SMED30024248

Overview
NameSMED30024248
Smed IDSMED30024248
Length (bp)1592
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024248 (SMED30024248) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024248 (SMED30024248) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024248 (SMED30024248) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024248 (SMED30024248) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024248

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024248 dd_Smed_v4_6835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024248 dd_Smed_v4_6835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024248 dd_Smed_v4_6835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024248 dd_Smed_v4_6835_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30024248 dd_Smed_v4_6835_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30024248 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002706:22364..23955 -7879
Homology
BLAST of SMED30024248 vs. Ensembl Human
Match: LRRTM2 (leucine rich repeat transmembrane neuronal 2 [Source:HGNC Symbol;Acc:HGNC:19409])

HSP 1 Score: 65.855 bits (159), Expect = 8.446e-11
Identity = 46/123 (37.40%), Postives = 69/123 (56.10%), Query Frame = 2
Query:  641 LKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            L++  +  ++ + F +  QL  L +  NQIS +   +F+GL  L  L LSSN+   F      F ++ NL  LDLSFN++++L  ++F GL KLQ LHL +N L  I    F    SL +L+L
Sbjct:   68 LRHNHITELERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNKI--FYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDL 188          

HSP 2 Score: 55.4546 bits (132), Expect = 1.557e-7
Identity = 58/187 (31.02%), Postives = 92/187 (49.20%), Query Frame = 2
Query:  566 KIENIKLDSWSSEYLSVCQSVEIIILKN--LQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLC-LNPIKANLIKIFISADSIQCVEM 1117
            +I  +K D++   Y    +  E+I+  N    L N  F   +N   L+ L + FNQ+S +    F GL+ L  L L SN     T     F +  +L  LDLS NR+ +L+   F GL+KL++LHL +N L  I+   F  L SL  L L  N    + +L C +      L K+ ++ + I+ +++
Sbjct:   96 QISTVKEDAFQGLY----KLKELILSSNKIFYLPNTTFTQLIN---LQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLR--TIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNK---ISNLTCGMEWTWGTLEKLDLTGNEIKAIDL 270          

HSP 3 Score: 53.9138 bits (128), Expect = 5.220e-7
Identity = 45/159 (28.30%), Postives = 75/159 (47.17%), Query Frame = 2
Query:  542 GLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            GL KL+ L + +  L +        C+S+E + L   +L ++    F    +L+ L +  NQ+++I+   F  L  L  L L  N+  + T         G L KLDL+ N I A+ + +F  +  L+ L ++NN L  +D+     L SL  + L  N
Sbjct:  155 GLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNKISNLTCGMEW--TWGTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLDSKILNSLRSLTTVGLSGN 311          
BLAST of SMED30024248 vs. Ensembl Human
Match: LRRTM3 (leucine rich repeat transmembrane neuronal 3 [Source:HGNC Symbol;Acc:HGNC:19410])

HSP 1 Score: 65.855 bits (159), Expect = 9.683e-11
Identity = 45/121 (37.19%), Postives = 65/121 (53.72%), Query Frame = 2
Query:  656 LENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L+ + +  F    QL  L +  N IS I   +F G++ L  L LSSN+  +F  N   FR + NL  LDLS+N++ +L  + F GL KL  LHL +N L  I    F+   +L  L+L +N
Sbjct:   73 LQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNT--FRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYN 191          

HSP 2 Score: 61.2326 bits (147), Expect = 2.586e-9
Identity = 52/201 (25.87%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  530 NFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLN-------PIKANLIKIFISADSIQCV 1111
            N   GLN+L  L +++  + +      +  + ++ +IL + ++       F     L+ L + +NQ+  +    F+GL+ L  L L SN     T     F++  NL  LDL +NRI +L+  +F G+++L++LHL +N    ++   F  L+SL  L L  N   ++   +           +  N I+ F      QCV
Sbjct:   79 NQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLR--TIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYLQWNKISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCV 277          
BLAST of SMED30024248 vs. Ensembl Human
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 65.4698 bits (158), Expect = 1.428e-10
Identity = 52/161 (32.30%), Postives = 81/161 (50.31%), Query Frame = 2
Query:  536 LSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
             SGL  L+QL +E   L +  +E LS  +S+  + LK+L + N+   AF   F LK L I +  +  + ++    L  L   SLS       T     F+ +  L  L+LS+N I+ +   MF  L++LQ+LH+    L  I+  +F+GL  L  LN+  N
Sbjct:  173 FSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPL--LDMMPANSLYGLNLTSLSVTNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQN 331          
BLAST of SMED30024248 vs. Ensembl Human
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 65.4698 bits (158), Expect = 1.428e-10
Identity = 52/161 (32.30%), Postives = 81/161 (50.31%), Query Frame = 2
Query:  536 LSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
             SGL  L+QL +E   L +  +E LS  +S+  + LK+L + N+   AF   F LK L I +  +  + ++    L  L   SLS       T     F+ +  L  L+LS+N I+ +   MF  L++LQ+LH+    L  I+  +F+GL  L  LN+  N
Sbjct:  173 FSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPL--LDMMPANSLYGLNLTSLSVTNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQN 331          
BLAST of SMED30024248 vs. Ensembl Human
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 65.4698 bits (158), Expect = 1.428e-10
Identity = 52/161 (32.30%), Postives = 81/161 (50.31%), Query Frame = 2
Query:  536 LSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
             SGL  L+QL +E   L +  +E LS  +S+  + LK+L + N+   AF   F LK L I +  +  + ++    L  L   SLS       T     F+ +  L  L+LS+N I+ +   MF  L++LQ+LH+    L  I+  +F+GL  L  LN+  N
Sbjct:  173 FSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPL--LDMMPANSLYGLNLTSLSVTNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQN 331          
BLAST of SMED30024248 vs. Ensembl Celegans
Match: lron-15 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q18902])

HSP 1 Score: 66.6254 bits (161), Expect = 2.932e-11
Identity = 48/133 (36.09%), Postives = 74/133 (55.64%), Query Frame = 2
Query:  620 QSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            +++E + L+N QL +  F +     +L+ L +  NQI +I   S   L  L HLSL+ NQ +  T N  G      L  L+L+ N+I ++S + F  L  LQQL L++N++  I +M F  L +L YL+L HN
Sbjct:  510 KNLESLFLQNNQLAH--FPSLFRLDKLRHLMLDNNQIQKIDNFSLADLPKLQHLSLAGNQLDIITENMFGSSSSSELKSLNLAHNKIHSISSRSFSDLDNLQQLRLSHNNIRTITSMTFSNLRNLRYLDLSHN 640          

