Peptidase M60 domain-containing protein

Overview
NamePeptidase M60 domain-containing protein
Smed IDSMED30024252
Length (bp)3335
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024252

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30024252SMESG000026355.1 SMESG000026354.1 SmedASXL_017424SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30024252SMESG000026355.1 SMESG000026354.1 SmedASXL_017424SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30024252SMESG000026355.1 SMESG000026354.1 dd_Smed_v4_9120_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024252SMESG000026355.1 SMESG000026354.1 dd_Smed_v4_9120_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30024252SMESG000026355.1 SMESG000026354.1 Contig49803newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024252SMESG000026355.1 SMESG000026354.1 Contig49803uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 135.576 bits (340), Expect = 9.693e-32
Identity = 90/296 (30.41%), Postives = 143/296 (48.31%), Query Frame = 3
Query: 2202 VEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIF------TLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            V +T    V  P + +  K  +++W  + Q  ++PW  +A+D ++  + +  ++ L DP   L L+D M++    L        R E + AD+QI AG+MHSGYPI   +  V    NE D       +   G WG +HE+GHN Q   + F     E T N++      T++ I       + SP     PE+   + +  H+  G    +W  N + AL  Y Q + +FGWE F Q+F  Y  L +   +  +  ++ LW+K  SE    NL P +E W WPI ++ A+ L+ L
Sbjct:  523 VPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSP-----PER--ERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPKD--NTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 799          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 135.576 bits (340), Expect = 9.693e-32
Identity = 90/296 (30.41%), Postives = 143/296 (48.31%), Query Frame = 3
Query: 2202 VEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIF------TLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            V +T    V  P + +  K  +++W  + Q  ++PW  +A+D ++  + +  ++ L DP   L L+D M++    L        R E + AD+QI AG+MHSGYPI   +  V    NE D       +   G WG +HE+GHN Q   + F     E T N++      T++ I       + SP     PE+   + +  H+  G    +W  N + AL  Y Q + +FGWE F Q+F  Y  L +   +  +  ++ LW+K  SE    NL P +E W WPI ++ A+ L+ L
Sbjct:  523 VPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSP-----PER--ERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPKD--NTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 799          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 135.961 bits (341), Expect = 9.764e-32
Identity = 90/296 (30.41%), Postives = 143/296 (48.31%), Query Frame = 3
Query: 2202 VEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNG-VGEVTNNIF------TLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            V +T    V  P + +  K  +++W  + Q  ++PW  +A+D ++  + +  ++ L DP   L L+D M++    L        R E + AD+QI AG+MHSGYPI   +  V    NE D       +   G WG +HE+GHN Q   + F     E T N++      T++ I       + SP     PE+   + +  H+  G    +W  N + AL  Y Q + +FGWE F Q+F  Y  L +   +  +  ++ LW+K  SE    NL P +E W WPI ++ A+ L+ L
Sbjct:  627 VPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSP-----PER--ERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPKD--NTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2C (TRPM8 channel associated factor 2C [Source:HGNC Symbol;Acc:HGNC:53641])

HSP 1 Score: 134.42 bits (337), Expect = 1.496e-31
Identity = 90/296 (30.41%), Postives = 143/296 (48.31%), Query Frame = 3
Query: 2202 VEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNG-VGEVTNNIF------TLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            V +T    V  P + +  K  +++W  + Q  ++PW  +A+D ++  + +  ++ L DP   L L+D M++    L        R E + AD+QI AG+MHSGYPI   +  V    NE D       +   G WG +HE+GHN Q   + F     E T N++      T++ I       + SP     PE+   + +  H+  G    +W  N + AL  Y Q + +FGWE F Q+F  Y  L +   +  +  ++ LW+K  SE    NL P +E W WPI ++ A+ L+ L
Sbjct:  420 VPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQWHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSP-----PER--ERRIKAHLGKGAPLCDW--NVWTALETYLQLQQAFGWEPFTQLFAEYQTLSHLPKD--NTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 696          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF1 (TRPM8 channel associated factor 1 [Source:HGNC Symbol;Acc:HGNC:22201])

HSP 1 Score: 116.701 bits (291), Expect = 8.073e-26
Identity = 97/378 (25.66%), Postives = 168/378 (44.44%), Query Frame = 3
Query: 1971 GIYAIPRVDISVKITQSK-SQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIER-NKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNG-VGEVTNNIFTLVAIE-------SMTNKSSWSPTNGWVPEKLYVKDLVDHINNG-TFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDE--DKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            G+Y   R  I V + ++  S   +I I  H  D++   ++++ P       +++  K     +     + +  +     V +T    V  P + +  +  +++W  + Q    PW  +A+D ++  + +  +R L +P   L L+D +++    L          + + AD+QI  G+MH+GYPI   +  V    NEK        +   G WG +HE+G N Q   + F     E T N++ +   E       S  N + W P           K +  +++ G   +NW  N + AL  Y Q + +FGWE F ++F  Y   +N+  N+  E  DK+ LW+K  S     NL P +E W WPI ++ A  L+ L
Sbjct:  548 GLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYY-KLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEK-------LIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVR--------EKRVRIYLSKGPNVKNW--NAWTALETYLQLQEAFGWEPFIRLFTEY---RNQT-NLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYL 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 57.7658 bits (138), Expect = 4.620e-8
Identity = 34/81 (41.98%), Postives = 42/81 (51.85%), Query Frame = 3
Query:  369 NWCKDTDNGREYLGDVNYTKSGKDCNPWIN--QRTHPKDSFPEKNLNLVGNKCRNPDMSEG-PWCYYSTENKREECDVPKC 602
            +WC   ++G +Y G V  T SGK C PWI+   R      FPE  L    N CRNP   +  PWCY     + E CDVP+C
Sbjct:  193 HWCY-VNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPE--LMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQC 270          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 57.7658 bits (138), Expect = 4.706e-8
Identity = 34/81 (41.98%), Postives = 42/81 (51.85%), Query Frame = 3
Query:  369 NWCKDTDNGREYLGDVNYTKSGKDCNPWIN--QRTHPKDSFPEKNLNLVGNKCRNPDMSEG-PWCYYSTENKREECDVPKC 602
            +WC   ++G +Y G V  T SGK C PWI+   R      FPE  L    N CRNP   +  PWCY     + E CDVP+C
Sbjct:  326 HWCY-VNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPE--LMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQC 403          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 57.7658 bits (138), Expect = 4.915e-8
Identity = 34/81 (41.98%), Postives = 42/81 (51.85%), Query Frame = 3
Query:  369 NWCKDTDNGREYLGDVNYTKSGKDCNPWIN--QRTHPKDSFPEKNLNLVGNKCRNPDMSEG-PWCYYSTENKREECDVPKC 602
            +WC   ++G +Y G V  T SGK C PWI+   R      FPE  L    N CRNP   +  PWCY     + E CDVP+C
Sbjct:  352 HWCY-VNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPE--LMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQC 429          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Fly
Match: Nrk (gene:FBgn0020391 transcript:FBtr0087728)

HSP 1 Score: 51.2174 bits (121), Expect = 5.991e-6
Identity = 22/76 (28.95%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  129 GREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSC 356
            GR ++G  +++K+G  C  W  ++ +K     ++ +  + L G NYCRN       PWC   + +++W++C+I  C
Sbjct:  224 GRFYMGTMNVSKSGIPCQRWDTQYPHKHFQPPLVFH--QLLEGENYCRNAGGEEPHPWCYTVDESVRWQHCDIPMC 297          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.3 (si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-13])

HSP 1 Score: 138.658 bits (348), Expect = 9.007e-33
Identity = 91/293 (31.06%), Postives = 144/293 (49.15%), Query Frame = 3
Query: 2196 DKVEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESM--TNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            D VEI     V+ P F +  +  + DW+ K +   +PWA +  + LV  L S+ IRNL  P+   +L+D +++    L        R+E    D+QI AG+MHSGYPI       +   N K+   H +       WG +H++GHN Q  ++ F     E T N++++   E +   NK+   P       +  +K+         F+NW  N + AL  Y Q +  FGW+ F +VF  Y+ +K+   +  +  K+ L+ KT S++   NL P +++W WPI   T  ELS L
Sbjct:  622 DGVEIVVQTAVQAPYF-KSGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDFIRNLERPDQVAKLWDAIMRSVSDLAATPAKFPRKERFVGDVQISAGFMHSGYPIMMLSSSASELLNVKEAHKHDF-------WGPLHKLGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNKAKAHPCMTLQSRQERIKEYFS--GGKDFENW--NTWTALETYMQLQEKFGWDAFKKVFSLYHDMKDVPND--NAGKMNLYAKTFSKVVNHNLSPFFKVWGWPIQPNTEQELSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.4 (si:ch211-210b2.4 [Source:ZFIN;Acc:ZDB-GENE-131122-12])

HSP 1 Score: 136.732 bits (343), Expect = 3.618e-32
Identity = 90/293 (30.72%), Postives = 140/293 (47.78%), Query Frame = 3
Query: 2196 DKVEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESM--TNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            D VEI     V+ P F +  +  + DW+ K +   +PWA +  + LV  L S+ IRNL  P+   EL+D +++    L        R+E    D+QI AG+MHSGYPI       +   N K+   H +       WG +HE+GHN Q  ++ F     E T N++++   E +   N++   P       +  +K           +NW +    AL  Y Q +  FGW+ F +VF  Y+ +K+   +  +  K+ L+ KT S++   NL P ++ W WPI   T  ELS L
Sbjct:  622 DGVEIVVQTAVQAPYF-KSGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDLIRNLERPDEVAELWDAIMRSVSDLAATPAKFPRKERFVGDVQISAGFMHSGYPIMMLSSSASQLLNVKEAHKHDF-------WGPLHELGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNRAKAHPCMTLESRQACIKKYFS--GGKDLKNWTKA--TALETYMQLQEKFGWDAFKKVFSLYHDMKDVPND--NAGKMNLYAKTFSKVVNHNLSPFFKTWGWPIQPNTEQELSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.2 (si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-33])

HSP 1 Score: 135.576 bits (340), Expect = 6.915e-32
Identity = 90/293 (30.72%), Postives = 141/293 (48.12%), Query Frame = 3
Query: 2196 DKVEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESM--TNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            D VEI     V+ P F +  +  + DW+ K +   +PWA +  + LV  L S+ IRNL  P+   +L+D +++    L        R+E    D+QI AG+MHSGYPI       +   N K+   H +       WG +HE+GHN Q  ++ F     E T N++++   E +   NK+   P       +  +K           +NW +    AL  Y Q +  FGW+ F +VF  Y+ +K+   +  +  K+ L+ KT S++   NL P +++W WPI   T  ELS L
Sbjct:  618 DGVEIVVQTAVQAPYF-KSGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDFIRNLERPDEVAKLWDAIMRSVSDLAATPAKFRRKERFVGDVQISAGFMHSGYPIMMLSSSASQLLNVKEAHKHDF-------WGPLHELGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNKAKAHPCMTLESRQACIKKYFS--GGKDLKNWTKAT--ALETYMQLQEKFGWDAFKKVFSLYHDMKDVPND--NAGKMNLYAKTFSKVVNHNLSPFFKVWGWPIQPNTEQELSHL 896          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 125.561 bits (314), Expect = 9.861e-29
Identity = 85/297 (28.62%), Postives = 138/297 (46.46%), Query Frame = 3
Query: 2196 DKVEITFNNVVEIPLFDRRNKKDIKDWI-HKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTL------VAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            D VEI     V+ P F +  +  + DW+ H +   +PWA +  + L+    S  IRNL  P+   +L+D +++    L  R     R+E   AD+QI  G+MH+GYPI           N ++ +         G WG +HE+GHN Q  ++ F     E T N+++L        I+S     + +P +     K+Y     D        +W    ++AL  Y Q +  FGW+ F +VF  Y+ +     +  +  K+ L+ +T S++  +NL P ++ W WPI   T   LS L
Sbjct:  622 DGVEIVVQTAVQAPYF-KSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAY-------KCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKMYFDGGKD------LNSWCM--WMALETYMQLQEKFGWDAFKKVFSLYHDMTGVPND--NAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 125.561 bits (314), Expect = 9.861e-29
Identity = 85/297 (28.62%), Postives = 138/297 (46.46%), Query Frame = 3
Query: 2196 DKVEITFNNVVEIPLFDRRNKKDIKDWI-HKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTL------VAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            D VEI     V+ P F +  +  + DW+ H +   +PWA +  + L+    S  IRNL  P+   +L+D +++    L  R     R+E   AD+QI  G+MH+GYPI           N ++ +         G WG +HE+GHN Q  ++ F     E T N+++L        I+S     + +P +     K+Y     D        +W    ++AL  Y Q +  FGW+ F +VF  Y+ +     +  +  K+ L+ +T S++  +NL P ++ W WPI   T   LS L
Sbjct:  622 DGVEIVVQTAVQAPYF-KSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAY-------KCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKMYFDGGKD------LNSWCM--WMALETYMQLQEKFGWDAFKKVFSLYHDMTGVPND--NAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045101.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 144.436 bits (363), Expect = 1.853e-34
Identity = 107/382 (28.01%), Postives = 180/382 (47.12%), Query Frame = 3
Query: 1971 GIYAIPR-VDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDN-DKVEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNG-VGEVTNNIF------TLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDED--KIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPD 3080
            G+Y  P+   + V    +  Q  ++ +  H  D+  K E Y+ P    + S+ R KV++  +  G L  I  +  N   + +        P +  + K  +  W+   + L  PWA + ++ ++  + S+AIR+L DP   L  +D M+     L       SR E + AD+QI AG+MH+GYP+   +  V        Y  ++  +  +G WG +HE+GHN Q+ ++ F     E T N++      T+V +      S+  P +     + Y+K           +NW  N + AL  Y Q +  FGWE F Q+F+ Y      +  IS+++  K+ LW +  SE    NL P +E W WPI ++T ++LS L ++  D
Sbjct:  533 GLYLSPKKTAVLVFPASAVQQGLQVQVGCHSDDLGSKDEFYRAPIVVRKISVHREKVQVSCYWGGLLYIIVKERSNLGTIPVQVYGAEPAPTY-IKGKTSLDSWLQSLRDLPPPWAELITENIILTVPSDAIRSLNDPEELLGFWDRMMVAITELAAIPTTFSRPERIVADVQISAGWMHAGYPVMVHLASV-------KYLTNLSCMQKEGLWGPIHELGHNQQQKVWEFPPHTTEATCNLWSVFVNETVVGVPRDKANSALEPASRAACIEAYLK------TGPKLENW--NVWTALETYLQLQEGFGWEPFKQLFKDY----QSMSGISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSALPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000002244.1 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:100489234])

