGTGAGGRGGGQRRLGVNLHRAPHGATSFASVLA--SWFSEGQNYDYARPGCAHNRTCRHYTQMVWASASRVGCAKRWCR--DPGSRVEAFACVY-LPGNDVRLSL 212          
BLAST of Cysteine-rich venom protein vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 48.9062 bits (115), Expect = 8.018e-8
Identity = 38/118 (32.20%), Postives = 55/118 (46.61%), Query Frame = 1
Query:  232 GQNLYLATRPKSITPYDVDLAVLAWIKESQ--GFVYPS--SCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQ--TLYQSGVSCSNCPTPYPDCENKLC 567
            G+N++LAT P S        AVL W  E++  GF++    +  G  GH TQ++W ++  +GC    C          +  C Y   GN+  +    Y  G  C +CP    DCEN LC
Sbjct:    2 GENIFLATAPLSWQD-----AVLDWYNEAEVPGFIFGKGPAAPGDIGHYTQVVWYSSFQLGCAVNYCPEAI---YKYVYVCHYCPAGNLNTRLSRPYNEGSPCRSCPN---DCENDLC 108          
BLAST of Cysteine-rich venom protein vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 58.151 bits (139), Expect = 1.239e-10
Identity = 43/146 (29.45%), Postives = 67/146 (45.89%), Query Frame = 1
Query:   67 SMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSS--YGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQ 495
            SM+N HN  R++   T +    L W+ TL   A+N++      +    N  +S   YG+NL L         Y    +V AW  E   + Y +   + + GH TQ++W  TS +GCG  +C     +     I C Y   GN++G+
Sbjct:  195 SMVNEHNTKRALHKDTGS----LTWSDTLATYAQNYAD----SYDCSGNLVHSGGPYGENLALG--------YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGD----YIICSYKAAGNVIGE 320          
BLAST of Cysteine-rich venom protein vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 51.6026 bits (122), Expect = 3.434e-8
Identity = 47/150 (31.33%), Postives = 67/150 (44.67%), Query Frame = 1
Query:   61 KQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSS----LCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQ 495
            +  +LN HN+ R++   TA     L W+ TL   A+N++       V  H      +   YG+NL L         Y    AV AW  E   + Y +   + + GH TQ++W +T+ IGCG   C  T     N  I C Y   GN LG+
Sbjct:   26 ESDVLNEHNKFRALHVDTA----PLTWSDTLATYAQNYADQYDCSGVLTH------SDGPYGENLALG--------YTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTT----WNNYIVCSYNPPGNYLGE 153          
BLAST of Cysteine-rich venom protein vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 48.1358 bits (113), Expect = 2.870e-7
Identity = 40/147 (27.21%), Postives = 61/147 (41.50%), Query Frame = 1
Query:   70 MLNIHNQNRSMVNPTATNMIKLQWNQTL----EALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPS-SCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQ 495
            +L  HN+ R++   T      L W+ TL    +  A+N+       H          YG+NL L         YD   AV AW  E   + + +   +   GH TQ++W +T+ +GCG  TC     +     + C Y   GN  G+
Sbjct:  166 VLAEHNKKRALHKDTPA----LSWSDTLASYAQDYADNYDCSGTLTHSG------GPYGENLALG--------YDGPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGD----YVICSYDPAGNYEGE 290          
BLAST of Cysteine-rich venom protein vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 45.8246 bits (107), Expect = 1.573e-6
Identity = 36/147 (24.49%), Postives = 67/147 (45.58%), Query Frame = 1
Query:   61 KQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVY--PSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQ 495
            K  +L  HN  R+     A     L+WN  L + A++W+   + Q  A  +++   YG+++   +          D+    W  E   + +  P   T + GH TQ++WA ++ +G G+AT ++         +  +Y   GN++GQ
Sbjct:    3 KNDILKTHNDYRAQHGTKA-----LKWNARLASEAQSWAE-NLAQRNAIQHSSSREYGESIAYMSGAVLTGRKATDM----WYGEVDKYRFENPGFST-SSGHFTQVVWAGSTEMGAGKATSSSGAH-----FVVARYTPPGNVMGQ 133          
BLAST of Cysteine-rich venom protein vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 46.9802 bits (110), Expect = 2.727e-6