HSP 2 Score: 55.0694 bits (131), Expect = 1.280e-7
Identity = 68/227 (29.96%), Postives = 97/227 (42.73%), Query Frame = 2
Query:  344 NLINFTYQRKLTFFNYCKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAF--VNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            N+ ++     +    Y  V   +I   S    + +KNLESL        Q N L+         L  L+KL+ L ++N ++    +  L+    ++ + L   QL+ I    F   +  +LK L +  N+I  IS  SF  L  L  L LS N     T     F  + NL  LDLS NRI  +       L  L  LHL++N+L  ID  AF     L  L L HN
Sbjct:  475 NMSDYLIFEHMPLLTYVDVSFNRIRFISPRVFEKLKNLESL------FLQNNQLAHFP-----SLFRLDKLRHLMLDNNQIQKIDNFSLADLPKLQHLSLAGNQLDIITENMFGSSSSSELKSLNLAHNKIHSISSRSFSDLDNLQQLRLSHNNIR--TITSMTFSNLRNLRYLDLSHNRIIKILPSALYQLPALDVLHLDHNNLNEIDRDAFRSFSDLQSLKLSHN 688          
BLAST of SMED30024248 vs. Ensembl Celegans
Match: sym-1 (SYM-1 protein [Source:UniProtKB/TrEMBL;Acc:G5EFP4])

HSP 1 Score: 56.6102 bits (135), Expect = 3.801e-8
Identity = 49/166 (29.52%), Postives = 83/166 (50.00%), Query Frame = 2
Query:  527 ENFLSGL-NKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKY-LTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            ++  +GL N +++L +    L    +  L+  + + I+ LK  ++ENI  +AFVN   L  + +  NQI  ++  +F  +K  L +L L +N    F +     R + NLI L + +N+I A+    F+ L  L  L LN N++  I   A +   +L YL L  N
Sbjct:  100 DHAFTGLENVMQELSLSENNLKEVPTSALAGLRVLNILSLKCNKIENITTKAFVNMTSLIDVNLGCNQICSMAADTFANVKMSLQNLILDNNCMTEFPSKA--VRNMNNLIALHIKYNKINAIRQNDFVNLTSLSMLSLNGNNISEIKGGALQNTPNLHYLYLNEN 263          
BLAST of SMED30024248 vs. Ensembl Celegans
Match: let-4 (Leucine-rich repeat-containing protein let-4 [Source:UniProtKB/Swiss-Prot;Acc:Q93373])

HSP 1 Score: 53.5286 bits (127), Expect = 2.891e-7
Identity = 47/189 (24.87%), Postives = 88/189 (46.56%), Query Frame = 2
Query:  437 KQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYL 1003
            +Q   N+ SL YL + G +   L+  A   + F     +L+ L + N ++ +  +  LS  + +  + L + ++ NI   AF N   + +L +  N++  ++     GL  L  +S   NQ +  T N N F +  +L+ LDL+ N++  ++   F+  + L  + L+ N L      AF   +  V L
Sbjct:  249 RQAFLNVPSLRYLYLSGNKITKLT--AYQFQTF----EQLEMLDLTNNEIGAIPANSLSGLKQLRQLYLAHNKISNISSNAFTNS-SIVVLVLSSNELKTLTAGIISGLPNLQQVSFRDNQIK--TINRNAFYDAASLVMLDLAKNQLTEIAPTTFLAQLNLLLVDLSENKLPKTPYSAFNSRVGTVLL 428          

HSP 2 Score: 50.0618 bits (118), Expect = 3.343e-6
Identity = 36/108 (33.33%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  695 QLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            QL++L +  N+I  I   S  GLK L  L L+ N+  + ++N   F    +++ L LS N +  L+  +  GL  LQQ+   +N ++ I+  AF    SLV L+L  N
Sbjct:  281 QLEMLDLTNNEIGAIPANSLSGLKQLRQLYLAHNKISNISSNA--FTN-SSIVVLVLSSNELKTLTAGIISGLPNLQQVSFRDNQIKTINRNAFYDAASLVMLDLAKN 385          
BLAST of SMED30024248 vs. Ensembl Celegans
Match: egg-6 (Leucine-rich repeat-containing protein egg-6 [Source:UniProtKB/Swiss-Prot;Acc:P90920])

HSP 1 Score: 48.9062 bits (115), Expect = 9.369e-6
Identity = 61/222 (27.48%), Postives = 99/222 (44.59%), Query Frame = 2
Query:  422 DSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENF-LSGLNKLKQLKIENIKLDSWSS---------EYL-------SVCQSVEIIILKNLQLENIDFEAFVNCFQLKILT------IIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            D+IP  Q+++N  +L YL +     N++S    +I NF L  L  L++L+++N  L              +YL       S      +   KNL++ ++   A      LK L       +  N I++I  L+F     L  +S+ +N     + N   F  +  L+ L +  N +A +   MF G+  LQQL + NN L  +D  +F  L  L  L+L HN
Sbjct:  188 DAIPA-QILRNAANLMYLDLG---SNNIS----EINNFELMNLPFLRELRVQNNTLRRIHPMAFMNVPQLQYLYLQDNIISTLDGNRLQGFKNLEVLDVSNNALYALPSLKDLPNLKQVRVDGNLITKIETLAFSNNPNLQLISVQNNNIVQISRNS--FESLDKLVVLLVGNNSLAKIERGMFDGMKNLQQLSIRNNTLTALDASSFAQLAHLTTLDLGHN 399          
BLAST of SMED30024248 vs. Ensembl Fly
Match: rk (gene:FBgn0003255 transcript:FBtr0080610)

HSP 1 Score: 68.5514 bits (166), Expect = 1.129e-11
Identity = 55/160 (34.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  542 GLNKLKQLKIENIK-LDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            G++KL++L + +++ L S+    L  C ++EI+ L    ++ +         +LK L +  N + RI  LS    + L  L LSSNQ E     G  F  +  L  L LS+NRI AL    F G+ KLQ L L  N++ +I   AF G  +L  LNL +N
Sbjct:  414 GMSKLRKLILSDVRTLRSFPE--LEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLS--SCRDLRLLDLSSNQIEKI--QGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNN 567          
BLAST of SMED30024248 vs. Ensembl Fly
Match: CG7509 (gene:FBgn0035575 transcript:FBtr0073362)