HSP 1 Score: 133.265 bits (334), Expect = 5.302e-31
Identity = 103/387 (26.61%), Postives = 183/387 (47.29%), Query Frame = 3
Query: 1971 GIYAIPRVDISVKITQSK-SQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDN-DKVEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDED--KIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKR 3110
            G+Y  PR  + ++   S   Q  ++ +  H  D S K  + + P       ++R KV + SF  G L  I     N   V +        P++ +  K  +  W+H  + L +PWA + ++ ++  + S+A+R+L +P + L L+D ++     L  +     R E + AD+QI AG+MH+GYPI   +      A E     HM     +G WG +HE+GHN Q++ + F     E T N++ +   E++         +G +   +    +  ++ NG   + W  + + AL  Y Q +   GW+ F +++R  ++       +S+E+  K+ LW +  S  +  NL P +E W WPI Q T ++LS L ++  D     +  K+
Sbjct:  511 GLYLPPRKAVVIEFPASAVQQGFQVQVGCHSDDPSAKETLNRAPVVVRRIHVDRQKVPVSSFWGGLLYIIVRSNSNFGTVPVRVYGAEPAPIYIK-GKTSLDSWLHSIRQLPAPWAELVTENIILTVPSDAVRSLKNPEALLSLWDRIMAAIADLAAKPKKFPRPERIVADVQISAGWMHAGYPIMCDL----ESAKELTDLHHMEK---EGIWGPIHELGHNQQKTQWEFPPHTTEATCNLWAVYVHETVLGIPR-DRAHGNLQPNVRTSRIKSYLQNGANLEQW--DGWTALETYLQLQEGLGWDPFRRLYRDPSI-----SGMSNENTFKMNLWAEKFSRAAQTNLVPFFEAWGWPIDQSTRSKLSALPVWEKDPMKPYVTAKK 881          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045059.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 127.102 bits (318), Expect = 5.530e-29
Identity = 90/285 (31.58%), Postives = 146/285 (51.23%), Query Frame = 3
Query: 2250 RNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFD-VMVK-EEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPE--KLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDED--KIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPD 3080
            + K ++  W+   + L +PWA + ++ ++  + S+AIR+L+DP + L L+D +MV   E   I +T    R E   AD+QI AG+MH+GYPI   +      A E      M  + I   WG +HE+GHN Q+  + F     E T N++++   E++             PE    Y+++ V   N    + W  + + AL  Y Q +  FGWE F Q+F+ Y      +  IS+++  K+ LW +  SE    NL P +E W WPI ++T ++LS L ++  D
Sbjct:  627 KGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFP--RPERFVADVQISAGWMHAGYPIMCHL----ESAKELTDLNVMQTVGI---WGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPRNKAHGSLQPETRACYIQEYVK--NGSNLEQW--DVWTALETYLQLQEGFGWEPFKQLFKDY----QSMSGISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSALPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045084.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 122.865 bits (307), Expect = 8.827e-28
Identity = 89/285 (31.23%), Postives = 144/285 (50.53%), Query Frame = 3
Query: 2250 RNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFD-VMVK-EEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPE--KLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDED--KIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPD 3080
            + K ++  W+   + L +PWA + ++ ++  + S+AIR+L+DP + L L+D +MV   E   I +T    R E   AD+QI AG+MH+GYPI   +      A E      M  + I   WG +HE+GHN Q+  + F     E T N++++   E++             PE    Y+++ V   N    + W  + + AL  Y Q +  FGWE F ++F+ Y      +  IS+++  K+ LW +  SE    NL P +E W WPI + T  +LS L ++  D
Sbjct:  627 KGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFP--RPERFVADVQISAGWMHAGYPIMCHL----ESAKELTDLNVMQTVGI---WGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPRNKAHGSLQPETRACYIQEYVK--NGSNLEQW--DVWTALETYLQLQEGFGWEPFKRLFKDY----QSMSGISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEATRIKLSALPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045039.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 122.094 bits (305), Expect = 1.697e-27
Identity = 89/285 (31.23%), Postives = 144/285 (50.53%), Query Frame = 3
Query: 2250 RNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFD-VMVK-EEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPE--KLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDED--KIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPD 3080
            + K ++  W+   + L +PWA + ++ ++  + S+AIR+L+DP + L L+D +MV   E   I +T    R E   AD+QI AG+MH+GYPI   +      A E      M  + I   WG +HE+GHN Q+  + F     E T N++++   E++             PE    Y+++ V   N    + W  + + AL  Y Q +  FGWE F ++F+ Y      +  IS+++  K+ LW +  SE    NL P +E W WPI + T  +LS L ++  D
Sbjct:  627 KGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFP--RPERFVADVQISAGWMHAGYPIMCHL----ESAKELTDLNVMQTVGI---WGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPRNKAHGSLQPETRACYIQEYVK--NGSNLEQW--DVWTALETYLQLQEGFGWEPFKRLFKDY----QSMSGISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEATRIKLSVLPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf3 (TRPM8 channel-associated factor 3 [Source:MGI Symbol;Acc:MGI:3042585])

HSP 1 Score: 141.739 bits (356), Expect = 9.140e-34
Identity = 98/294 (33.33%), Postives = 141/294 (47.96%), Query Frame = 3
Query: 2190 DNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLV-SPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            + D V +T    V  P F R  K   ++W +  T   +PW  +A+D ++  + +  ++ L DP   L+L+D MV+    L  R     R E V  D QI  G++HSGYPI   I  V    +E       + +   G WG++HE+GHN Q+S +TF     E   N++T+   E++ N           PE L  + +  H+N G    NW    + AL  Y Q +  FGWE F QVF  Y  L     N  +EDK+ LW+K  SE    NL P +E W WP+    A  L+ L
Sbjct:  614 NQDNVSVTIRGAVSAPYF-RLGKTTQEEWKNLITHSKAPWGELATDNIILTIPTVNLKELQDPYPLLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQISFGFLHSGYPIMGLISIVEGIISE-------FKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNLWTIYVHETVLNIPREQAHPSLNPE-LRRQRIKYHLNKGAPLSNWIM--WTALETYLQLQEGFGWEPFIQVFADYRTLSGLPQN--NEDKMNLWVKKFSEAVHKNLAPFFEAWGWPVKYAVAKSLASL 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf2 (TRPM8 channel-associated factor 2 [Source:MGI Symbol;Acc:MGI:2385258])