Identity = 37/142 (26.06%), Postives = 63/142 (44.37%), Query Frame = 1
Query:   13 VFFHFQIVDPLLTDSEKQS-MLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCV----FQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTG-TCGHATQILWATTSSIGCGRATC 420
            V    + +  L  D + +S +L+IHN  R+M      N   L+W+  L   A+ W+         +H + ++  Y   G+N+   +       +D+  A+  W  ES+ + Y +     T GH TQI+W  T  +G G A  
Sbjct:  197 VRMDIKTLGALPVDEDTRSRILDIHNNYRAM-----HNAAPLRWSAALAKDAQAWAGKLAREGRLEHASREDRYYK--GENICRMSHH-----FDIGDALQIWYNESESYQYDNPGFALTTGHFTQIVWRGTREVGVGFAKS 326          
BLAST of Cysteine-rich venom protein vs. Ensembl Nematostella
Match: EDO44787 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ3])

HSP 1 Score: 45.8246 bits (107), Expect = 4.251e-6
Identity = 45/160 (28.12%), Postives = 64/160 (40.00%), Query Frame = 1
Query:   73 LNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNA---------AYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCT---GTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGV 516
            L  HN  R +++ TA     L WN  +   A  ++     +  AEDN          A +S G+NLY +      T    D AV AW  E + + Y           GH TQ++W  ++ +G G A             I  +Y   GNI GQ  Y + V
Sbjct:   90 LAAHNHKR-VLHGTA----GLSWNAQMAEEAAKYA-----KKLAEDNKDTTRVSLNHASTSDGENLYYSGTSSGHTARCTD-AVSAWYNEIKDYDYNDYTNHPGAMIGHFTQVVWKGSTQVGVGAAKVKVN--GMTRTFIVARYRAAGNIRGQRYYDANV 236          
BLAST of Cysteine-rich venom protein vs. Ensembl Nematostella
Match: EDO37114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM4])

HSP 1 Score: 43.8986 bits (102), Expect = 9.681e-6
Identity = 41/150 (27.33%), Postives = 62/150 (41.33%), Query Frame = 1
Query:   73 LNIHNQNRSMVNPTATNMIKLQWNQTLEALAENW----SSLCVFQHPAEDNAAYSSYGQNLYLA----TRPKSITPYDVDLAVLAWIKESQGFVYPSSC-TGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQ 495
            L  HN+ R           ++ W+ +L A A+ W    S    F+H   D A+ +S  Q   LA     +P +    D   A  AW  ES  + Y ++  +   GH TQ++W  T  +G G A     D       +  ++   GNI GQ
Sbjct:    6 LEAHNEYRKRHGAK-----EMTWSASLAADAQKWADKLSQTDAFKH---DYASINSKSQGENLAYFTPQKPNNTAIMD---AFDAWYDESSKYDYANAKFSKETGHFTQLVWKATQKMGIGTAKNAKGDKE----YVVARFSPAGNIKGQ 140          
BLAST of Cysteine-rich venom protein vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 100.523 bits (249), Expect = 1.173e-24
Identity = 61/181 (33.70%), Postives = 93/181 (51.38%), Query Frame = 1
Query:   43 LLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYP-SSC--TGTCGHATQILWATTSSIGCGRATCNAT---DPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            LLTD +++ ++ +HN  R  V+P+A  M+ L+W+  L+ +AE +++ C+++H    N      G+NL+  T        D+  AV  W  E   + Y  +SC     CGH TQ++WA T  +GC    CN     D NN + L+ C Y+  GN   +  Y  G  CS CP     C+N LC
Sbjct:   56 LLTDQQEEMLVELHNHYRGQVSPSAAAMLPLKWDGNLKLVAEGYAAKCIWEH----NTELEDTGENLFAGT-----GKLDLSEAVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLV-CNYFPAGNYDDERPYVEGDWCSRCPEDLDVCQNHLC 226          
BLAST of Cysteine-rich venom protein vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 88.5817 bits (218), Expect = 3.946e-21
Identity = 54/176 (30.68%), Postives = 86/176 (48.86%), Query Frame = 1
Query:   61 KQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSY--GQNLYLATRP---KSITPYDVDLAVLAWIKESQGFVYPSSCTG--TCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            +  ++++HN  R  V P A +M+ + +++ L   A+ W   CV  H    +   + Y  G+NL+ +T P   KSI        + AW KE   F +P++ T     GH TQ++W ++  +GCG   C     +N   L  C Y+  GN      Y+ G  C++CP    DC +KLC