HSP 1 Score: 65.4698 bits (158), Expect = 6.674e-11
Identity = 73/256 (28.52%), Postives = 121/256 (47.27%), Query Frame = 2
Query:  383 FNYCKVGILKISSD------------SIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVE 1114
            +N+C  G+ + + D            S+P  Q+I     +N + ID   +N LS +  D      GL  LK+L I +  LD    +      S+ ++ ++N QLE+ID   F     L IL +  N+I  +    F   + LT +++  NQ ++F    N  R+   L +LD+S N+I+ LS      L KL+ L    N +  ID+  F GL SL  L+ LHN ++        N + ANL+ + ++ + I  ++
Sbjct:  146 WNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIP----MNMVNID-LSRNILSTLHKDT---FRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPP--NLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLS-LHNNRISSLSGTIFNNL-ANLVTLDLTTNRISHID 389          

HSP 2 Score: 52.7582 bits (125), Expect = 6.067e-7
Identity = 37/108 (34.26%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  695 QLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            +LK L   +NQI++I    F GL+ L  LSL +N+    +  G  F  + NL+ LDL+ NRI+ +    F+ L  L +L L  N +  I    F  + +L  L L  N
Sbjct:  326 KLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLS--GTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSN 431          
BLAST of SMED30024248 vs. Ensembl Fly
Match: Con (gene:FBgn0005775 transcript:FBtr0309972)

HSP 1 Score: 62.003 bits (149), Expect = 9.866e-10
Identity = 56/191 (29.32%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  512 VALDIENFLSGLNKLKQLKIEN---IKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKANLI 1075
            +ALD + F + + +L++L +E+    ++D ++   L +C   E + L N  +  +    F +  +L  L +  NQI+ ++   F+GL  L  L L+ N           F E+ +L +L+L  NRI  +S +   GL  L+ L+L NN L+ IDN    G  +L+ +N+  N KL         PI  NL+
Sbjct:  220 MALDQDAFANHI-RLRELNLEHNQIFEMDRYAFRNLPLC---ERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFI--GDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQAN-KLETLTFYTFQPIMDNLV 403          

HSP 2 Score: 52.7582 bits (125), Expect = 7.265e-7
Identity = 52/182 (28.57%), Postives = 82/182 (45.05%), Query Frame = 2
Query:  545 LNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGL------------------------KYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L  L  + IE  +++   S   +    +E IIL N  +  +D +AF N  +L+ L +  NQI  +   +F+ L                          LT L+L+ NQ    T+    FR +GNL  L L+ N +  +   +F  L  L +L L++N +E I   A +GL +L  LNL +N
Sbjct:  182 LKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEI--FRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNN 361          
BLAST of SMED30024248 vs. Ensembl Fly
Match: Con (gene:FBgn0005775 transcript:FBtr0073375)

HSP 1 Score: 62.003 bits (149), Expect = 9.866e-10
Identity = 56/191 (29.32%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  512 VALDIENFLSGLNKLKQLKIEN---IKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKANLI 1075
            +ALD + F + + +L++L +E+    ++D ++   L +C   E + L N  +  +    F +  +L  L +  NQI+ ++   F+GL  L  L L+ N           F E+ +L +L+L  NRI  +S +   GL  L+ L+L NN L+ IDN    G  +L+ +N+  N KL         PI  NL+
Sbjct:  220 MALDQDAFANHI-RLRELNLEHNQIFEMDRYAFRNLPLC---ERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFI--GDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNNLLKKIDNGLLRGTPALLSINVQAN-KLETLTFYTFQPIMDNLV 403          

HSP 2 Score: 52.7582 bits (125), Expect = 7.265e-7
Identity = 52/182 (28.57%), Postives = 82/182 (45.05%), Query Frame = 2
Query:  545 LNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGL------------------------KYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L  L  + IE  +++   S   +    +E IIL N  +  +D +AF N  +L+ L +  NQI  +   +F+ L                          LT L+L+ NQ    T+    FR +GNL  L L+ N +  +   +F  L  L +L L++N +E I   A +GL +L  LNL +N
Sbjct:  182 LKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEI--FRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRNN 361          
BLAST of SMED30024248 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330733)

HSP 1 Score: 61.6178 bits (148), Expect = 1.376e-9
Identity = 64/230 (27.83%), Postives = 105/230 (45.65%), Query Frame = 2
Query:  626 VEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQC----EHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN-----PKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSNDCQSPSEMTRH-----------TTTVSETLPLKAGSPN 1255
            VE + L+   L  I    F    +L++L +  NQI  I   SF+ L  L  L L++N+     E+F T+        +L++LD+S N I  +  ++F G   L+ L L+NN +  +D  AF+GL+ L  L L +N     P  I   L         L  + +S +   C    S LS F +S  ++   +  CQSPS++               + ++E  P++ G+ N
Sbjct:  102 VERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSS------ASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGL-------GRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTR-CQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAEN 317          

HSP 2 Score: 51.9878 bits (123), Expect = 1.514e-6
Identity = 37/101 (36.63%), Postives = 53/101 (52.48%), Query Frame = 2
Query:  722 NQISRISILS-FKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNP 1021
            N++ RIS    F  L +L  L L  NQ      N   F    ++ +L L  N+I  +S KMF+GL +L+ L+L +N +  +   +FE L SL  LNL  NP
Sbjct:  580 NELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNA--FEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNP 678          
BLAST of SMED30024248 vs. Ensembl Zebrafish
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 69.3218 bits (168), Expect = 5.937e-12
Identity = 52/152 (34.21%), Postives = 80/152 (52.63%), Query Frame = 2
Query:  677 AFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLN-PIKA--NLIKIFISADSIQCVEMKS 1123
            AF     +++L + FN ++ +S     GL  L  L LS N       +   F +   L +LDLS+N+++ L    F+GL  L+QLH+ NN + FI + AF GL +L  L+L  N   I + +  +N P  A  NL K+F+  + I+ V  KS
Sbjct:  131 AFWGLNNMEVLQLEFNNLTEVSKGWLYGLLTLQQLHLSHNSISRIKPDAWEFCQ--KLAELDLSWNQLSRLEEGSFVGLSVLEQLHIGNNRISFIADGAFRGLTNLQTLDLKFNE--ISWTIEDMNGPFSALDNLRKLFLQGNRIRSVTRKS 278          