HSP 1 Score: 129.028 bits (323), Expect = 9.512e-30
Identity = 85/288 (29.51%), Postives = 140/288 (48.61%), Query Frame = 3
Query: 2202 VEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELS 3056
            V +T  N V  P + +  K  +++W    Q  + PW  +A+D ++  + + +++ L +P   L+L+D M++    L  +     R E + AD+Q+ AG+MHSGYPI   +  V            + N+   G WG +HE+GHN Q   + F     E T N++++   E++             PE+   K + +H+  G   QNW  N + AL  Y Q +  FGWE F  +F  Y  +     +  +E K+ +W+K  SE    NL P +E W WPI +  A +L+
Sbjct:  628 VSVTITNAVPAPYY-KLGKTSLEEWKSCIQKNLGPWGELATDNVILTVPTASLKTLENPEPLLQLWDEMMQAVARLASQPFPFQRPERIVADVQLSAGWMHSGYPIMCHMESVQE-------LVSLANIRSKGLWGPIHELGHNQQCRGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHPQLKPEE-REKRIKEHLQKGAPLQNW--NVWTALETYLQLQEVFGWEPFITLFAEYQTIFYIPED--NECKMNIWLKLFSEKVQKNLVPFFEAWGWPIQKDVAEDLA 902          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 121.324 bits (303), Expect = 2.079e-27
Identity = 100/379 (26.39%), Postives = 169/379 (44.59%), Query Frame = 3
Query: 1971 GIYAIPRVDISVKITQSK-SQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIER-NKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLV---SPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNG-VGEVTNNIFTLVAIE-------SMTNKSSWSPTNGWVPEKLYVKDLVDHINNG-TFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDE-DKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            G+Y   R  I V + +S  S   +I I  H  D++   ++++ P       +++  K     +     + +  +     V +T    V  P + +  +   ++W  K+ L+    PW  +A+D ++  + +  +R L +P   L L+D M++    L G T      + + AD+QI  G+MH+GYPI   +  V    NEK        +   G WG +HE+G N Q   + F     E T N++ +   E       S  N + W P           K +  +++ G + ++W  N + AL  Y Q + +FGWE F ++F  Y          SD  DK+ LW+K  S+    NL P +E W WPI ++ A  L+ L
Sbjct:  548 GLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAPFY-KLGETSKEEW--KRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEK-------LIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVR--------EKRVRIYLSKGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYL 906          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 121.324 bits (303), Expect = 2.079e-27
Identity = 100/379 (26.39%), Postives = 169/379 (44.59%), Query Frame = 3
Query: 1971 GIYAIPRVDISVKITQSK-SQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIER-NKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLV---SPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNG-VGEVTNNIFTLVAIE-------SMTNKSSWSPTNGWVPEKLYVKDLVDHINNG-TFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDE-DKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            G+Y   R  I V + +S  S   +I I  H  D++   ++++ P       +++  K     +     + +  +     V +T    V  P + +  +   ++W  K+ L+    PW  +A+D ++  + +  +R L +P   L L+D M++    L G T      + + AD+QI  G+MH+GYPI   +  V    NEK        +   G WG +HE+G N Q   + F     E T N++ +   E       S  N + W P           K +  +++ G + ++W  N + AL  Y Q + +FGWE F ++F  Y          SD  DK+ LW+K  S+    NL P +E W WPI ++ A  L+ L
Sbjct:  548 GLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAPFY-KLGETSKEEW--KRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEK-------LIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVR--------EKRVRIYLSKGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYL 906          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 121.324 bits (303), Expect = 2.079e-27
Identity = 100/379 (26.39%), Postives = 169/379 (44.59%), Query Frame = 3
Query: 1971 GIYAIPRVDISVKITQSK-SQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIER-NKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLV---SPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNG-VGEVTNNIFTLVAIE-------SMTNKSSWSPTNGWVPEKLYVKDLVDHINNG-TFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDE-DKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            G+Y   R  I V + +S  S   +I I  H  D++   ++++ P       +++  K     +     + +  +     V +T    V  P + +  +   ++W  K+ L+    PW  +A+D ++  + +  +R L +P   L L+D M++    L G T      + + AD+QI  G+MH+GYPI   +  V    NEK        +   G WG +HE+G N Q   + F     E T N++ +   E       S  N + W P           K +  +++ G + ++W  N + AL  Y Q + +FGWE F ++F  Y          SD  DK+ LW+K  S+    NL P +E W WPI ++ A  L+ L
Sbjct:  548 GLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAPFY-KLGETSKEEW--KRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEK-------LIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVR--------EKRVRIYLSKGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYL 906          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6QR59|TCAF3_MOUSE (TRPM8 channel-associated factor 3 OS=Mus musculus OX=10090 GN=Tcaf3 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 6.394e-33
Identity = 98/294 (33.33%), Postives = 141/294 (47.96%), Query Frame = 3
Query: 2190 DNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLV-SPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            + D V +T    V  P F R  K   ++W +  T   +PW  +A+D ++  + +  ++ L DP   L+L+D MV+    L  R     R E V  D QI  G++HSGYPI   I  V    +E       + +   G WG++HE+GHN Q+S +TF     E   N++T+   E++ N           PE L  + +  H+N G    NW    + AL  Y Q +  FGWE F QVF  Y  L     N  +EDK+ LW+K  SE    NL P +E W WP+    A  L+ L
Sbjct:  614 NQDNVSVTIRGAVSAPYF-RLGKTTQEEWKNLITHSKAPWGELATDNIILTIPTVNLKELQDPYPLLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQISFGFLHSGYPIMGLISIVEGIISE-------FKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNLWTIYVHETVLNIPREQAHPSLNPE-LRRQRIKYHLNKGAPLSNWIM--WTALETYLQLQEGFGWEPFIQVFADYRTLSGLPQN--NEDKMNLWVKKFSEAVHKNLAPFFEAWGWPVKYAVAKSLASL 894          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P6V7|TCAF3_RAT (TRPM8 channel-associated factor 3 OS=Rattus norvegicus OX=10116 GN=Tcaf3 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 7.801e-33
Identity = 95/297 (31.99%), Postives = 143/297 (48.15%), Query Frame = 3
Query: 2190 DNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLV----SPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFN-GVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            + D V +T +  V  P F R  K   ++W   + L+    +PW  +A+D ++  + +  ++ L DP   L+L+D +VK    L  R     R E +  D QI  G++HSGYPI   I  V    NE       + +   G WG+ HE+GHN Q+  +TF     E   N++++   E++ N           PE L  + + DH+N G    NW    + AL  Y Q +  FGWE F Q+F  Y  L     N  +EDK+ LW+K  SE+   NL P ++ W WP+    A  L+ L
Sbjct:  614 NQDNVSVTISGAVSAPYF-RLGKTTQEEW---KNLIEHSKAPWGELATDNIILTIPTVNLKVLQDPYPLLQLWDKIVKAVAKLAARPFPFQRPERIVLDKQISFGFLHSGYPIMGLIIIVEGIINE-------FKIRSHGVWGVTHELGHNHQKPGWTFRPHTTEALCNLWSIYVHETVLNIPRDQAHPSLNPE-LRKQRIKDHLNKGAPLSNWIV--WTALETYLQLQEGFGWEPFIQLFANYQTLTGLPQN--NEDKMNLWVKKFSEVVQKNLAPFFKAWGWPVQHAVAKSLASL 894          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|A6NFQ2|TCAF2_HUMAN (TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 4.689e-31
Identity = 90/296 (30.41%), Postives = 143/296 (48.31%), Query Frame = 3
Query: 2202 VEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNG-VGEVTNNIF------TLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            V +T    V  P + +  K  +++W  + Q  ++PW  +A+D ++  + +  ++ L DP   L L+D M++    L        R E + AD+QI AG+MHSGYPI   +  V    NE D       +   G WG +HE+GHN Q   + F     E T N++      T++ I       + SP     PE+   + +  H+  G    +W  N + AL  Y Q + +FGWE F Q+F  Y  L +   +  +  ++ LW+K  SE    NL P +E W WPI ++ A+ L+ L
Sbjct:  627 VPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSP-----PER--ERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPKD--NTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 903          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q921K8|TCAF2_MOUSE (TRPM8 channel-associated factor 2 OS=Mus musculus OX=10090 GN=Tcaf2 PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 6.653e-29
Identity = 85/288 (29.51%), Postives = 140/288 (48.61%), Query Frame = 3
Query: 2202 VEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELS 3056
            V +T  N V  P + +  K  +++W    Q  + PW  +A+D ++  + + +++ L +P   L+L+D M++    L  +     R E + AD+Q+ AG+MHSGYPI   +  V            + N+   G WG +HE+GHN Q   + F     E T N++++   E++             PE+   K + +H+  G   QNW  N + AL  Y Q +  FGWE F  +F  Y  +     +  +E K+ +W+K  SE    NL P +E W WPI +  A +L+
Sbjct:  628 VSVTITNAVPAPYY-KLGKTSLEEWKSCIQKNLGPWGELATDNVILTVPTASLKTLENPEPLLQLWDEMMQAVARLASQPFPFQRPERIVADVQLSAGWMHSGYPIMCHMESVQE-------LVSLANIRSKGLWGPIHELGHNQQCRGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHPQLKPEE-REKRIKEHLQKGAPLQNW--NVWTALETYLQLQEVFGWEPFITLFAEYQTIFYIPED--NECKMNIWLKLFSEKVQKNLVPFFEAWGWPIQKDVAEDLA 902          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|A4IG42|TCAF_DANRE (TRPM8 channel-associated factor homolog OS=Danio rerio OX=7955 GN=tcaf PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.555e-28
Identity = 86/297 (28.96%), Postives = 139/297 (46.80%), Query Frame = 3
Query: 2196 DKVEITFNNVVEIPLFDRRNKKDIKDWI-HKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTL------VAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            D VEI   N V+ P F +  +  + DW+ H +   +PWA +  + L+    S  IRNL  P+   +L+D +++    L  R     R+E   AD+QI  G+MH+GYPI           N ++ +         G WG +HE+GHN Q  ++ F     E T N+++L        I+S     + +P +     K+Y     D        +W    ++AL  Y Q +  FGW+ F +VF  Y+ +     +  +  K+ L+ +T S++  +NL P ++ W WPI   T   LS L
Sbjct:  622 DGVEIVVQNAVQAPYF-KSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAY-------KCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKMYFDGGKD------LNSWCM--WMALETYMQLQEKFGWDAFKKVFSLYHDMTGVPND--NAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V4A0M8 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_165593 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.740e-60
Identity = 144/438 (32.88%), Postives = 230/438 (52.51%), Query Frame = 3
Query: 1860 IVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTI 3173
            I+PG++ +PG F S   P K         Y ++V   G Y      ++V +     +   + I  H   +S + E+ +WP       +   +  I   +FGGL+  +   +   + +  +NV++ PLFD      I+ W  ++     WA + S+ L+  L S +IRNL  P S ++ +D ++K  FHL G  I + R++ +  D+Q  AGYMHSGYP+ T +  V NP++E  +  + +NLN  G WG+ HE GHN+QE ++TF G  EVT NIFTL A++++  K      + W+  ++       + N+  + +WK +  +AL IYAQ  +  GW  F +VFRRY  +        + D+I LW    SE+S +NL  L + W+ P+S K   E+SK Q FLPDD + +M  +R   I++K+    + LR P  I
Sbjct:  505 ILPGIANFPGDFEST--PSKTSVTLTLSSYQEDVHPTGYYVQAGDSLAVSVLSQNGKGWTVQIGAHSDCLSGQSELKRWPNVVCCKPLNE-QCTIVKATFGGLVYFTSPSNQQSITVQLDNVIQAPLFDLTLPTTIEQWNGRRQAPGLWADICSEFLIITLPSKSIRNLDGPVSVMKKWDEVLKAHFHLKGIDIRNHRKQWLVTDVQPSAGYMHSGYPVVTHLD-VANPSHEF-FLLNSHNLNTKGSWGVFHEFGHNMQEGVWTFPGTTEVTVNIFTLHAMDTLIGKRPI--VHEWLQNQMSNAKRYLYHNDQNYSHWKSDPGIALFIYAQIAHHLGWGVFKEVFRRYGRMNPSSYPNKENDQIDLWYTLLSEVSQLNLASLVDFWKIPLSDKARREMSKFQPFLPDDDVMRMAPERTHMILAKY--HSNCLRQPAYI 933          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: R7UHN9 (Peptidase M60 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_195748 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 3.147e-58
Identity = 172/639 (26.92%), Postives = 320/639 (50.08%), Query Frame = 3
Query: 1290 LQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKNILDSELKI--LFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLY-----SNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIY--AIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKL-YVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIP 3176
            + EI++K +   A++   I    +E+    V  LL  +  G  +I  + PW ++  +KN  + ++ +  + + AG+  +  Y + N    T  S+ +      L    L+++  +N+     D+ S      +L ++   ++R +  DL      +++  L+   IP  +  L D  +K LL   + + A   G +   PG+  +PG F   D+  K +++ L+    +++    +Y  A   ++I +    +  Q  +++I  H  D+    +  + PK +++  +  +   IFS   G +   S DE++ ++++T +NVVE P +          WI ++     WA +A   ++  L S++I++L DP+  L  +D +V     +    ++S R++ +  D+Q   GYMHSGYPI T +  V +P +++ +  +   L  +G WGL HE+GHN+Q   +TF G  EVT N+FTL A++ +     W   + W+  ++  +K  +  +    F  WK+   +AL IYAQ  +  GW  +  VFR+Y V+ NE    +D++KI+LWI T +E  G NLC L+  W + I       L++L +FLP D +T  V +R+ +++++F G    + T L +P
Sbjct:  103 IHEILAKETESVAIVR-IIGQKFDEIE---VLMLLDFIEHGGGLIFAICPWGWLQLNKNYAEEDMPMYSILERAGIHFTGHYINGNADGFTVPSIPSTARVPTLIQKCLSSS--ENLGLYAYDLAS------LLEDLPLRIVRSTFQDLLDEVEETDFYNLV---IPEEKYPLKDNRSKGLL-LLSCLSARVRGDK--APGVHAFPGDF-EGDVQHKCVRINLDSA-RRDIFPAAVYLPAGETLEIEIHEGSTDPQKWKVWIGAHSDDLVRSSQWKRLPKVHIKQRLSEDTNVIFSPYGGNVYFESPDEES-QLDVTVSNVVESPCY-------TDHWIGQRDAPGLWADLAGRHIMITLPSSSIKDLVDPSEVLAFWDSVVAAHHVVRTTDVSSHRKQWIVCDVQPVVGYMHSGYPIVTHMD-VADPTSDQ-FLLNHDKLKAEGNWGLYHELGHNMQRLEWTFQGTSEVTVNVFTLHAMDVVNGVKPW--IHPWLNNQMNAIKRYL--MAGADFTTWKKEPGIALGIYAQLAHHLGWGTYKAVFRKYEVMSNEQKPKTDDEKIRLWITTFAECCGQNLCALFRFWGFTIPNDLQRNLAELPLFLPMDEMTLFVPERIAKVVAEFDGEGGCMDT-LPLP 706          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3I0H4 (TRPM8 channel-associated factor 2-like OS=Lingula unguis OX=7574 GN=LOC106159184 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 3.624e-57
Identity = 150/445 (33.71%), Postives = 224/445 (50.34%), Query Frame = 3
Query: 1863 VPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIYAIPRVDISVKITQSKSQFC---RIFINYHHFD-VSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPA---NEKDYF-FHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNG-TFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRY--NVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTP 3164
            +PG+  +PG F S+  PL+ +++ L    H++    G Y      + V +T  +       +I I  H    V+ K    +WP   V    E       S  +GGLL     E N ++ +   NVVE P FD    + ++DW  ++     WA +A   +VF + S ++R + DP + L L+D  V  +  L G      +RE V AD Q  AGYMH+GYPI T +  V +P    N  D F F    +   G WGL HE+GHN+Q   +TF+G+GEVTNNIFTL   E++T   +W   N    +K   + L   + +  +  +WK++ F AL +Y+Q  + FGW  F  VFR Y  +V K E  N  D  KI +W    SEI   NL P+ + W  P+S    N L+    FLP+D +T   + RVD+++  + G   ++R+P
Sbjct:  285 LPGIGVFPGDF-SSKPPLQTVRLNLT-TKHRQRLSTGYYVPAGQPVKVTVTSDQGTDLSGWKICIGAHDDSLVNVKEPWRRWPD--VAVLEELKATTALSSPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWAELAGRHIVFTVPSTSVREIDDPTTILALWDSAVAAQHDLRGTDRNLQKRERVVADEQPSAGYMHAGYPIVTHLD-VVDPNFQYNGSDNFVFSESGMKSYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAW---NNPTMKKFRAEKLPRLLQSQPSLSDWKKDPFFALCVYSQLAHEFGWRSFKTVFRLYENSVKKEEESNQDDGAKIDMWFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNYPG---IVRSP 718          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V3ZHF7 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236481 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 2.821e-56
Identity = 190/722 (26.32%), Postives = 325/722 (45.01%), Query Frame = 3
Query: 1068 IPGHFILFSNNAIAYATNADNQ-IPVTISTVGKGRIAFLAADGVVDSIYF------PQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGT-LLQLVNSGLRIIIGVKPWAYVTYH--KNILDSELKILFQAAGVWPSLIY---ADNNWKTVTKHSVYTMPLYQRLEYAKLN--ANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQL---GIYAIPRVDISVKITQSKSQFC--RIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSW--SPTNGWVPE-KLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTP 3164
            +P   ++  + +    +N   + + + +  +G+GRIA +   G +  I        P++K   +++    V S     KE       KN    +L    I     E    +    +L+ + +G  ++  V  W ++     KNI D  L  + +  G+  +  Y     +        +  +  +   L++  L+   +TL  ++   V ++    V K   E    +I E   +            IP  +  ++    KS++ F + +LA        +PG+  +PG F + D PL D +    +I   E+      G Y     ++ ++I   +S  C   I I  H   +     M +WP    +  I +  +++ +   G +   S  +   K+ I   N +E PLFD    + I +W   +     WA +    +VF L + ++ +L DP + LE +D +V    HL G    S RRE + AD+Q   GYMHSGYPI T +  V +P+ +  +  +   L   G WGL HE+GHN+Q+  +TF G GEVT NIFTL A++ +  KS W  S   G VP+ + +++      ++  F  W+ +  +AL +YAQ  N FGW  + + FR+Y          ++E+KI  W +T S+ S  NL PL +LW  P+S     +L     FLPDD +T+ V ++V+E+  K+      +R P
Sbjct:   29 VPSTLVVLGDESRPILSNPQQKHVWIAVGELGRGRIAVVGHGGYITKINTTSGHTNPEIKHFNDNLKSWLVRSENVDMKEMKN---FKNLTPESLKNAKIVICTGESNANVTDKEILEYIQNGGALLHAVCAWGWLQIRNTKNIHDIPLYEVLEEVGIIYTKGYFWLPKSGLHIAISKASESQHVIHALDHTHLDNCCSTLSQINDCPVKVLQS--VMKKSGEKVHKIISEKEHEC-----------IPSEKRPVSSSIGKSVM-FLHDVLAKTGNGYKKMPGIDLFPGDF-TEDPPLSDGR----IIIESEIPAAHPTGFYVRAGEEVELEIVTEESLNCGWEIQIGCHSDHLQTSNAMKRWPIITEKQKITQKNLKMKTPIGGLMYVWS-PKMASKIIINVKNAIESPLFDLTQPETIINWKTNRQAPGLWADLGGHHIVFTLPAKSVGDLEDPTAVLESWDRVVCAHHHLRGTDPNSQRREWIVADVQPSCGYMHSGYPIVTHLD-VADPS-KSSFLLNNKTLLESGNWGLFHELGHNMQKPTWTFRGTGEVTCNIFTLHAMDVIAQKSPWIHSWLEGKVPKARQFIR------SSAGFSKWQSDPGIALFVYAQLYNQFGWSVYKKTFRQYEEQDMPPQLKTEEEKIDYWFETMSKFSEYNLAPLADLWSIPLSDTCREQLKVFPSFLPDDEITQGVPEKVEELEKKYPKLVRKIRPP 719          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3KG34 (TRPM8 channel-associated factor 2 OS=Lingula unguis OX=7574 GN=LOC106181552 PE=4 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 7.440e-55
Identity = 148/445 (33.26%), Postives = 221/445 (49.66%), Query Frame = 3
Query: 1863 VPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIYAIPRVDISVKITQSKSQFC---RIFINYHHFD-VSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPA---NEKDYF-FHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHIN-NGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRY--NVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTP 3164
            +PG+  +PG F S   PL+ +++ L    H++    G Y      + V +T  +       +I I  H    V+ K    +WP   V    E       S  +GGLL     E N ++ +   NVVE P FD    + ++DW  ++     W  +A   +VF + S ++R + DP + L L+D  V  +  L G      +RE V AD Q  AGYMH+GYPI T +  V +P    N  D F F    + + G WGL HE+GHN+Q   +TF+G+GEVTNNIFTL   E++T   +W   N    +K   + L   +    +  +WK++ F AL +Y+Q  + FGW  F  VFR Y  +V K E  N  D  KI ++    SEI   NL P+ + W  P+S    N L+    FLP+D +T   + RVD+++  + G   ++R P
Sbjct:  285 LPGIDVFPGDF-SFKPPLQTVRLNLT-TKHRQRLSTGYYVPAGQPVKVAVTSDQGTDLSGWKICIGAHDDSLVNVKEPWRRWPD--VAVLEELKATTALSSPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWTELAGRHIVFTVPSTSVREIDDPTTILALWDSAVAAQHDLRGTDPNFQKRERVVADEQPSAGYMHAGYPIVTHLD-VVDPNFQYNGSDNFVFSESGMKLYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAW---NNPTMKKFRAEKLPRLLQTQPSLNDWKKDPFFALCVYSQLAHEFGWGSFKTVFRLYENSVKKEEESNQDDGAKIDMYFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNYPG---IVRGP 718          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-210b2.3 (si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-13])