Sbjct:   16 QAEIVDVHNAFRRAVEPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYELGENLFYSTSPMLWKSI--------INAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLC-----SNNIYLYGCHYYRAGNFKRWPPYKVGTPCASCPN---DCVDKLC 175          
BLAST of Cysteine-rich venom protein vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 92.0485 bits (227), Expect = 4.044e-21
Identity = 61/188 (32.45%), Postives = 91/188 (48.40%), Query Frame = 1
Query:   55 SEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLA-TRPKSITPYDVDLAVLAWIKESQGFVY----------PSSCTG-TCGHATQILWATTSSIGCGRATCNATDPNNE----NILITCQYWLRGNILGQTLYQSGVSCSNCPTPY-PDCENKLC 567
            S+++ +L +HN+ RS V P+A NM  + W+  LE  A  W+  C ++H  +D     S GQNL +   R +S         V AW  E + + Y          P  C+G  C H TQ++WATT+ +GC    C   +   E     + + C Y  +GN +G+  Y+ G  CS CP  +   C N LC
Sbjct:   74 SDREEILLLHNKLRSSVYPSAANMEHMVWDDELERSATQWAEECRWEHGPQD--LLMSIGQNLAVHWGRYRSPA-----FHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRNNLC 254          
BLAST of Cysteine-rich venom protein vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 92.0485 bits (227), Expect = 4.437e-21
Identity = 63/194 (32.47%), Postives = 94/194 (48.45%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQH-PAEDNAAYSSYGQNL---YLATRPKSITPYDVDLAVLAWIKESQGFVYPS----------SCTG-TCGHATQILWATTSSIGCGRATCNATDPNNE----NILITCQYWLRGNILGQTLYQSGVSCSNCPTPY-PDCENKLC 567
            +TDS+ Q +L++HN+ R  V P A+NM  + W+  LE  AE W+  C+++H PA   +     GQNL   +   +P +         V AW  E + + +P            C+G  C H TQ++WAT+S IGC    C+  D   +     + + C Y  +GN  G   Y+ G  CS CP  Y   C + LC
Sbjct:   84 ITDSDAQLILDLHNKLRGQVYPPASNMEYMMWDTELERSAEEWAETCLWEHGPA---SLLPQIGQNLGAHWGRYQPPT-------FHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLC 267          
BLAST of Cysteine-rich venom protein vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 91.2781 bits (225), Expect = 6.052e-21
Identity = 63/194 (32.47%), Postives = 94/194 (48.45%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQH-PAEDNAAYSSYGQNL---YLATRPKSITPYDVDLAVLAWIKESQGFVYPS----------SCTG-TCGHATQILWATTSSIGCGRATCNATDPNNE----NILITCQYWLRGNILGQTLYQSGVSCSNCPTPY-PDCENKLC 567
            +TDS+ Q +L++HN+ R  V P A+NM  + W+  LE  AE W+  C+++H PA   +     GQNL   +   +P +         V AW  E + + +P            C+G  C H TQ++WAT+S IGC    C+  D   +     + + C Y  +GN  G   Y+ G  CS CP  Y   C + LC
Sbjct:   56 ITDSDAQLILDLHNKLRGQVYPPASNMEYMMWDTELERSAEEWAETCLWEHGPA---SLLPQIGQNLGAHWGRYQPPT-------FHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLC 239          
BLAST of Cysteine-rich venom protein vs. Planmine SMEST
Match: SMESG000044051.1 (SMESG000044051.1)

HSP 1 Score: 401.749 bits (1031), Expect = 2.600e-144
Identity = 209/209 (100.00%), Postives = 209/209 (100.00%), Query Frame = 1
Query:   70 MLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLCXXXXXXXXXXXXXXXXPRNYTPKHVFHKFLNLLLFWIAILSRQ 696
            MLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLCTKSIASGTISIISGTTPRNYTPKHVFHKFLNLLLFWIAILSRQ
Sbjct:    1 MLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLCTKSIASGTISIISGTTPRNYTPKHVFHKFLNLLLFWIAILSRQ 209          
BLAST of Cysteine-rich venom protein vs. Planmine SMEST
Match: SMESG000044056.1 (SMESG000044056.1)

HSP 1 Score: 165.236 bits (417), Expect = 6.818e-51
Identity = 80/189 (42.33%), Postives = 109/189 (57.67%), Query Frame = 1