HSP 2 Score: 66.6254 bits (161), Expect = 3.687e-11
Identity = 70/218 (32.11%), Postives = 106/218 (48.62%), Query Frame = 2
Query:  374 LTFFNYCKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQL-----KIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            LTF     +  LK+  + I  + M      LN + +   + N+L+ V+   + +L GL  L+QL      I  IK D+W       CQ +  + L   QL  ++  +FV    L+ L I  N+IS I+  +F+GL  L  L L  N+      + NG F  + NL KL L  NRI +++ K F GL  L+QL L+NN +  +   AF  +  L  L+L
Sbjct:  106 LTFQGLHGLRSLKMQRNGI-SRLMDGAFWGLNNMEVLQLEFNNLTEVS---KGWLYGLLTLQQLHLSHNSISRIKPDAWE-----FCQKLAELDLSWNQLSRLEEGSFVGLSVLEQLHIGNNRISFIADGAFRGLTNLQTLDLKFNEISWTIEDMNGPFSALDNLRKLFLQGNRIRSVTRKSFTGLEMLEQLDLSNNAIMSLQANAFSQMKKLSELHL 314          
BLAST of SMED30024248 vs. Ensembl Zebrafish
Match: LRRTM4 (leucine rich repeat transmembrane neuronal 4 [Source:HGNC Symbol;Acc:HGNC:19411])

HSP 1 Score: 68.9366 bits (167), Expect = 7.188e-12
Identity = 82/298 (27.52%), Postives = 133/298 (44.63%), Query Frame = 2
Query:  164 LSAIITIELWRFT--LARIPCPQKLCRCDENGQPWKCEIRRDQD-----QIDCSQDLSLSEPINVNLNLINFTYQRKLTFFNYCKVGILKISSDSIPG--KQMIKNLESLNYLIIDGTQ----KNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L  +I +  W     L + PCP+  CRCD  G+   CE    +D      I C Q LSL     VNL    F    +L +        L +  + I G  KQ  + +  L  LI+   +    +NS      ++ N     NKL+ L+          +++  + + + + I  N  L+ +    F +C  L+ L + +N++  ++  +F GL  LT L L  NQ      N + F  + NL  L L +NRI +++  +      LQ+L L+ NDL+ +D+  F+ L +L  LNL  N
Sbjct:   16 LKGVIILSRWLMIPLLVQKPCPRS-CRCD--GKIVYCESNAFRDVPKNVSIGC-QGLSLRYNSLVNLRAGQFASLSQLVW--------LYLDHNYISGVDKQAFQGVRRLKELILSSNKITHLENSTFHSIPNLRNLDLSYNKLQILQ---------PNQFQGLRKLLSLHIRSN-SLKTVPMRVFQDCRNLEFLDLGYNRLRSLTRNAFAGLLKLTELHLEHNQFSKI--NFSHFPRLNNLRALYLQWNRIKSITQGITWTWTSLQKLDLSGNDLQVLDSSIFQCLPNLQTLNLDSN 289          
BLAST of SMED30024248 vs. Ensembl Zebrafish
Match: lrig1 (leucine-rich repeats and immunoglobulin-like domains 1 [Source:ZFIN;Acc:ZDB-GENE-031113-23])

HSP 1 Score: 68.1662 bits (165), Expect = 1.807e-11
Identity = 50/158 (31.65%), Postives = 78/158 (49.37%), Query Frame = 2
Query:  545 LNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L KL QL++   +L            S+E++ L+   +  +   AF    ++++L + +N +  ++  S  GL+ L  L L++N   +F   G GF E   L +L+LS+N +  LS   F  LV L  L L +N +  I   AF GL SL  L L HN
Sbjct:  201 LPKLTQLELSRNRLRLIEGLTFQGLSSLEVLKLQRNNISKLTDGAFWGLARMRVLHLDYNSLREVNSGSLYGLESLLQLYLANNSISNFNPEGWGFCE--RLRELNLSYNNLTKLSEGSFAKLVNLISLRLGHNSISHITEGAFRGLSSLRTLELDHN 356          
BLAST of SMED30024248 vs. Ensembl Zebrafish
Match: lrig1 (leucine-rich repeats and immunoglobulin-like domains 1 [Source:ZFIN;Acc:ZDB-GENE-031113-23])

HSP 1 Score: 67.781 bits (164), Expect = 2.075e-11
Identity = 50/158 (31.65%), Postives = 78/158 (49.37%), Query Frame = 2
Query:  545 LNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L KL QL++   +L            S+E++ L+   +  +   AF    ++++L + +N +  ++  S  GL+ L  L L++N   +F   G GF E   L +L+LS+N +  LS   F  LV L  L L +N +  I   AF GL SL  L L HN
Sbjct:  177 LPKLTQLELSRNRLRLIEGLTFQGLSSLEVLKLQRNNISKLTDGAFWGLARMRVLHLDYNSLREVNSGSLYGLESLLQLYLANNSISNFNPEGWGFCE--RLRELNLSYNNLTKLSEGSFAKLVNLISLRLGHNSISHITEGAFRGLSSLRTLELDHN 332          

HSP 2 Score: 60.8474 bits (146), Expect = 2.950e-9
Identity = 53/191 (27.75%), Postives = 92/191 (48.17%), Query Frame = 2
Query:  455 LESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAAL---SMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
             + L+ L +   Q+N++S +    +    GL +++ L ++   L   +S  L   +S+  + L N  + N + E +  C +L+ L + +N ++++S  SF  L  L  L L  N   H T     FR + +L  L+L  N I+     +   F GL  L +L L  N ++ +   AF GL +L +LNL  N
Sbjct:  198 FQGLSSLEVLKLQRNNISKLT---DGAFWGLARMRVLHLDYNSLREVNSGSLYGLESLLQLYLANNSISNFNPEGWGFCERLRELNLSYNNLTKLSEGSFAKLVNLISLRLGHNSISHITEGA--FRGLSSLRTLELDHNDISGTIEDTSGAFTGLENLNKLTLFGNKIKSVAKKAFSGLEALEHLNLGEN 383          
BLAST of SMED30024248 vs. Ensembl Zebrafish
Match: lrig1 (leucine-rich repeats and immunoglobulin-like domains 1 [Source:ZFIN;Acc:ZDB-GENE-031113-23])