HSP 1 Score: 115.161 bits (287), Expect = 1.500e-25
Identity = 77/297 (25.93%), Postives = 136/297 (45.79%), Query Frame = 3
Query: 2196 DKVEITFNNVVEIPLFDRRNKKDIKDWIHK-QTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPI---GTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFN-GVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMF 3071
            D VE+     ++ P + +  +  + +W+++ +   +PWA +  + ++  L S  IR L  P+                    +A  R+E   AD+QI  G+MH+GYPI         + NP + + +          G WG +HE+GHN Q   + F     E T N++++   E +   +  S      PE+ + +     +       W    + AL  Y Q ++ FGW+ F +VF  Y+ + N  G+  +  K+ L+ +T S++  MNL P ++ W WPI   T + LS L ++
Sbjct:  623 DGVEVIVQTAIKAPYY-KSGETSVANWMNEIRNAPAPWAELEFENIIITLQSEVIRQLDRPDE-------------------VAFPRKERFVADVQISHGFMHAGYPIMILSCSAPELVNPESARKF----------GIWGAIHELGHNQQRWAWEFPPNTTECTCNLWSVYVHEEVLGVNRASAHENMSPERRWGRAQSYAMGGRQLDQWSM--WTALETYMQLQDRFGWDAFKKVFTAYHTINNVPGD--NNGKMNLYAETFSKVVNMNLAPFFKAWGWPIQPSTEDALSSLPVW 885          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018418.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 96.2857 bits (238), Expect = 8.648e-20
Identity = 71/233 (30.47%), Postives = 103/233 (44.21%), Query Frame = 3
Query:   69 LSRLTSSYFTDIENCKITTH-GREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSC----------IKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPE--KNLNLVGNKCRNPDMSEGPWCYYSTENKR-EECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSI 725
            +SR TS   T +     TT  G  + G  S+T++G+ C +W  +  +K  +    NY  K L   NYCRNP N    PWC   +   +WEYCN++SC          I     C + DNG  Y G +  T SGK C  W +   H     P+     +L  N CRNPD    PWCY +  + R E C + +C    + +          ++P  +   S+ + + D K    I
Sbjct:  267 VSRCTSPPPTIVPQLNCTTGDGNTYRGTVSVTESGKTCQSWASQLPHK-HSRTPDNYPCKGL-DQNYCRNPDNE-RKPWCYTTDPETRWEYCNVESCGNEPRPDEPVIAPNEDCYE-DNGSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFPTADLRRNLCRNPDGDRAPWCYTTDPSVRWEYCRIERCGS--TTVSLTPPPALKPVVPPTLLTQSVPSEFADCKTGSGI 493          

HSP 2 Score: 90.1225 bits (222), Expect = 7.425e-18
Identity = 62/188 (32.98%), Postives = 90/188 (47.87%), Query Frame = 3
Query:   63 PLLSRLTSSYFTDIE---NCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTH----PKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREE-CDVPKC 602
            P+L R + + +  I     C I   G ++ G  S TK+G  C  W+  F +K           K+ + +N+CRNP     GPWC   +   +WE C+I+ C ++   C    +G  Y G ++ T+SG  C  W +Q+ H        FPEK L    N CRNPD    PWC+  +  KR E C V +C
Sbjct:   92 PILRRRSITLYEKIVYLLECVIGI-GTDYRGTKSKTKSGTLCQRWESTFPHKPNI--TPRSHPKADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDCTEECMHC----SGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYLEE--NYCRNPDGEPKPWCFTESPAKRWEFCSVSRC 270          

HSP 3 Score: 66.2402 bits (160), Expect = 1.851e-10
Identity = 54/189 (28.57%), Postives = 83/189 (43.92%), Query Frame = 3
Query:  129 GREFIGRTSITKNGQQCITWKE-EFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSC--------------------------IKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLN--LVGNKCRNPDMS-EGPWCYYSTENKR-EECDVPKC 602
            G  + G  + T +G++C  W   E  + ++  +  N+ +  L   N CRNP +    PWC   + +++WEYC I+ C                            +   CK T +G  Y G V+ T +G  C  W     H     P+ + +  L  NKCRNPD    GPWCY +  NK+ + C +P+C
Sbjct:  382 GSSYRGVMTETISGKKCQAWASMEPHSHVKTPQ--NFPTADLR-RNLCRNP-DGDRAPWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCK-TGSGISYRGSVSKTVAGVTCQAWSASTPHLSSFTPQAHPDKGLDSNKCRNPDGDVNGPWCYTTDPNKKWDYCQIPEC 565          

HSP 4 Score: 50.8322 bits (120), Expect = 9.627e-6
Identity = 38/120 (31.67%), Postives = 52/120 (43.33%), Query Frame = 3
Query:   21 TTKSMSYLCFLIALPLLSRLTSSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCK 380
            TT S++    L  +   + LT S  ++  +CK T  G  + G  S T  G  C  W       L +     +  K L  +N CRNP    NGPWC   +   KW+YC I  C  D  + K
Sbjct:  457 TTVSLTPPPALKPVVPPTLLTQSVPSEFADCK-TGSGISYRGSVSKTVAGVTCQAWSAS-TPHLSSFTPQAHPDKGL-DSNKCRNPDGDVNGPWCYTTDPNKKWDYCQIPECALDTEYLK 573          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018419.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 96.2857 bits (238), Expect = 9.163e-20
Identity = 71/233 (30.47%), Postives = 103/233 (44.21%), Query Frame = 3
Query:   69 LSRLTSSYFTDIENCKITTH-GREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSC----------IKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPE--KNLNLVGNKCRNPDMSEGPWCYYSTENKR-EECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSI 725
            +SR TS   T +     TT  G  + G  S+T++G+ C +W  +  +K  +    NY  K L   NYCRNP N    PWC   +   +WEYCN++SC          I     C + DNG  Y G +  T SGK C  W +   H     P+     +L  N CRNPD    PWCY +  + R E C + +C    + +          ++P  +   S+ + + D K    I
Sbjct:  256 VSRCTSPPPTIVPQLNCTTGDGNTYRGTVSVTESGKTCQSWASQLPHK-HSRTPDNYPCKGL-DQNYCRNPDNE-RKPWCYTTDPETRWEYCNVESCGNEPRPDEPVIAPNEDCYE-DNGSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFPTADLRRNLCRNPDGDRAPWCYTTDPSVRWEYCRIERCGS--TTVSLTPPPALKPVVPPTLLTQSVPSEFADCKTGSGI 482          

HSP 2 Score: 89.7373 bits (221), Expect = 9.604e-18
Identity = 62/188 (32.98%), Postives = 90/188 (47.87%), Query Frame = 3
Query:   63 PLLSRLTSSYFTDIE---NCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTH----PKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREE-CDVPKC 602
            P+L R + + +  I     C I   G ++ G  S TK+G  C  W+  F +K           K+ + +N+CRNP     GPWC   +   +WE C+I+ C ++   C    +G  Y G ++ T+SG  C  W +Q+ H        FPEK L    N CRNPD    PWC+  +  KR E C V +C
Sbjct:   81 PILRRRSITLYEKIVYLLECVIGI-GTDYRGTKSKTKSGTLCQRWESTFPHKPNI--TPRSHPKADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDCTEECMHC----SGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYLEE--NYCRNPDGEPKPWCFTESPAKRWEFCSVSRC 259          

HSP 3 Score: 66.2402 bits (160), Expect = 1.670e-10
Identity = 54/190 (28.42%), Postives = 84/190 (44.21%), Query Frame = 3
Query:  129 GREFIGRTSITKNGQQCITWKE-EFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSC--------------------------IKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLN--LVGNKCRNPDMS-EGPWCYYSTENKR-EECDVPKCD 605
            G  + G  + T +G++C  W   E  + ++  +  N+ +  L   N CRNP +    PWC   + +++WEYC I+ C                            +   CK T +G  Y G V+ T +G  C  W     H     P+ + +  L  NKCRNPD    GPWCY +  NK+ + C +P+C+
Sbjct:  371 GSSYRGVMTETISGKKCQAWASMEPHSHVKTPQ--NFPTADLR-RNLCRNP-DGDRAPWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCK-TGSGISYRGSVSKTVAGVTCQAWSASTPHLSSFTPQAHPDKGLDSNKCRNPDGDVNGPWCYTTDPNKKWDYCQIPECE 555          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051129.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5658439:5662219:-1 gene:ENSAMXG00000036822.1 transcript:ENSAMXT00000051129.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 5.203e-18
Identity = 63/218 (28.90%), Postives = 103/218 (47.25%), Query Frame = 3
Query: 2424 LIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGE---WGLMHEVGHNLQESIFTFNG-VGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNG-TFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            L  +     R+E   AD+QI AG+MHSGYPI      V+ P         + N  + G+   WG +HE+GHN Q S + F     E T N++++   E +             P++   + +  +I  G   ++W    + AL  Y Q +  FGW+ F +VF  Y+ +     +  ++ K+ L+ +T S++   NL P ++ W WPI   T  +L  L
Sbjct:    7 LAAKPALFPRKERFVADVQILAGFMHSGYPIMMHT--VSAP--------DLVNPYVSGKSDFWGPVHELGHNQQHSDWEFPPYTTECTCNLWSVYVHEVVLGVKKADAHGQMTPQRRQNR-IKKYIEGGRNLKDW--TVWTALETYMQLQEEFGWDAFKKVFAAYHDMTGVPQD--NKGKMNLYAETFSKVVNRNLTPFFKAWGWPIQPSTEEQLCSL 209          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: mst1 (macrophage stimulating 1 [Source:NCBI gene;Acc:103025427])