Query:   13 VFF--HFQIVDPLLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNL-YLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCT-GTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            VFF   FQ+    L+D E   M+  HN NRS V P ATNM + +W+  L  LA+ WS  C+++HP EDN  Y+ YGQNL Y  T P ++     + AV++W +E Q F YP +C+ G CGH TQ +WA T  +GCG+A C         + +TCQY+ RGN      Y++G  CS CP  +  C+  LC
Sbjct:    8 VFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPDALG--TAEKAVISWSEEIQYFTYPITCSGGVCGHYTQNIWADTYEVGCGKAICKGQSAATSKLFVTCQYYPRGNYKDTAPYETGTPCSKCPETHKVCKKNLC 194          
BLAST of Cysteine-rich venom protein vs. Planmine SMEST
Match: SMESG000044056.1 (SMESG000044056.1)

HSP 1 Score: 163.696 bits (413), Expect = 1.964e-50
Identity = 77/186 (41.40%), Postives = 106/186 (56.99%), Query Frame = 1
Query:   16 FFHFQIVDPLLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNL-YLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCT-GTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
               FQ+    L+D E   M+  HN NRS V P ATNM + +W+  L  LA+ WS  C+++HP EDN  Y+ YGQNL Y  T P ++     + AV++W +E Q F YP +C+ G CGH TQ +WA T  +GCG+A C         + +TCQY+ RGN      Y++G  CS CP  +  C+  LC
Sbjct:    1 MIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPDALG--TAEKAVISWSEEIQYFTYPITCSGGVCGHYTQNIWADTYEVGCGKAICKGQSAATSKLFVTCQYYPRGNYKDTAPYETGTPCSKCPETHKVCKKNLC 184          
BLAST of Cysteine-rich venom protein vs. Planmine SMEST
Match: SMESG000044056.1 (SMESG000044056.1)

HSP 1 Score: 159.844 bits (403), Expect = 5.669e-49
Identity = 75/176 (42.61%), Postives = 103/176 (58.52%), Query Frame = 1
Query:   46 LTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNL-YLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCT-GTCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            L+D E   M+  HN NRS V P ATNM + +W+  L  LA+ WS  C+++HP EDN  Y+ YGQNL Y  T P ++     + AV++W +E Q F YP +C+ G CGH TQ +WA T  +GCG+A C         + +TCQY+ RGN      Y++G  CS CP  +  C+  LC
Sbjct:    6 LSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPDALG--TAEKAVISWSEEIQYFTYPITCSGGVCGHYTQNIWADTYEVGCGKAICKGQSAATSKLFVTCQYYPRGNYKDTAPYETGTPCSKCPETHKVCKKNLC 179          
BLAST of Cysteine-rich venom protein vs. Planmine SMEST
Match: SMESG000044061.1 (SMESG000044061.1)

HSP 1 Score: 148.288 bits (373), Expect = 2.964e-44
Identity = 75/192 (39.06%), Postives = 111/192 (57.81%), Query Frame = 1
Query:    1 LIFTVFFHFQIVDPLLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTGTCGHATQILWATTSSIGCGRATC---NATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLC 567
            +IF ++F  +  + LL  +E++ +LN+HN  R+ V P ++NM K+ WNQTL  LA N S  C    P ++N+ +S YG N+Y +   KS T  D+     +W+ E + F+YP  CTG C + TQI+W++++ +GC    C   N++     NI +TC YW +GNI G   Y SG  CS CP     C  KLC
Sbjct:    1 MIFAIYF--RNGNFLLNKNERKLILNLHNNYRNNVKPQSSNMTKMTWNQTLYNLALNISWNCSLDFPGKNNSEFSEYGINMYFSIMSKS-TVKDIHKTFESWVSEEKNFMYPFKCTGNCMNYTQIVWSSSTQLGCNDNMCFMKNSSKIRKWNIFLTCLYWPKGNIFGMVPYGSGKPCSKCPKKMAYCVYKLC 189          
The following BLAST results are available for this feature:
BLAST of Cysteine-rich venom protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI162.765e-2937.43peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI162.765e-2937.43peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI162.765e-2937.43peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
CRISP22.771e-2634.46cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP22.771e-2634.46cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-78.058e-2735.08SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-81.188e-2534.38SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-12.817e-2332.00SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-103.568e-2332.37SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-56.858e-2232.97SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84835.892e-1830.11gene:FBgn0038126 transcript:FBtr0082782[more]