HSP 1 Score: 67.781 bits (164), Expect = 2.165e-11
Identity = 50/158 (31.65%), Postives = 78/158 (49.37%), Query Frame = 2
Query:  545 LNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L KL QL++   +L            S+E++ L+   +  +   AF    ++++L + +N +  ++  S  GL+ L  L L++N   +F   G GF E   L +L+LS+N +  LS   F  LV L  L L +N +  I   AF GL SL  L L HN
Sbjct:  201 LPKLTQLELSRNRLRLIEGLTFQGLSSLEVLKLQRNNISKLTDGAFWGLARMRVLHLDYNSLREVNSGSLYGLESLLQLYLANNSISNFNPEGWGFCE--RLRELNLSYNNLTKLSEGSFAKLVNLISLRLGHNSISHITEGAFRGLSSLRTLELDHN 356          

HSP 2 Score: 60.8474 bits (146), Expect = 3.022e-9
Identity = 53/191 (27.75%), Postives = 92/191 (48.17%), Query Frame = 2
Query:  455 LESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAAL---SMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
             + L+ L +   Q+N++S +    +    GL +++ L ++   L   +S  L   +S+  + L N  + N + E +  C +L+ L + +N ++++S  SF  L  L  L L  N   H T     FR + +L  L+L  N I+     +   F GL  L +L L  N ++ +   AF GL +L +LNL  N
Sbjct:  222 FQGLSSLEVLKLQRNNISKLT---DGAFWGLARMRVLHLDYNSLREVNSGSLYGLESLLQLYLANNSISNFNPEGWGFCERLRELNLSYNNLTKLSEGSFAKLVNLISLRLGHNSISHITEGA--FRGLSSLRTLELDHNDISGTIEDTSGAFTGLENLNKLTLFGNKIKSVAKKAFSGLEALEHLNLGEN 407          
BLAST of SMED30024248 vs. Ensembl Xenopus
Match: vasn (vasorin [Source:NCBI gene;Acc:448556])

HSP 1 Score: 63.1586 bits (152), Expect = 7.664e-10
Identity = 42/104 (40.38%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  707 LTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L +  N IS I   SF GL  L  L LS NQ       G  FR + NL  LDL+ N++  +S   F GL +L++L+LN N +  I   AF+G+ SL+ L L +N
Sbjct:   67 LYVFENGISSIEESSFIGLNGLHLLDLSHNQLSSLP--GGVFRNLANLSNLDLTSNQLTEISADTFQGLSRLERLYLNGNRIRSIHPEAFKGIESLLELKLSNN 168          
BLAST of SMED30024248 vs. Ensembl Xenopus
Match: vasn (vasorin [Source:NCBI gene;Acc:448556])

HSP 1 Score: 62.7734 bits (151), Expect = 8.420e-10
Identity = 42/104 (40.38%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  707 LTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L +  N IS I   SF GL  L  L LS NQ       G  FR + NL  LDL+ N++  +S   F GL +L++L+LN N +  I   AF+G+ SL+ L L +N
Sbjct:   55 LYVFENGISSIEESSFIGLNGLHLLDLSHNQLSSLP--GGVFRNLANLSNLDLTSNQLTEISADTFQGLSRLERLYLNGNRIRSIHPEAFKGIESLLELKLSNN 156          
BLAST of SMED30024248 vs. Ensembl Xenopus
Match: IGFALS (insulin like growth factor binding protein acid labile subunit [Source:NCBI gene;Acc:100489984])

HSP 1 Score: 62.003 bits (149), Expect = 1.460e-9
Identity = 63/219 (28.77%), Postives = 109/219 (49.77%), Query Frame = 2
Query:  305 QDLSLSEPINVNLNLINFTYQRKLTFFNYCKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFI 961
            +DL     +N+  N I    +R  TF    ++ +L ++ +++   +    L  LN  +I+    N L  +A   E+   GL KL  L +E+  L     +  +   S+  + L+N ++  I+  +F +   L  L +  N+++ ++  SF GLK L++L LSSNQ    T +   F  +  L  LDLS N++ AL+  +F+ L  L+ L L NN L+ I
Sbjct:  304 KDLQFLVELNLGQNKIKILLER--TFEGLAQLELLSLNHNNVQEIRPGSFLGLLNVAVIN-LSGNCLKSLA---EHCFKGLGKLHSLHMESSCLSHIKPQMFAGLSSIRRLFLQNNEIVAIENHSFTDLHGLLELDLRSNKLTHLTTRSFTGLKNLSYLLLSSNQI--LTISPEVFSPVQQLQWLDLSDNQLKALTEDIFLPLSSLRYLSLKNNCLKTI 514          

HSP 2 Score: 55.4546 bits (132), Expect = 1.873e-7
Identity = 52/190 (27.37%), Postives = 88/190 (46.32%), Query Frame = 2
Query:  449 KNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            +NL  L++L +  +Q  SL   AL       GL  L  L +E   + S +    +  Q++  + L N  L  I+   F     L  L + +N +  +  + F  L  L  L L+ N+  +   +   F  +G L +LDLS N +  +   +F    K  +L+LN+N +  +   AF G+ +L +L+L HN
Sbjct:   88 RNLSHLDFLNLQSSQVASLEQQALH------GLKALAHLHLERNMIKSLAPSTFTHTQNLVSLTLNNNFLTKIEDGLFSGLSNLWYLNLGWNLLVVLPDMVFHDLLNLRELVLAGNRLVYLQPSL--FLSLGELKELDLSGNSLKGIKANVFTRQQKTHKLYLNHNHISTVAPRAFSGMKNLRWLDLSHN 269          

HSP 3 Score: 50.0618 bits (118), Expect = 7.755e-6
Identity = 44/159 (27.67%), Postives = 81/159 (50.94%), Query Frame = 2
Query:  533 FLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            FLS L +LK+L +    L    +   +  Q    + L +  +  +   AF     L+ L +  N+++ +   +F GL  L  L LS+N     +     F+++  L++L+L  N+I  L  + F GL +L+ L LN+N+++ I   +F GL+++  +NL
Sbjct:  207 FLS-LGELKELDLSGNSLKGIKANVFTRQQKTHKLYLNHNHISTVAPRAFSGMKNLRWLDLSHNRLTALYEDTFFGLPSLNVLRLSNNSLT--SLRPRIFKDLQFLVELNLGQNKIKILLERTFEGLAQLELLSLNHNNVQEIRPGSFLGLLNVAVINL 362          
BLAST of SMED30024248 vs. Ensembl Xenopus
Match: rorc (RAR related orphan receptor C [Source:Xenbase;Acc:XB-GENE-481075])