HSP 1 Score: 87.8113 bits (216), Expect = 3.505e-17
Identity = 59/165 (35.76%), Postives = 86/165 (52.12%), Query Frame = 3
Query:  117 ITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEK--NLNLVGNKCRNPDMSEGPWCYYSTEN-KREECDVPKC 602
            I   G ++ G+ S T++G+ C  W  +F +  +          + +  NYCRNP     GPWC   +   ++E CNI  C KD   C +  NG +Y G V++T +G++C  W  Q  H     PEK  + +L  N CRNPD S  PWCY +  + +RE CD+ KC
Sbjct:  112 IVGKGEDYRGKVSKTQSGKTCQQWWSKFPHDHR----WTPSPTNGLELNYCRNPDGDRIGPWCYTTDPERRYESCNIPLC-KDEV-CINC-NGEDYRGQVDHTVNGRECQRWDQQYPHQHIYQPEKYPDKSLDDNYCRNPDASPVPWCYTTDPDVERENCDIRKC 269          

HSP 2 Score: 80.1073 bits (196), Expect = 7.112e-15
Identity = 58/164 (35.37%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  117 ITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSC---IKDRNWCKDTDN-----GREYLGDVNYTKSGKDCNPWINQRTHPKDSFPE--KNLNLVGNKCRNPDMSEGPWCYYSTENKR 578
            I  +G ++ G+   T NG++C  W +++ ++    +   Y  KSL  +NYCRNP   P  PWC   +  ++ E C+I+ C    K R     T N     G +Y G VN T SG  C  W  Q  H    +P   +   LV N CRNPD SE PWC+ S    R
Sbjct:  193 INCNGEDYRGQVDHTVNGRECQRWDQQYPHQ-HIYQPEKYPDKSL-DDNYCRNPDASPV-PWCYTTDPDVERENCDIRKCSGIPKRRLRPSYTTNCFRGRGEDYRGKVNETTSGIACQKWDAQFPHEHPFYPHTYECKGLVENYCRNPDGSEAPWCFTSLPEMR 353          

HSP 3 Score: 69.3218 bits (168), Expect = 1.811e-11
Identity = 64/191 (33.51%), Postives = 87/191 (45.55%), Query Frame = 3
Query:   75 RLTSSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYC-NIKSCIKDRNWCKDT--DNGREYLGDVNYTKSGKDCNPW---------INQRTHPKDSFPEKNLNLVGNKCRNPDMS-EGPWCYYSTENKRE--ECDVPKC 602
            RL  SY T   NC     G ++ G+ + T +G  C  W  +F ++        Y+ K L+  NYCRNP +    PWC      ++   C  IK C  D    +D   +NG+ Y G V  T+ G  C  W         IN +THP       + NL  N CRNPD    GPWC Y+T+ K E   C + +C
Sbjct:  276 RLRPSYTT---NC-FRGRGEDYRGKVNETTSGIACQKWDAQFPHE-HPFYPHTYECKGLV-ENYCRNP-DGSEAPWCFTSLPEMRTALCLQIKRCADDIE-AEDCYHENGKNYRGIVRKTRKGIICQKWSANTPHQTKINPKTHP-------DANLTENYCRNPDGDLHGPWC-YTTDPKTEFDYCAIKQC 450          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000976.1 (pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 gene:ENSPMAG00000000885.1 transcript:ENSPMAT00000000976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 7.533e-28
Identity = 77/278 (27.70%), Postives = 124/278 (44.60%), Query Frame = 3
Query: 2199 KVEITFNNVVEIPLFDRRNKKDIKDWIH-KQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNG-VGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGT-FQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRW 3023
            K+ +        P F +  +  ++ W   ++   +PW+ +A D+L+  + S A R LADP   + L+D M     +L      S+R E +  D QI  G+MH+GYPI      +    NE++       +  +G WG +HE+GHN Q   + F     E TNN+F +   E +   +         P +   + L DH++ G     W    F  L  Y Q + +FGW+ F ++F  Y    +    +  E K+  W +  S   G NL P +  W W
Sbjct:  612 KIRVRVRGAARAPYF-KLGETSLQHWQEFERHYPAPWSELACDSLILTVPSEAARGLADPERLMRLWDRMTGAIAYLAAEPHPSARPERIVVDEQISHGWMHAGYPIMVHRASIPKLLNEQE-------MRAEGMWGPLHELGHNRQRPAWNFPPHTTEATNNLFAVYVHEEVLGVARARAHPDLRPAE-RERRLRDHVDAGCPLAAW--TVFTCLETYLQLQEAFGWDPFVRLFGDYQRAASTPSTM--EAKMSEWAERFSRCVGRNLAPFFSAWGW 876          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003778.1 (pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 gene:ENSPMAG00000003419.1 transcript:ENSPMAT00000003778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 1.886e-19
Identity = 55/169 (32.54%), Postives = 80/169 (47.34%), Query Frame = 3
Query:  117 ITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTD-------------------NGREYLGDVNYTKSGKDCNPWINQRTHPKDSFP--EKNLNLVGNKCRNPDM-SEGPWCY 557
            +T +G ++IG  S TK+G+QC  W   F ++++  K +++  K L+  N+CRNP    +GPWC   +  +  E C++ +C KD N                          G +Y G VN T+SG+ C  W  Q  H     P   +   L G  CRNPD   EG WCY
Sbjct:  108 MTGNGEQYIGNVSFTKSGRQCQLWTSNFPHQVRF-KPVDHPEKQLV-ENFCRNPDASQDGPWCYTRDPLVPREPCSVPTCDKDPNQHVPVSPRVTPTKPAPRPQGPCVPGAGEDYRGPVNVTRSGRHCQAWSAQTPHVSRYSPLTHRAAGLEGAACRNPDGDEEGAWCY 274          

HSP 2 Score: 67.3958 bits (163), Expect = 1.138e-11
Identity = 41/86 (47.67%), Postives = 50/86 (58.14%), Query Frame = 3
Query:  384 TDNGREYLGDVNYTKSGKDCNPWINQRTH-----PKDSFPEKNLNLVGNKCRNPDMSE-GPWCYYSTE-NKREECDVPKCDKKFSQ 620
            T NG +Y+G+V++TKSG+ C  W +   H     P D  PEK   LV N CRNPD S+ GPWCY       RE C VP CDK  +Q
Sbjct:  109 TGNGEQYIGNVSFTKSGRQCQLWTSNFPHQVRFKPVD-HPEK--QLVENFCRNPDASQDGPWCYTRDPLVPREPCSVPTCDKDPNQ 191          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001728.1 (pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 gene:ENSPMAG00000001561.1 transcript:ENSPMAT00000001728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 6.551e-11
Identity = 32/87 (36.78%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  102 IENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIK 362
            +++C  T  G  + G  ++T +G QC TW  +    L A     +    L  NNYCRNP + PNGPWCI  +  + WEYC ++ C  
Sbjct:    8 VDHC-YTGSGTGYRGLQTLTASGHQCQTWASK-TPHLHAYTPEGFPEAGLE-NNYCRNPDSDPNGPWCITQDPNVLWEYCALQRCAS 91          

HSP 2 Score: 51.6026 bits (122), Expect = 3.745e-7
Identity = 23/75 (30.67%), Postives = 36/75 (48.00%), Query Frame = 3
Query:  132 REFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSC 356
            R + G  ++T  G+ C  W  +  ++ Q       D+   +G  YCRNP     GPWC   ++  +W+YC I  C
Sbjct:  213 RGYRGAQAVTSGGKTCQAWASQSPHRHQFVPANYTDADLSLG--YCRNPDGDLAGPWCYTTDSATRWQYCGIAHC 285          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: hgfb (hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GENE-041014-3])

HSP 1 Score: 62.7734 bits (151), Expect = 2.298e-10
Identity = 46/148 (31.08%), Postives = 69/148 (46.62%), Query Frame = 3
Query:  120 TTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEK--NLNLVGNKCRNPDMSEGPWCY 557
            T +G  + G  + T++G  C  W +   +  +      Y +  L GN+ CRNP   P  PWC   ++  + E C I  C  D   C +   G  Y G V++T S ++C  W  Q  H  +  P++  N  L  N CRNP+    PWC+
Sbjct:   53 TGNGSGYRGDKNYTESGLPCQAWGDSEPHDSRYLPSF-YPAFDLEGNS-CRNPAQEPGEPWCYTMDSNRRRERCGIPRC--DEVPCVEC-RGEHYRGLVDHTDSQRECQRWDLQHPHNHNYTPDRFPNAGLDDNYCRNPNGRMRPWCF 195          

HSP 2 Score: 62.7734 bits (151), Expect = 2.463e-10
Identity = 50/175 (28.57%), Postives = 73/175 (41.71%), Query Frame = 3
Query:  129 GREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYC-NIKSCIKDRNWCKD-TDNGREYLGDVNYTKSGKDCN---------PWINQRTHPKDSFPEKNLNLVGNKCRNPDMSE-GPWCYYSTEN-KREECDVPKCDKKF 614
            G ++ GR + TK G  C  W  +  ++       NY    L   NYCRNP      PWC   + +++ + C +I  C +     +  + +G  Y G V  T+ G  C          PW   ++HP          L G+ CRNPD    GPWC+ S  +   + C V  C   F
Sbjct:  232 GEDYRGRANHTKGGIPCQHWAAQQPHR-HTYLEHNYPCSGLD-RNYCRNPDGREEAPWCFTLDPSVRRQLCSHIPRCAQPTAGSQCYSGSGTAYRGGVATTRHGLQCQAWNATSPHKPWYTPKSHP-------GAGLEGHSCRNPDGDPWGPWCFTSDPHLPWDYCSVEACGDNF 397          

HSP 3 Score: 62.7734 bits (151), Expect = 2.485e-10
Identity = 34/79 (43.04%), Postives = 41/79 (51.90%), Query Frame = 3
Query:  384 TDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPE--KNLNLVGNKCRNPDMSEG-PWCYYSTENKREE-CDVPKCDK 608
            T NG  Y GD NYT+SG  C  W +   H     P      +L GN CRNP    G PWCY    N+R E C +P+CD+
Sbjct:   53 TGNGSGYRGDKNYTESGLPCQAWGDSEPHDSRYLPSFYPAFDLEGNSCRNPAQEPGEPWCYTMDSNRRRERCGIPRCDE 131          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO30193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1H4])

HSP 1 Score: 53.1434 bits (126), Expect = 8.177e-9
Identity = 25/82 (30.49%), Postives = 42/82 (51.22%), Query Frame = 3
Query:  129 GREFIGRTSITKNGQQCITWKEEFINK-LQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRN 371
            GR++ G  + T  G  C  W E++ ++  +    +    + L  +NYCRNP    + PWC       +W+YC I+SC K ++
Sbjct:    2 GRDYRGTMNFTAKGVTCQPWNEQWPHQHTEMADPLVAAREGLGKHNYCRNPGGRKHRPWCYTTLEKTRWQYCEIRSCRKTKS 83          

HSP 2 Score: 46.595 bits (109), Expect = 1.833e-6
Identity = 29/87 (33.33%), Postives = 39/87 (44.83%), Query Frame = 3
Query:  390 NGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLNLVG--------NKCRNP-DMSEGPWCYYSTENKR-EECDVPKCDKKFSQ 620
            +GR+Y G +N+T  G  C PW  Q  H      +    LV         N CRNP      PWCY + E  R + C++  C K  S+
Sbjct:    1 DGRDYRGTMNFTAKGVTCQPWNEQWPHQHTEMADP---LVAAREGLGKHNYCRNPGGRKHRPWCYTTLEKTRWQYCEIRSCRKTKSK 84          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO28926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T536])

HSP 1 Score: 52.373 bits (124), Expect = 1.585e-8
Identity = 34/77 (44.16%), Postives = 41/77 (53.25%), Query Frame = 3
Query:  393 GREYLGDVNYTKSGKDCNPWINQ----RTHPKDSFPEKNLNLVGNKCRNPD--MSEGPWCYYSTENKR-EECDVPKC 602
            G  Y G++N TKSG  C PW +Q      H    +PE  L    N CRNP     +GPWCY + +  R E CDVPKC
Sbjct:    7 GVGYHGNINVTKSGISCQPWSSQCPHHHYHNSTQYPE--LINASNFCRNPGGMGPDGPWCYTTNKLVRWEYCDVPKC 81          