CG94005.109e-925.00gene:FBgn0030562 transcript:FBtr0073920[more]
CG326792.409e-726.40gene:FBgn0052679 transcript:FBtr0071469[more]
Ag5r9.012e-626.92gene:FBgn0015010 transcript:FBtr0333658[more]
Ag5r9.012e-626.92gene:FBgn0015010 transcript:FBtr0073937[more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
r3hdml2.687e-2634.64R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml2.687e-2634.64R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
glipr1a4.396e-2631.68GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
glipr1a1.395e-2531.68GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
crispld23.330e-2232.62cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036788.15.434e-2433.52pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
crispld21.641e-2332.09cysteine-rich secretory protein LCCL domain contai... [more]
crispld21.736e-2332.09cysteine-rich secretory protein LCCL domain contai... [more]
crispld21.904e-2332.09cysteine-rich secretory protein LCCL domain contai... [more]
stn19.213e-2234.44STN1, CST complex subunit [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi163.040e-3137.43peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi163.288e-3137.43peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi163.288e-3137.43peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi163.510e-3037.43peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Glipr1l11.078e-2436.51GLI pathogenesis-related 1 like 1 [Source:MGI Symb... [more]
back to top
BLAST of Cysteine-rich venom protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ET66|PI16_MOUSE2.455e-2937.43Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN... [more]
sp|Q6UXB8|PI16_HUMAN1.328e-2837.43Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q58D34|PI16_BOVIN1.563e-2737.64Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI... [more]
sp|P16562|CRIS2_HUMAN1.331e-2534.46Cysteine-rich secretory protein 2 OS=Homo sapiens ... [more]
sp|Q8JI39|CRVP_PROFL9.516e-2535.39Cysteine-rich venom protein triflin OS=Protobothro... [more]
back to top
BLAST of Cysteine-rich venom protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YKT82.511e-3639.11SCP domain-containing protein (Fragment) OS=Hymeno... [more]
A0A0R3WLM27.695e-3238.92SCP domain-containing protein OS=Hydatigena taenia... [more]
A0A0R3ST833.095e-3134.48SCP domain-containing protein OS=Hymenolepis dimin... [more]
A0A210PN751.712e-2934.25Peptidase inhibitor 16 OS=Mizuhopecten yessoensis ... [more]
A0A0R3WJL82.135e-2937.44SCP domain-containing protein OS=Hydatigena taenia... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031557.14.081e-2832.02peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000036030.16.513e-2832.02peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.11.326e-2732.02peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
r3hdml2.116e-2634.27R3H domain containing like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000032496.11.310e-2433.71pep primary_assembly:Astyanax_mexicanus-2.0:18:323... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.11.157e-2129.69pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
ENSPMAT00000002250.19.219e-1830.73pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP39.314e-1729.31cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
CLEC18A4.433e-1127.81C-type lectin domain family 18 member A [Source:HG... [more]