HSP 1 Score: 62.003 bits (149), Expect = 2.075e-9
Identity = 41/128 (32.03%), Postives = 68/128 (53.12%), Query Frame = 2
Query:  596 SSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAF 976
            SS   S CQ ++ ++L +  L  +D  +  +   L +L + +N IS I+  +FKGLK L  L L  N+      + NG F  + +L KL L  N+I +++ + F G+  L+ L+L  N L  + + AF
Sbjct:  286 SSAGWSFCQKLQELVLSHNNLTRLDEGSLADLGVLDVLRLSYNSISHIAEGAFKGLKSLRILELDHNEISGTIEDTNGAFIGLESLNKLTLFGNKIKSVAKRAFSGIESLEHLNLGENALRSVHSEAF 413          
BLAST of SMED30024248 vs. Ensembl Xenopus
Match: rorc (RAR related orphan receptor C [Source:Xenbase;Acc:XB-GENE-481075])

HSP 1 Score: 62.003 bits (149), Expect = 2.118e-9
Identity = 41/128 (32.03%), Postives = 68/128 (53.12%), Query Frame = 2
Query:  596 SSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAF 976
            SS   S CQ ++ ++L +  L  +D  +  +   L +L + +N IS I+  +FKGLK L  L L  N+      + NG F  + +L KL L  N+I +++ + F G+  L+ L+L  N L  + + AF
Sbjct:  286 SSAGWSFCQKLQELVLSHNNLTRLDEGSLADLGVLDVLRLSYNSISHIAEGAFKGLKSLRILELDHNEISGTIEDTNGAFIGLESLNKLTLFGNKIKSVAKRAFSGIESLEHLNLGENALRSVHSEAF 413          
BLAST of SMED30024248 vs. Ensembl Mouse
Match: Lgr6 (leucine-rich repeat-containing G protein-coupled receptor 6 [Source:MGI Symbol;Acc:MGI:2441805])

HSP 1 Score: 67.3958 bits (163), Expect = 2.725e-11
Identity = 75/294 (25.51%), Postives = 124/294 (42.18%), Query Frame = 2
Query:  206 ARIPCPQKLCRCDENGQPWKCEIRRDQDQIDCSQDLSLSEPINVNLNLI--NFTYQRKLTFFNYCKVGILKISSDS---IPGKQMIKNLESLNYLIIDGTQKNSLSGVALDI---------------------ENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
             R  CP   C C E+G      +  D  ++  S   +  +P+   L+L   N T  +   F +   +  L++S +    IPG Q    L SL  L++   Q N L G+  +                      E    GL+ L+ L +++  L       L+   +++ + L    + +I   AF N   L +L +  N+I  +   SF+GL  L  L L+ N+ + F       R +G L +L    N I A+  K F+G   LQ +H  +N ++F+   AF+ L  L  L+L
Sbjct:   31 GRPACPAP-CHCQEDG----IMLSADCSELGLSVVPADLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPG-QAFSGLHSLKILML---QSNQLRGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNHIRHIPDYAFQNLTSLVVLHLHNNRIQHVGTHSFEGLHNLETLDLNYNELQEFPL---AIRTLGRLQELGFHNNNIKAIPEKAFMGSPLLQTIHFYDNPIQFVGRSAFQYLSKLHTLSL 312          

HSP 2 Score: 60.4622 bits (145), Expect = 4.568e-9
Identity = 50/161 (31.06%), Postives = 76/161 (47.20%), Query Frame = 2
Query:  545 LNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLD---LSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L  L++L++    L     +  S   S++I++L++ QL  I  EA      L+ L +  N IS +   SF+GL  L HL L  N            R + NL  L    L+ N I  +    F  L  L  LHL+NN ++ +   +FEGL +L  L+L +N
Sbjct:   89 LRFLEELRLSGNHLSHIPGQAFSGLHSLKILMLQSNQLRGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPV-----RALNNLPALQAMTLALNHIRHIPDYAFQNLTSLVVLHLHNNRIQHVGTHSFEGLHNLETLDLNYN 244          
BLAST of SMED30024248 vs. Ensembl Mouse
Match: Lrrtm3 (leucine rich repeat transmembrane neuronal 3 [Source:MGI Symbol;Acc:MGI:2389177])

HSP 1 Score: 65.855 bits (159), Expect = 6.100e-11
Identity = 45/121 (37.19%), Postives = 65/121 (53.72%), Query Frame = 2
Query:  656 LENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L+ + +  F    QL  L +  N IS I   +F G++ L  L LSSN+  +F  N   FR + NL  LDLS+N++ +L  + F GL KL  LHL +N L  I    F+   +L  L+L +N
Sbjct:   73 LQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNT--FRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYN 191          

HSP 2 Score: 60.8474 bits (146), Expect = 2.390e-9
Identity = 51/201 (25.37%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  530 NFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLN-------PIKANLIKIFISADSIQCV 1111
            N   GLN+L  L +++  + +      +  + ++ +IL + ++       F     L+ L + +NQ+  +    F+GL+ L  L L SN     T     F++  NL  LDL +NRI +L+  +F G+++L++LHL +N    ++   F  L+SL  L +  N   ++   +           +  N I+ F      QCV
Sbjct:   79 NQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLR--TIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYMQWNKISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCV 277          
BLAST of SMED30024248 vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 66.2402 bits (160), Expect = 6.379e-11
Identity = 63/198 (31.82%), Postives = 94/198 (47.47%), Query Frame = 2
Query:  401 GILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQL-----KIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGN-GFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAF 976
            GI K+   +  G   + N+E L        + N+L+GV    + +L GL  L+QL      IE I  D+W       CQ +  + L   QL  +D  AFV    L+ L +  N+++ I+   F+ L  L  L L +N       + +  F  + +L KL L  NRI +++ K FIGL  L+ L LNNN +  I   AF
Sbjct:  249 GISKLKDGAFFG---LNNMEELEL------EHNNLTGVN---KGWLYGLRMLQQLYMSQNAIEKISPDAWE-----FCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKSVTQKAFIGLESLEYLDLNNNAIMSIQENAF 429          
BLAST of SMED30024248 vs. Ensembl Mouse
Match: Lrrtm2 (leucine rich repeat transmembrane neuronal 2 [Source:MGI Symbol;Acc:MGI:2389174])