HSP 2 Score: 50.8322 bits (120), Expect = 5.122e-8
Identity = 26/82 (31.71%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  129 GREFIGRTSITKNGQQCITWKEE-----FINKLQAGKIINYDSKSLIGNNYCRNPTNF-PNGPWCIIDENTLKWEYCNIKSC 356
            G  + G  ++TK+G  C  W  +     + N  Q  ++IN        +N+CRNP    P+GPWC      ++WEYC++  C
Sbjct:    7 GVGYHGNINVTKSGISCQPWSSQCPHHHYHNSTQYPELIN-------ASNFCRNPGGMGPDGPWCYTTNKLVRWEYCDVPKC 81          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO39763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S935])

HSP 1 Score: 52.7582 bits (125), Expect = 1.885e-8
Identity = 33/82 (40.24%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  393 GREYLGDVNYTKSGKDCNPWINQ--RTHPKDSFPEKNLNLVGNKCRNPD--MSEGPWCYYSTENKR-EECDVPKCDKKFSQI 623
            G  Y G++N TKSG  C PW +Q    H  +S     L    N CRNP     +GPWCY +    R E CDVPKC    + +
Sbjct:   16 GVGYHGNINVTKSGISCQPWSSQCPHRHYHNSTQYTELINASNFCRNPGGMGPDGPWCYTTNMMVRWEYCDVPKCPPPGTVV 97          

HSP 2 Score: 51.2174 bits (121), Expect = 6.558e-8
Identity = 26/82 (31.71%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  129 GREFIGRTSITKNGQQCITWKEE-----FINKLQAGKIINYDSKSLIGNNYCRNPTNF-PNGPWCIIDENTLKWEYCNIKSC 356
            G  + G  ++TK+G  C  W  +     + N  Q  ++IN        +N+CRNP    P+GPWC      ++WEYC++  C
Sbjct:   16 GVGYHGNINVTKSGISCQPWSSQCPHRHYHNSTQYTELIN-------ASNFCRNPGGMGPDGPWCYTTNMMVRWEYCDVPKC 90          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO43993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX97])

HSP 1 Score: 56.225 bits (134), Expect = 5.526e-8
Identity = 27/76 (35.53%), Postives = 39/76 (51.32%), Query Frame = 3
Query:  129 GREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSC 356
            G ++IGR ++TK G  C++WK               D    + +N+CRNP      PWC +D+NT  +EYC I  C
Sbjct:  137 GEDYIGRLNVTKYGMPCLSWKSN-------------DPVYKLSHNFCRNPRGQHEAPWCYVDKNT--YEYCVIPKC 197          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-210b2.3 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:101159605])

HSP 1 Score: 116.701 bits (291), Expect = 4.420e-26
Identity = 85/295 (28.81%), Postives = 139/295 (47.12%), Query Frame = 3
Query: 2190 DNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPI-GTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTF-NGVGEVTNNIFTLVAIESM--TNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKL 3062
            D   VE+     V  P + +      + W   +T  SPWA +  D ++  + S A+R L  P    +L++ ++K    L  +     R+E   AD+QI  G+MH+GYPI G K     +  NE     HM +    G WG +HE+GHN Q   + F     E T N++++   E +   +++   P       K   ++ V    N    +W+   ++AL  Y Q ++ FGW+ F +VF  Y  +    G+  +  K+ L+ +T S+  GM+L   ++ W WPI   T  +LS L
Sbjct:  625 DVHGVEVIVQMAVPAPYY-KSGVTTAEAWSLLRTAPSPWAELEFDNIILTVPSEAVRTLERPEELAQLWNKIMKAIADLAAKPEKFPRKERFVADVQISHGWMHAGYPIMGQK-----SAVNELVNVDHMKSC---GLWGPIHELGHNQQRGCWEFPPNTTECTCNLWSVYVHEEVLGIDRAKAHPNMSLENRKSRARNYVTQGRN--LNSWEM--WVALETYMQLQDKFGWDAFKKVFAAYLQMSQFPGD--NPGKMNLYTETFSQTVGMDLTAFFKAWGWPIQASTEQKLSNL 904          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: plat (plasminogen activator, tissue type [Source:NCBI gene;Acc:100049466])

HSP 1 Score: 90.8929 bits (224), Expect = 2.147e-18
Identity = 61/182 (33.52%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  117 ITTHGREFIGRTSITKNGQQCITWKEEFI-NKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENT-LKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPK--DSFPEKNLNLV---GNKCRNPDMSEGPWC--YYSTENKREECDVPKCDKKFSQIEYFG 635
            I   G  + G  S+T +G++CI W    +  K    +  +     L  +N+CRNP    + PWC I + T + WE C++  C  DRN       G+ Y G    TKSG  C PW       K  +++    L+L     N CRNPD   GPWC  Y   +   E CD+PKC +  S I   G
Sbjct:   79 IVGKGEGYRGTLSVTHSGEECINWNSTSLRGKKFTARKTDASGLGLGNHNFCRNPDQ-DSAPWCYIYKGTQVIWELCSLPKCSGDRNRECVQGLGKSYRGTAAVTKSGSACLPWDAPAVRRKRNNAWKSNALDLGLSNHNFCRNPDGDSGPWCHTYKKMQLTWELCDIPKCSRAPSTITTLG 259          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: plat (plasminogen activator, tissue type [Source:NCBI gene;Acc:100049466])

HSP 1 Score: 90.8929 bits (224), Expect = 2.257e-18
Identity = 61/182 (33.52%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  117 ITTHGREFIGRTSITKNGQQCITWKEEFI-NKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENT-LKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPK--DSFPEKNLNLV---GNKCRNPDMSEGPWC--YYSTENKREECDVPKCDKKFSQIEYFG 635
            I   G  + G  S+T +G++CI W    +  K    +  +     L  +N+CRNP    + PWC I + T + WE C++  C  DRN       G+ Y G    TKSG  C PW       K  +++    L+L     N CRNPD   GPWC  Y   +   E CD+PKC +  S I   G
Sbjct:  111 IVGKGEGYRGTLSVTHSGEECINWNSTSLRGKKFTARKTDASGLGLGNHNFCRNPDQ-DSAPWCYIYKGTQVIWELCSLPKCSGDRNRECVQGLGKSYRGTAAVTKSGSACLPWDAPAVRRKRNNAWKSNALDLGLSNHNFCRNPDGDSGPWCHTYKKMQLTWELCDIPKCSRAPSTITTLG 291          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: plat (plasminogen activator, tissue type [Source:NCBI gene;Acc:100049466])

HSP 1 Score: 90.8929 bits (224), Expect = 2.590e-18
Identity = 63/186 (33.87%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  105 ENCKITTHGREFIGRTSITKNGQQCITWKEEFI-NKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENT-LKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPK--DSFPEKNLNLV---GNKCRNPDMSEGPWC--YYSTENKREECDVPKCDKKFSQIEYFG 635
            E C I   G  + G  S+T +G++CI W    +  K    +  +     L  +N+CRNP    + PWC I + T + WE C++  C  DRN       G+ Y G    TKSG  C PW       K  +++    L+L     N CRNPD   GPWC  Y   +   E CD+PKC +  S I   G
Sbjct:  148 EKC-IVGKGEGYRGTLSVTHSGEECINWNSTSLRGKKFTARKTDASGLGLGNHNFCRNPDQ-DSAPWCYIYKGTQVIWELCSLPKCSGDRNRECVQGLGKSYRGTAAVTKSGSACLPWDAPAVRRKRNNAWKSNALDLGLSNHNFCRNPDGDSGPWCHTYKKMQLTWELCDIPKCSRAPSTITTLG 331          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: mst1 (hepatocyte growth factor-like protein [Source:NCBI gene;Acc:101168450])

HSP 1 Score: 87.4261 bits (215), Expect = 4.691e-17
Identity = 57/165 (34.55%), Postives = 82/165 (49.70%), Query Frame = 3
Query:  117 ITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEK--NLNLVGNKCRNPDMSEGPWCYYSTE-NKREECDVPKC 602
            I   G ++ G+   TK+G  C  W  +F +           + + +  NYCRNP     GPWC   +   ++E CNI  C   ++    T NG +Y G V++T +GK+C  W  Q  H     PEK  + +L  N CRNPD S  PWCY +    +RE C++ KC
Sbjct:  110 IVGKGEDYRGKVFTTKSGLNCQQWWSKFPHD----HWWTPTASNGLELNYCRNPDGDNIGPWCYTTDPERRYESCNIPQC---KDEVCITCNGEDYRGQVDHTATGKECQRWDQQHPHQHIYQPEKYPDKSLDDNYCRNPDASPVPWCYTTDPLVERENCNISKC 267          

HSP 2 Score: 77.7962 bits (190), Expect = 3.532e-14
Identity = 60/175 (34.29%), Postives = 81/175 (46.29%), Query Frame = 3
Query:   99 DIENCK----ITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSC----IKDRNWCKDTDN-----GREYLGDVNYTKSGKDCNPWINQRTHPKDSFPE--KNLNLVGNKCRNPDMSEGPWCYYSTENKR 578
            +I  CK    IT +G ++ G+   T  G++C  W ++  ++    +   Y  KSL  +NYCRNP   P  PWC   +  ++ E CNI  C    ++ R     T N     G +Y G VN T SG  C  W  Q  H     P   +   L  N CRNPD SE PWC+ S    R
Sbjct:  181 NIPQCKDEVCITCNGEDYRGQVDHTATGKECQRWDQQHPHQ-HIYQPEKYPDKSL-DDNYCRNPDASPV-PWCYTTDPLVERENCNISKCPEVPVEKRQRSSFTTNCFRGRGEDYRGKVNETLSGIPCQRWNAQFPHEHPFHPNIYECKGLEENYCRNPDGSEAPWCFTSAPEMR 352          

HSP 3 Score: 68.1662 bits (165), Expect = 3.780e-11
Identity = 69/212 (32.55%), Postives = 96/212 (45.28%), Query Frame = 3
Query:   60 LPLLSRLTSSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYC-NIKSCIKDRNWCKDT--DNGREYLGDVNYTKSGKDCNPW---------INQRTHPKDSFPEKNLNLVGNKCRNPDMSE-GPWCYYSTENKRE--ECDVPKC-DKKFSQIEYFGGYDF 647
            +P+  R  SS+ T   NC     G ++ G+ + T +G  C  W  +F ++      I Y+ K L   NYCRNP +    PWC      ++   C  IK C  D    +D   +NG+ Y G V  T+ G  C  W         IN  THP+        NL  N CRNPD  + GPWC Y+T+ K E   C + +C  +K S  E     +F
Sbjct:  270 VPVEKRQRSSFTT---NC-FRGRGEDYRGKVNETLSGIPCQRWNAQFPHEHPFHPNI-YECKGL-EENYCRNP-DGSEAPWCFTSAPEMRTALCLQIKRCEDDIE-AEDCYQENGKNYRGIVRKTRKGVTCQRWNVNTPHRTKINPLTHPE-------ANLTENYCRNPDGDQHGPWC-YTTDPKTEFDYCAIKQCAGEKVSLTEQIEKVEF 465          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026355.1 (SMESG000026355.1)

HSP 1 Score: 2152.48 bits (5576), Expect = 0.000e+0
Identity = 1065/1073 (99.25%), Postives = 1068/1073 (99.53%), Query Frame = 3
Query:   33 MSYLCFLIALPLLSRLTSSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSIKLESLNSDILNKTSLWATDYNPKCQTDLDEYEYCTIVESKSENENYIISYSCLEPLRHLMFISPLKKTEYTIKYSGKLYKINWKPSERFTEYENKVNEYLQKKNKNELKIQSDQIPGHFILFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKNILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGAXXXXXXXXLN 3251
            MSYLCFLIALPLLSRLTSSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDT+NGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSIKLESLNSDILNKTSLWATDYNPKCQTDLDEYEYCTIVESKSE+ENYIISYSCLEPLRHLMFISPLKKTEYTIKYSGKLYKINWKPSERFTEYENKVNEYLQKKNKNELKIQSDQIPGHF LFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHK ILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLG+YAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVE FSFSFGGLLSISCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKT NELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRF IEGAQIIEEIQILN
Sbjct:    1 MSYLCFLIALPLLSRLTSSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTENGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSIKLESLNSDILNKTSLWATDYNPKCQTDLDEYEYCTIVESKSEDENYIISYSCLEPLRHLMFISPLKKTEYTIKYSGKLYKINWKPSERFTEYENKVNEYLQKKNKNELKIQSDQIPGHFFLFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKKILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGLYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVETFSFSFGGLLSISCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTENELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFAIEGAQIIEEIQILN 1073          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026377.1 (SMESG000026377.1)