CRISP28.018e-832.20cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY21.239e-1029.45Sterol binding protein involved in the export of a... [more]
PRY33.434e-831.33Cell wall-associated protein involved in export of... [more]
PRY12.870e-727.21Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO488811.573e-624.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493102.727e-626.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447874.251e-628.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371149.681e-627.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.21.173e-2433.70peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000020676.23.946e-2130.68cysteine-rich venom protein pseudecin-like [Source... [more]
crispld24.044e-2132.45cysteine rich secretory protein LCCL domain contai... [more]
crispld1a4.437e-2132.47cysteine rich secretory protein LCCL domain contai... [more]
crispld1a6.052e-2132.47cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Cysteine-rich venom protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044051.12.600e-144100.00SMESG000044051.1[more]
SMESG000044056.16.818e-5142.33SMESG000044056.1[more]
SMESG000044056.11.964e-5041.40SMESG000044056.1[more]
SMESG000044056.15.669e-4942.61SMESG000044056.1[more]
SMESG000044061.12.964e-4439.06SMESG000044061.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024253 ID=SMED30024253|Name=Cysteine-rich venom protein|organism=Schmidtea mediterranea sexual|type=transcript|length=698bp
TTAATTTTTACTGTTTTCTTTCACTTCCAAATTGTTGATCCTTTATTAAC
GGATTCTGAAAAACAATCAATGCTAAACATACATAATCAGAATCGAAGTA
TGGTCAATCCAACCGCAACCAATATGATAAAACTACAATGGAATCAAACT
CTTGAAGCATTGGCAGAAAACTGGAGTTCTCTGTGCGTATTTCAGCACCC
AGCCGAGGACAATGCTGCTTATTCTAGTTATGGGCAAAACCTGTACTTAG
CAACTCGACCTAAATCCATTACTCCATATGATGTAGATTTGGCCGTTTTA
GCCTGGATTAAAGAATCTCAAGGCTTTGTTTATCCCTCTTCCTGCACTGG
GACTTGTGGTCACGCTACTCAAATACTTTGGGCAACAACCTCCAGTATTG
GCTGCGGCAGAGCGACTTGCAATGCTACTGATCCTAATAATGAGAATATC
TTGATAACCTGCCAATATTGGCTCAGAGGAAATATTTTAGGACAAACACT
TTATCAAAGTGGAGTATCATGTTCGAATTGCCCAACACCATATCCTGATT
GTGAGAATAAGCTTTGCACTAAGTCCATCGCGTCTGGGACTATTTCTATT
ATATCTGGAACTACACCAAGAAATTATACACCAAAACATGTATTTCATAA
ATTTTTGAATCTTCTCTTATTTTGGATAGCTATTTTATCTAGACAACC
back to top

protein sequence of SMED30024253-orf-1

>SMED30024253-orf-1 ID=SMED30024253-orf-1|Name=SMED30024253-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=232bp
LIFTVFFHFQIVDPLLTDSEKQSMLNIHNQNRSMVNPTATNMIKLQWNQT
LEALAENWSSLCVFQHPAEDNAAYSSYGQNLYLATRPKSITPYDVDLAVL
AWIKESQGFVYPSSCTGTCGHATQILWATTSSIGCGRATCNATDPNNENI
LITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLCTKSIASGTISI
ISGTTPRNYTPKHVFHKFLNLLLFWIAILSRQ
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0090729toxin activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR014044CAP_domain
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 226..232
NoneNo IPR availablePANTHERPTHR10334:SF344AT27079P-RELATEDcoord: 16..187
NoneNo IPR availableCDDcd05380CAP_eukcoord: 21..157
e-value: 1.44263E-34
score: 118.711
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 98..111
score: 32.48
coord: 119..135
score: 52.01
coord: 151..164
score: 39.32
coord: 45..63
score: 28.53
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 16..187
IPR014044CAP domainSMARTSM00198SCP_3coord: 19..164
e-value: 3.5E-41
score: 152.8
IPR014044CAP domainPFAMPF00188CAPcoord: 25..156
e-value: 1.5E-18
score: 67.8
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 8..197
e-value: 2.2E-48
score: 166.4
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 15..171