HSP 1 Score: 65.855 bits (159), Expect = 6.601e-11
Identity = 46/123 (37.40%), Postives = 69/123 (56.10%), Query Frame = 2
Query:  641 LKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            L++  +  ++ + F +  QL  L +  NQIS +   +F+GL  L  L LSSN+   F      F ++ NL  LDLSFN++++L  ++F GL KLQ LHL +N L  I    F    SL +L+L
Sbjct:   68 LRHNHITALERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNKI--FYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDL 188          

HSP 2 Score: 56.225 bits (134), Expect = 6.671e-8
Identity = 58/187 (31.02%), Postives = 94/187 (50.27%), Query Frame = 2
Query:  566 KIENIKLDSWSSEYLSVCQSVEIIILKN--LQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLC-LNPIKANLIKIFISADSIQCVEM 1117
            +I  +K D++   Y    +  E+I+  N    L N  F   +N   L+ L + FNQ+S +    F GL+ L  L L SN     T     F +  +L  LDLS NR+ +L+   F GL+KL++LHL +N L  I+   F  L SL  L L  N    + +L C ++   + L K+ ++ + I+ +++
Sbjct:   96 QISTVKEDAFQGLY----KLKELILSSNKIFYLPNTTFTQLIN---LQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLR--TIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNK---ISNLTCGMDWTWSTLEKLDLTGNEIKAIDL 270          

HSP 3 Score: 51.9878 bits (123), Expect = 1.556e-6
Identity = 44/159 (27.67%), Postives = 75/159 (47.17%), Query Frame = 2
Query:  542 GLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            GL KL+ L + +  L +        C+S+E + L   +L ++    F    +L+ L +  NQ+++I+   F  L  L  L L  N+  + T   +       L KLDL+ N I A+ + +F  +  L+ L ++NN L  +D+     L SL  + L  N
Sbjct:  155 GLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNKISNLTCGMDW--TWSTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLDSKILNSLKSLTTVGLSGN 311          
BLAST of SMED30024248 vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 66.2402 bits (160), Expect = 6.647e-11
Identity = 63/198 (31.82%), Postives = 94/198 (47.47%), Query Frame = 2
Query:  401 GILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQL-----KIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGN-GFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAF 976
            GI K+   +  G   + N+E L        + N+L+GV    + +L GL  L+QL      IE I  D+W       CQ +  + L   QL  +D  AFV    L+ L +  N+++ I+   F+ L  L  L L +N       + +  F  + +L KL L  NRI +++ K FIGL  L+ L LNNN +  I   AF
Sbjct:  249 GISKLKDGAFFG---LNNMEELEL------EHNNLTGVN---KGWLYGLRMLQQLYMSQNAIEKISPDAWE-----FCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKSVTQKAFIGLESLEYLDLNNNAIMSIQENAF 429          
BLAST of SMED30024248 vs. UniProt/SwissProt
Match: sp|Q3UVD5|LGR6_MOUSE (Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus OX=10090 GN=Lgr6 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.906e-10
Identity = 75/294 (25.51%), Postives = 124/294 (42.18%), Query Frame = 2
Query:  206 ARIPCPQKLCRCDENGQPWKCEIRRDQDQIDCSQDLSLSEPINVNLNLI--NFTYQRKLTFFNYCKVGILKISSDS---IPGKQMIKNLESLNYLIIDGTQKNSLSGVALDI---------------------ENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
             R  CP   C C E+G      +  D  ++  S   +  +P+   L+L   N T  +   F +   +  L++S +    IPG Q    L SL  L++   Q N L G+  +                      E    GL+ L+ L +++  L       L+   +++ + L    + +I   AF N   L +L +  N+I  +   SF+GL  L  L L+ N+ + F       R +G L +L    N I A+  K F+G   LQ +H  +N ++F+   AF+ L  L  L+L
Sbjct:   31 GRPACPAP-CHCQEDG----IMLSADCSELGLSVVPADLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPG-QAFSGLHSLKILML---QSNQLRGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNHIRHIPDYAFQNLTSLVVLHLHNNRIQHVGTHSFEGLHNLETLDLNYNELQEFPL---AIRTLGRLQELGFHNNNIKAIPEKAFMGSPLLQTIHFYDNPIQFVGRSAFQYLSKLHTLSL 312          

HSP 2 Score: 60.4622 bits (145), Expect = 3.195e-8
Identity = 50/161 (31.06%), Postives = 76/161 (47.20%), Query Frame = 2
Query:  545 LNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLD---LSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L  L++L++    L     +  S   S++I++L++ QL  I  EA      L+ L +  N IS +   SF+GL  L HL L  N            R + NL  L    L+ N I  +    F  L  L  LHL+NN ++ +   +FEGL +L  L+L +N
Sbjct:   89 LRFLEELRLSGNHLSHIPGQAFSGLHSLKILMLQSNQLRGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPV-----RALNNLPALQAMTLALNHIRHIPDYAFQNLTSLVVLHLHNNRIQHVGTHSFEGLHNLETLDLNYN 244          
BLAST of SMED30024248 vs. UniProt/SwissProt
Match: sp|O43300|LRRT2_HUMAN (Leucine-rich repeat transmembrane neuronal protein 2 OS=Homo sapiens OX=9606 GN=LRRTM2 PE=1 SV=3)

HSP 1 Score: 65.855 bits (159), Expect = 4.056e-10
Identity = 46/123 (37.40%), Postives = 69/123 (56.10%), Query Frame = 2
Query:  641 LKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            L++  +  ++ + F +  QL  L +  NQIS +   +F+GL  L  L LSSN+   F      F ++ NL  LDLSFN++++L  ++F GL KLQ LHL +N L  I    F    SL +L+L
Sbjct:   68 LRHNHITELERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNKI--FYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDL 188          

HSP 2 Score: 55.4546 bits (132), Expect = 7.478e-7
Identity = 58/187 (31.02%), Postives = 92/187 (49.20%), Query Frame = 2
Query:  566 KIENIKLDSWSSEYLSVCQSVEIIILKN--LQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLC-LNPIKANLIKIFISADSIQCVEM 1117
            +I  +K D++   Y    +  E+I+  N    L N  F   +N   L+ L + FNQ+S +    F GL+ L  L L SN     T     F +  +L  LDLS NR+ +L+   F GL+KL++LHL +N L  I+   F  L SL  L L  N    + +L C +      L K+ ++ + I+ +++
Sbjct:   96 QISTVKEDAFQGLY----KLKELILSSNKIFYLPNTTFTQLIN---LQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLR--TIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNK---ISNLTCGMEWTWGTLEKLDLTGNEIKAIDL 270          