HSP 1 Score: 1440.25 bits (3727), Expect = 0.000e+0
Identity = 680/1055 (64.45%), Postives = 854/1055 (80.95%), Query Frame = 3
Query:   57 ALPLLSRLTSSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSIKLESLNSDILNKTSLWATDYNPKCQTDLDEYEYCTIVESKSENENYIISYSCLEPLRHLMFISPLKKTEYTIKYSGKLYKINWKPSERFTEYENKVNEYLQKKNKNELKIQSDQIPGHFILFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKNILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGA 3221
            AL L S    SYFT+IENCKITTHGRE++G T+++KNG+ C++WK+E++N +     I +D+ S+I  NYCRNPTNFPNGPWCI+DE+ L+WE+C+I+SCIK+RNWCKDTD G EYLGD+N+TK+GK C PWI Q  + ++SFPEK+  LVGNKCRNPDMS GPWC+YS + KREEC+VP+CD+KFSQIEYFGGYDFLK I   +T I+L +I Q V  TV+  LESLNSDIL KTSLWATDYNPKCQTDLDEYEYCTIVESK+ +++YIISYSC  P+++L+FI P+ K+EYTIKY G  Y  N  PS++F +YE K+NEY QKK K ++ + SD   GHF L ++N I YA +  N++ VTIS++GKGRI+FLA + +V+  ++P+L+DLF +VYEK VE+P  LTK+Y + +I +N  ++A+ E FIWNAH+ LG +LV  LLQL+ SGL+IIIGVKPWAY  Y    LDSELK+LF+ AG+WPS     + W+TVTK S  TMP Y RLEYAK N  +L+N+S +I + ++++P  K++S+  F L++ SI DLYSNYLP IK LIPC +  +T ES++ L++ FN+IL S FG+ +I PGLSFYPG F S+DI L++ +M+LNL Y  EV+QLG+Y +P   +SV+IT+S SQ CRIFIN+H F+   K ++YKWP T  EF I+RN +E F++ FGGLLSISCD +NDKV+ITF NVV++P+FDRR+KKD KDWI +Q++VSPWAVV+SDTLVFVLSSNAIRNLADP +F+ ++D MVKEEFHL GR+I++S RE++S DIQI AGYMH+GYPIGT+IFWVTNP N+KDYFF  YN+ IDGEWGLMHE+GHNLQE IFTFNG GEV NNIFTLVAIESMTN SSWSP +GWV  K+ +KDLV ++NNGTF+ WK+  ++AL+IYAQ RNSFGWEF++QVFRRYN LKNE+G+ISD +KIQLWIKTTSEISGMNLCPLYELW+WPISQKT  ELSKLQMFLPDDFLTKM+EKRVDEIISKFGG  SV RTPLTIPEKIGPL ++F IEG 
Sbjct:    9 ALLLQSSFILSYFTEIENCKITTHGREYVGYTNVSKNGRPCLSWKKEYLNDIIMDDSIYFDTTSIIETNYCRNPTNFPNGPWCIVDESILEWEHCHIRSCIKERNWCKDTDKGTEYLGDLNFTKTGKICKPWIIQSNYSENSFPEKSFQLVGNKCRNPDMSAGPWCFYSDDYKREECEVPRCDEKFSQIEYFGGYDFLKTISSLITTITLTDICQTVTVTVTFNLESLNSDILRKTSLWATDYNPKCQTDLDEYEYCTIVESKNTSKSYIISYSCFRPMKYLIFICPIDKSEYTIKYLGTFYNFNLSPSKQFDDYEIKMNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKVTVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENPKLLTKKYFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFYYRLEYAKKNLMSLKNLSKSIGNFLAEVPFHKIMSKRTFELLKSSIVDLYSNYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIPEKIGPLKHKFSIEGT 1063          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026354.1 (SMESG000026354.1)

HSP 1 Score: 1429.46 bits (3699), Expect = 0.000e+0
Identity = 730/747 (97.72%), Postives = 737/747 (98.66%), Query Frame = 3
Query: 1011 VNEYLQKKNKNELKIQSDQIPGHFILFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKNILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGAXXXXXXXXLN 3251
            VNEYLQKK+KNELKIQSD  PGHF LFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNS +S++LEPFIW+AHNELGEELVGTLLQLVNSGLRIIIGVKPWAY  Y KNI +SELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLG+YAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEIFSFSFGGLLSISCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKT NELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRF IEGAQIIEEIQILN
Sbjct:   11 VNEYLQKKSKNELKIQSDVNPGHFFLFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSSKSSILEPFIWSAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYDYYKKNIFESELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGLYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEIFSFSFGGLLSISCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTENELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFTIEGAQIIEEIQILN 757          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026376.1 (SMESG000026376.1)

HSP 1 Score: 1224.92 bits (3168), Expect = 0.000e+0
Identity = 593/1057 (56.10%), Postives = 785/1057 (74.27%), Query Frame = 3
Query:   84 SSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSIKLESLNSDILNKTSLWATDYNPKCQTDLDEYEYCTIVESKSENENYIISYSCLEPLRHLMFISPLKKTEYTIKYSGKLYKINWKPSERFTEYENKVNEYLQKKNKNELKIQSDQIPGHFILFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKNILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQ-NWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGAXXXXXXXXLN 3251
            + YF +IE CKI+THG E++G+ +  K+GQ+CI WK E++N++       +D+ S+IGNNYCRNPTNFPNGPWCIIDE TL+WE+CNI  C+KDRNWCKD+D G EYLGD+++TKSGK C PWIN R H  +SFPE N++L GNKCRNPDMS+ PWCYYS   +RE+C+V +CD+  +Q EYFG YD+L+ +    TI+ LD+IY  V  T+SIKLESL S  LNK+S+WAT YN +CQ+DLDEYE+C++ +    +E+YII+Y C  PL++LMFIS L+K+++TIK+ G  Y     PS++F EY+ K+ EY Q KNK E+     + PG+F L  +NAIAYA NA+N+I +TISTVGKGRI F+A +  ++   +  L + F DV++K V  P  L K YLQEIIS+N   S L EPFIWNAH   G+ LV  LL+ + SGLRIIIG KPW+Y +Y K ILDSE+KILF AAG+WPSL Y ++ +K VT+HS+YTM L ++ EYAK+N   + +V  A  ++   I +E+ L + +F+ +++ I DLY++Y P I+ L PC    ++ +S+K  L+FF++IL S  GK +I P L+ YPGKF S + P  +IKM+LNL+Y  EVA LG+Y  PR+  SVKI QSKS  C I++N+HHF++++K E+ KWP TY  F+I+R K E   F FGGL+SISCDE+NDKVEI F NV++IP +DRRNK++ KDWI KQ + SPWAV+A D ++F+L+S AIRNLADP + L+++D M KEEFHL G +   SRR +VS+DIQIGAGYMHSGYPIGT+I++  NP  +  YFF+   L  DG WGLMHE+GHNLQE  FTFNG GE T NIF+++A ESMTN++SWS T+GW  E+L ++ + +++ NGTF  NW+EN F+AL IYAQ +N FGWEF+AQVFRRYN L ++  +IS+++KIQLWIK TSEIS MNLCPLYELW+WPIS  T  ELSK  MFLPDDF+TK VEKR + II + G   SV+R PL +P K+GP+ N+F +EGA+IIE IQILN
Sbjct:   18 AGYFEEIEKCKISTHGGEYMGKVNYGKSGQRCIFWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGPWCIIDEMTLEWEHCNIIKCVKDRNWCKDSDKGTEYLGDISHTKSGKMCKPWINFRKHTANSFPENNVHLAGNKCRNPDMSKVPWCYYSNNYQREDCNVSRCDEAINQPEYFGTYDYLRGLGSSKTIVKLDDIYHTVTVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEFCSVKKLTKTSEDYIITYLCSGPLKYLMFISLLQKSDFTIKHVGTKYP-KPSPSKQFNEYDKKMKEYYQNKNKKEVTFSLARYPGYFYLLKDNAIAYAVNANNKISMTISTVGKGRIGFMAGEDSINLGSYKNLLNYFQDVFDKPVVKPKLLRKSYLQEIISENKSLSVLSEPFIWNAHQTFGQGLVNVLLEYIKSGLRIIIGFKPWSYESYVKPILDSEIKILFYAAGIWPSLHYIEDKFKPVTQHSIYTMSLDKKFEYAKINIKNMNDVLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALALYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTSVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIKRGKWETIQFPFGGLMSISCDENNDKVEIIFKNVIQIPYYDRRNKENSKDWIRKQKIESPWAVLAGDAVIFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPLSRRGIVSSDIQIGAGYMHSGYPIGTQIYYNNNPY-KSGYFFNKEILKKDGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTSGWFHERLTIESVQEYLINGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISKMNLCPLYELWKWPISDATEQELSKFPMFLPDDFVTKSVEKRTNNIIRRRG---SVIRQPLPVPVKVGPVKNKFTVEGAKIIEHIQILN 1069          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026361.1 (SMESG000026361.1)

HSP 1 Score: 1217.6 bits (3149), Expect = 0.000e+0
Identity = 595/1046 (56.88%), Postives = 781/1046 (74.67%), Query Frame = 3
Query:  117 ITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSIKLESLNSDILNKTSLWATDYNPKCQTDLDEYEYCTIVESKSENENYIISYSCLEPLRHLMFISPLKKTEYTIKYSGKLYKINWKPSERFTEYENKVNEYLQKKNKNELKIQSDQIPGHFILFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKNILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEXXXXXXXXXXXXXCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQ-NWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGAXXXXXXXXLN 3251
            +TTHGRE++G+    K+GQ+CI WK E++N++       +D+ S+IGNNYCRNPTNFPNG WCIIDE TL+WE+CNI  CIKDRNWCKD+D G EYLGD+++TKSGK C PWIN  TH   SFPE+NL   GNKCRNPDMS+ PWCYYS   +RE+C+VP+CDK+ +Q E+FG YD+L+ +    TI+ LD+IYQ V  T+SIKLESL S  LNK+S+WAT YN +CQ+DLDEYEYC+I  S + +++YII+Y C  PL++LMFIS L+K+++TIK++G  Y     PS++F EYE K+ EY Q KNKN+  +   + PG+F L  +NAIAYA NA N+I +T+STVGKGRIAF+ +D +++   +  L D F DV++K VESPT L K YLQEIISKN  +S L EPFIWNA    G++LV  LL+ + SGLRIIIG + W+Y+   K +LDSELKILF AAGVWPSL Y  + ++ VT+HS++TM L ++ EYAK+N  T+ +V  A  ++   I +E+ L +I+F+L+++ I DLY++Y P I+ L PC    ++ +S+K  L+FF++IL S  GK +I P LS YPGKF S + P  +IKM+LNL+Y  EVA LG+Y  PR+   VKI QSKS  C I++N+HHF++++K E+ KWP TY  F+IER K E   F FGGL+SISC+E+NDKVEI F NV++IP +DRRNK    +WI KQ + SPWAV+A D +VF+L+S AIRNLADP + L+++D M KEEFHL G +   SRR +VS+DIQIG GYMHSGYPIGT+I+   NP  +  YFF+   L  DG WGLMHE+GHNLQE  FTFNG GE T NIF+++A ESMTN++SWS T+GW  E+L ++ +  ++ +GTF  NW+EN F+AL IYAQ +N FGWEF+AQVFRRYN L ++  +IS+++KIQLWIK TSEISGMNLCPLYELW+WPI+ +T  ELSKL MFLPDDF+TK VEKR+ EII K G   S+ R PL +P K+GP+ N+F +EGA+IIE IQILN
Sbjct:    1 MTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYP-KPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDKIDFDLMKKVINDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNK---DEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPY-KSGYFFNKEILKKDGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRG---SIFRQPLPVPVKVGPVKNKFTVEGAKIIEHIQILN 1038          
The following BLAST results are available for this feature:
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCAF29.693e-3230.41TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF29.693e-3230.41TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF29.764e-3230.41TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF2C1.496e-3130.41TRPM8 channel associated factor 2C [Source:HGNC Sy... [more]
TCAF18.073e-2625.66TRPM8 channel associated factor 1 [Source:HGNC Sym... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cam-14.620e-841.98Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-14.706e-841.98Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-14.915e-841.98Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nrk5.991e-628.95gene:FBgn0020391 transcript:FBtr0087728[more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.39.007e-3331.06si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
si:ch211-210b2.43.618e-3230.72si:ch211-210b2.4 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
si:ch211-210b2.26.915e-3230.72si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-... [more]
zgc:1621939.861e-2928.62zgc:162193 [Source:NCBI gene;Acc:323315][more]
zgc:1621939.861e-2928.62zgc:162193 [Source:NCBI gene;Acc:323315][more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045101.11.853e-3428.01TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000002244.15.302e-3126.61TRPM8 channel-associated factor homolog [Source:NC... [more]
ENSXETT00000045059.15.530e-2931.58TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045084.18.827e-2831.23TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045039.11.697e-2731.23TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tcaf39.140e-3433.33TRPM8 channel-associated factor 3 [Source:MGI Symb... [more]
Tcaf29.512e-3029.51TRPM8 channel-associated factor 2 [Source:MGI Symb... [more]
Tcaf12.079e-2726.39TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf12.079e-2726.39TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf12.079e-2726.39TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6QR59|TCAF3_MOUSE6.394e-3333.33TRPM8 channel-associated factor 3 OS=Mus musculus ... [more]
sp|Q6P6V7|TCAF3_RAT7.801e-3331.99TRPM8 channel-associated factor 3 OS=Rattus norveg... [more]
sp|A6NFQ2|TCAF2_HUMAN4.689e-3130.41TRPM8 channel-associated factor 2 OS=Homo sapiens ... [more]
sp|Q921K8|TCAF2_MOUSE6.653e-2929.51TRPM8 channel-associated factor 2 OS=Mus musculus ... [more]
sp|A4IG42|TCAF_DANRE1.555e-2828.96TRPM8 channel-associated factor homolog OS=Danio r... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A0M81.740e-6032.88Peptidase M60 domain-containing protein OS=Lottia ... [more]
R7UHN93.147e-5826.92Peptidase M60 domain-containing protein OS=Capitel... [more]
A0A1S3I0H43.624e-5733.71TRPM8 channel-associated factor 2-like OS=Lingula ... [more]
V3ZHF72.821e-5626.32Peptidase M60 domain-containing protein OS=Lottia ... [more]
A0A1S3KG347.440e-5533.26TRPM8 channel-associated factor 2 OS=Lingula ungui... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.31.500e-2525.93si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
ENSAMXT00000018418.28.648e-2030.47plasminogen [Source:NCBI gene;Acc:103036400][more]
ENSAMXT00000018419.29.163e-2030.47plasminogen [Source:NCBI gene;Acc:103036400][more]
ENSAMXT00000051129.15.203e-1828.90pep primary_assembly:Astyanax_mexicanus-2.0:1:5658... [more]
mst13.505e-1735.76macrophage stimulating 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000976.17.533e-2827.70pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 ... [more]
ENSPMAT00000003778.11.886e-1932.54pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 g... [more]
ENSPMAT00000001728.16.551e-1136.78pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 ... [more]
hgfb2.298e-1031.08hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO301938.177e-930.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289261.585e-844.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397631.885e-840.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439935.526e-835.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.34.420e-2628.81TRPM8 channel-associated factor homolog [Source:NC... [more]
plat2.147e-1833.52plasminogen activator, tissue type [Source:NCBI ge... [more]
plat2.257e-1833.52plasminogen activator, tissue type [Source:NCBI ge... [more]
plat2.590e-1833.87plasminogen activator, tissue type [Source:NCBI ge... [more]
mst14.691e-1734.55hepatocyte growth factor-like protein [Source:NCBI... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026355.10.000e+099.25SMESG000026355.1[more]
SMESG000026377.10.000e+064.45SMESG000026377.1[more]
SMESG000026354.10.000e+097.72SMESG000026354.1[more]
SMESG000026376.10.000e+056.10SMESG000026376.1[more]
SMESG000026361.10.000e+056.88SMESG000026361.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024252 ID=SMED30024252|Name=Peptidase M60 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3335bp
CCAGGTAATGCATTATTGAAACAACAAAGTCAATGAGTTATTTATGTTTC
CTAATTGCTTTGCCATTACTGAGCAGACTCACTTCATCTTATTTTACAGA
TATTGAAAACTGTAAAATCACGACTCACGGTAGAGAATTCATTGGAAGGA
CGAGCATAACGAAAAATGGACAACAATGCATTACCTGGAAAGAGGAATTT
ATAAATAAATTACAAGCGGGTAAAATTATAAATTATGACAGTAAGTCACT
TATTGGTAACAATTACTGTCGAAATCCAACAAACTTTCCAAACGGTCCGT
GGTGCATTATCGACGAGAATACATTAAAATGGGAATATTGCAATATTAAA
AGTTGTATAAAAGATCGAAACTGGTGCAAAGATACAGACAACGGGAGAGA
ATATCTTGGTGACGTAAATTATACGAAATCCGGTAAAGACTGTAATCCTT
GGATTAATCAAAGAACACATCCTAAAGATTCCTTTCCGGAAAAAAATCTC
AATCTGGTTGGAAACAAATGTCGTAATCCAGATATGTCCGAAGGTCCTTG
GTGCTATTATTCAACTGAAAATAAAAGAGAAGAATGCGATGTACCAAAAT
GTGATAAAAAATTCAGTCAGATTGAATATTTCGGAGGTTATGATTTTTTG
AAGCTAATTCCGGACCAAATGACAATAATTTCACTGGATAACATTTACCA
GGACGTGAAAGCTACCGTATCCATCAAACTCGAGTCTCTGAATTCTGATA
TTCTCAATAAAACTTCTTTGTGGGCAACGGATTATAATCCCAAATGTCAA
ACCGATTTAGACGAGTACGAATATTGTACAATAGTGGAATCGAAATCTGA
AAACGAAAATTACATTATTTCCTATTCATGTTTGGAACCATTGAGGCATT
TGATGTTCATTTCTCCTCTAAAGAAGACGGAATACACTATCAAATATTCA
GGAAAGCTTTATAAAATCAATTGGAAACCCAGTGAAAGGTTCACAGAATA
TGAAAATAAAGTGAATGAATATTTGCAAAAGAAAAACAAAAATGAATTGA
AAATTCAATCGGACCAAATCCCTGGACATTTCATTTTATTCAGTAATAAC
GCAATTGCGTATGCGACTAATGCGGATAATCAAATTCCCGTGACAATTTC
AACAGTTGGGAAAGGCCGGATTGCTTTTCTTGCAGCTGACGGCGTGGTGG
ATTCTATATACTTTCCACAATTAAAAGACTTATTCAATGATGTCTATGAA
AAACAAGTAGAAAGTCCAACGTATTTGACAAAGGAATATTTGCAAGAGAT
AATTTCCAAGAATAGTCATGAATCTGCATTATTGGAACCTTTCATTTGGA
ATGCTCATAACGAATTGGGAGAAGAATTAGTTGGTACTTTACTGCAATTA
GTAAATTCAGGATTAAGGATAATTATTGGCGTGAAGCCATGGGCATATGT
TACTTATCATAAAAATATTTTGGATAGTGAACTGAAAATTCTTTTTCAAG
CGGCTGGTGTTTGGCCATCACTTATTTATGCTGACAATAATTGGAAAACC
GTTACTAAACATTCAGTATACACCATGCCGTTGTATCAAAGGCTTGAATA
TGCTAAATTAAATGCGAACACCCTACAAAATGTTTCAGGTGCTATTGTGG
ACATAATTTCTAAAATTCCAGTTGAAAAGGTTCTGAGTGAAATAAACTTT
AATTTAATAAGAGAAAGCATTTTTGACCTGTACTCGAATTATTTACCACT
TATTAAAGGTCTAATTCCTTGTTGGGAAGTTGGTCTTACTGACGAATCAA
ATAAAAGCCTACTTAGGTTTTTCAACTTTATTTTAGCTTCACCTTTTGGA
AAAAGGATAATTGTTCCTGGATTATCATTTTATCCAGGAAAATTTCATTC
GAATGATATTCCATTGAAGGACATTAAAATGAGACTCAATCTTATTTATC
ACAAAGAAGTTGCCCAGCTTGGAATTTATGCAATTCCCCGTGTGGATATT
TCAGTTAAAATTACGCAATCAAAATCTCAATTTTGCCGCATATTCATTAA
TTATCACCATTTTGACGTATCTGAGAAACCTGAAATGTATAAATGGCCTA
AAACTTATGTAGAATTTTCTATTGAAAGAAACAAAGTGGAAATATTTTCA
TTTTCGTTTGGTGGATTGCTTTCTATTTCTTGTGATGAAGATAATGATAA
AGTTGAAATAACATTCAATAATGTCGTAGAAATACCATTATTTGATAGGA
GAAACAAAAAAGATATAAAAGATTGGATCCACAAGCAAACCTTAGTTTCC
CCATGGGCAGTTGTAGCCAGTGACACTCTTGTATTCGTATTATCATCAAA
TGCTATTCGTAATTTAGCTGATCCAAATTCGTTTTTAGAATTGTTCGATG
TGATGGTGAAGGAAGAATTCCATTTGATAGGAAGAACAATTGCTTCAAGC
CGTAGAGAAATGGTATCAGCGGATATACAAATTGGAGCTGGATATATGCA
TTCAGGATATCCTATCGGCACAAAGATATTCTGGGTCACGAATCCCGCTA
ATGAAAAGGATTATTTTTTCCACATGTATAATCTCAACATTGATGGTGAA
TGGGGCTTGATGCATGAGGTTGGACATAATTTACAAGAATCCATATTTAC
TTTCAACGGAGTCGGTGAAGTAACCAATAACATTTTCACATTAGTGGCTA
TTGAATCTATGACTAATAAAAGCTCTTGGTCTCCAACCAATGGATGGGTT
CCAGAAAAACTTTATGTTAAGGATCTAGTAGACCACATAAATAATGGCAC
ATTTCAAAATTGGAAGGAAAATGATTTCTTAGCTTTAGCTATCTATGCGC
AACAACGAAATAGTTTTGGATGGGAGTTTTTTGCTCAAGTATTTCGTCGA
TACAATGTTTTAAAAAATGAACTTGGAAACATTTCTGATGAAGACAAAAT
TCAGCTGTGGATAAAAACTACTTCTGAAATATCCGGAATGAATTTGTGTC
CCTTATATGAGCTGTGGAGATGGCCTATTAGTCAGAAAACTGCAAACGAA
TTATCCAAACTTCAAATGTTTCTCCCCGATGATTTCCTTACCAAAATGGT
CGAAAAGAGAGTTGATGAAATAATTTCAAAGTTTGGTGGAGCAAAATCGG
TTCTCCGTACGCCTTTGACAATTCCAGAAAAAATTGGGCCTTTGACAAAT
AGATTTGTAATTGAAGGAGCACAAATCATCGAGGAAATTCAAATATTGAA
TTGATTAAAACATTTGTGTTTTTAACAATCAAATGACAAAATTGAAAATT
GAAAATAATATAAATGAATATCTTTGCTTTCTAAA
back to top

protein sequence of SMED30024252-orf-1

>SMED30024252-orf-1 ID=SMED30024252-orf-1|Name=SMED30024252-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1074bp
MSYLCFLIALPLLSRLTSSYFTDIENCKITTHGREFIGRTSITKNGQQCI
TWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKW
EYCNIKSCIKDRNWCKDTDNGREYLGDVNYTKSGKDCNPWINQRTHPKDS
FPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREECDVPKCDKKFSQIEYF
GGYDFLKLIPDQMTIISLDNIYQDVKATVSIKLESLNSDILNKTSLWATD
YNPKCQTDLDEYEYCTIVESKSENENYIISYSCLEPLRHLMFISPLKKTE
YTIKYSGKLYKINWKPSERFTEYENKVNEYLQKKNKNELKIQSDQIPGHF
ILFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDL
FNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELV
GTLLQLVNSGLRIIIGVKPWAYVTYHKNILDSELKILFQAAGVWPSLIYA
DNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKV
LSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFI
LASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGIYA
IPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERN
KVEIFSFSFGGLLSISCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIH
KQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIG
RTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYN
LNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWS
PTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFF
AQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPIS
QKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEK
IGPLTNRFVIEGAQIIEEIQILN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR042279Pep_M60_3
IPR035423M60-like_N
IPR038178Kringle_sf
IPR000001Kringle
IPR031161Peptidase_M60_dom
IPR018056Kringle_CS
IPR013806Kringle-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 327..347
NoneNo IPR availablePRINTSPR00018KRINGLEcoord: 163..183
score: 46.81
coord: 139..151
score: 37.3
coord: 186..197
score: 37.42
coord: 123..138
score: 32.19
NoneNo IPR availablePANTHERPTHR15730EXPERIMENTAL AUTOIMMUNE PROSTATITIS ANTIGEN 2-RELATEDcoord: 647..1019
NoneNo IPR availablePANTHERPTHR15730:SF5SI:CH211-210B2.2-RELATEDcoord: 647..1019
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.722
IPR031161Peptidase family M60 domainSMARTSM01276M60_like_2coord: 648..953
e-value: 1.8E-47
score: 173.7
IPR031161Peptidase family M60 domainPFAMPF13402Peptidase_M60coord: 739..1002
e-value: 9.7E-38
score: 130.2
IPR031161Peptidase family M60 domainPROSITEPS51723PEPTIDASE_M60coord: 648..953
score: 50.261
IPR000001KringleSMARTSM00130KR_2coord: 32..117
e-value: 3.4E-11
score: 53.2
coord: 120..199
e-value: 9.0E-17
score: 71.7
IPR000001KringlePFAMPF00051Kringlecoord: 125..197
e-value: 7.8E-14
score: 51.7
coord: 37..115
e-value: 7.5E-16
score: 58.2
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 39..115
score: 15.783
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 127..197
score: 16.821
IPR000001KringleCDDcd00108KRcoord: 121..198
e-value: 3.87286E-20
score: 83.5815
IPR042279Peptidase M60, enhancin-like domain 3GENE3DG3DSA:1.10.390.30coord: 875..1036
e-value: 1.7E-25
score: 91.8
IPR035423M60-like domain, N-terminalPFAMPF17291M60-like_Ncoord: 654..734
e-value: 1.6E-6
score: 28.0
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 20..115
e-value: 9.7E-19
score: 70.0
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 116..206
e-value: 1.2E-19
score: 72.8
IPR018056Kringle, conserved sitePROSITEPS00021KRINGLE_1coord: 85..98
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 125..206
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 16..118