HSP 3 Score: 53.9138 bits (128), Expect = 2.507e-6
Identity = 45/159 (28.30%), Postives = 75/159 (47.17%), Query Frame = 2
Query:  542 GLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            GL KL+ L + +  L +        C+S+E + L   +L ++    F    +L+ L +  NQ+++I+   F  L  L  L L  N+  + T         G L KLDL+ N I A+ + +F  +  L+ L ++NN L  +D+     L SL  + L  N
Sbjct:  155 GLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNKISNLTCGMEW--TWGTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLDSKILNSLRSLTTVGLSGN 311          
BLAST of SMED30024248 vs. UniProt/SwissProt
Match: sp|D3ZAL8|LRRT3_RAT (Leucine-rich repeat transmembrane neuronal protein 3 OS=Rattus norvegicus OX=10116 GN=Lrrtm3 PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.085e-10
Identity = 45/121 (37.19%), Postives = 65/121 (53.72%), Query Frame = 2
Query:  656 LENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L+ + +  F    QL  L +  N IS I   +F G++ L  L LSSN+  +F  N   FR + NL  LDLS+N++ +L  + F GL KL  LHL +N L  I    F+   +L  L+L +N
Sbjct:   73 LQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNT--FRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYN 191          

HSP 2 Score: 61.2326 bits (147), Expect = 1.532e-8
Identity = 51/201 (25.37%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  530 NFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLN-------PIKANLIKIFISADSIQCV 1111
            N   GLN+L  L +++  + +      +  + ++ +IL + ++       F     L+ L + +NQ+  +    F+GL+ L  L L SN     T     F++  NL  LDL +NRI +L+  +F G+++L++LHL +N    ++   F  L+SL  L +  N   ++   +           +  N I+ F      QCV
Sbjct:   79 NQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLR--TIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYMQWNKISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCV 277          
BLAST of SMED30024248 vs. UniProt/SwissProt
Match: sp|Q8BZ81|LRRT3_MOUSE (Leucine-rich repeat transmembrane neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrtm3 PE=2 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 4.267e-10
Identity = 45/121 (37.19%), Postives = 65/121 (53.72%), Query Frame = 2
Query:  656 LENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L+ + +  F    QL  L +  N IS I   +F G++ L  L LSSN+  +F  N   FR + NL  LDLS+N++ +L  + F GL KL  LHL +N L  I    F+   +L  L+L +N
Sbjct:   73 LQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNT--FRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYN 191          

HSP 2 Score: 60.8474 bits (146), Expect = 1.672e-8
Identity = 51/201 (25.37%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  530 NFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLN-------PIKANLIKIFISADSIQCV 1111
            N   GLN+L  L +++  + +      +  + ++ +IL + ++       F     L+ L + +NQ+  +    F+GL+ L  L L SN     T     F++  NL  LDL +NRI +L+  +F G+++L++LHL +N    ++   F  L+SL  L +  N   ++   +           +  N I+ F      QCV
Sbjct:   79 NQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLR--TIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYMQWNKISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCV 277          
BLAST of SMED30024248 vs. UniProt/SwissProt
Match: sp|Q52KR2|LRIG2_MOUSE (Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.462e-10
Identity = 63/198 (31.82%), Postives = 94/198 (47.47%), Query Frame = 2
Query:  401 GILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQL-----KIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGN-GFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAF 976
            GI K+   +  G   + N+E L        + N+L+GV    + +L GL  L+QL      IE I  D+W       CQ +  + L   QL  +D  AFV    L+ L +  N+++ I+   F+ L  L  L L +N       + +  F  + +L KL L  NRI +++ K FIGL  L+ L LNNN +  I   AF
Sbjct:  249 GISKLKDGAFFG---LNNMEELEL------EHNNLTGVN---KGWLYGLRMLQQLYMSQNAIEKISPDAWE-----FCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKSVTQKAFIGLESLEYLDLNNNAIMSIQENAF 429          
BLAST of SMED30024248 vs. TrEMBL
Match: A0A0D2WM22 (Uncharacterized protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_002281 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.540e-13
Identity = 69/233 (29.61%), Postives = 109/233 (46.78%), Query Frame = 2
Query:  329 INVNLNLINFTYQRKLTFFNYCKVGILKISSD---SIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            +++NL     T      F +  K+  L ++++   S+P +     L +L  L +D  Q  S+S +A       + L  L  L + N ++   S    +   ++  + L + Q+ +I   AF +   L  L++  NQI+ IS  +F GL  L  LSL+ NQ    +   N F  +  L  LDL+ N+I  +S   F GL  L  L L+NN +  I   AF GL  L YL L +N
Sbjct:  158 VSLNLEFTQITTISAAAFTSLAKLKNLYLNNNQITSVP-ESAFTGLTALVSLELDNNQITSISALAF------ANLTALSYLGLANNRITGISENTFTGLTALAALYLLDNQITSISANAFTDLTALTTLSLALNQITSISANAFTGLTTLAGLSLALNQITGIS--ANAFTGLTTLAGLDLALNQITGISTNAFTGLTTLAVLRLDNNQIASISANAFTGLTMLFYLTLHNN 381          

HSP 2 Score: 67.781 bits (164), Expect = 3.704e-8
Identity = 44/126 (34.92%), Postives = 65/126 (51.59%), Query Frame = 2
Query:  641 LKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L++ Q+  I  +AF     L  L +  N I+ IS  +F  L  L++L LS  Q    +   N F  +  L+ L+L F +I  +S   F  L KL+ L+LNNN +  +   AF GL +LV L L +N
Sbjct:   90 LQSNQITAISPDAFAGLTSLNSLYLSDNPITSISANAFSDLTELSYLHLSYTQLTDIS--ANAFTTLPALVSLNLEFTQITTISAAAFTSLAKLKNLYLNNNQITSVPESAFTGLTALVSLELDNN 213          

HSP 3 Score: 67.3958 bits (163), Expect = 5.108e-8
Identity = 59/191 (30.89%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  449 KNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNP 1021
             NL +L+YL   G   N ++G++   EN  +GL  L  L + + ++ S S+   +   ++  + L   Q+ +I   AF     L  L++  NQI+ IS  +F GL  L  L L+ NQ    +TN   F  +  L  L L  N+IA++S   F GL  L  L L+NN    +    F+GL + + L++  +P
Sbjct:  224 ANLTALSYL---GLANNRITGIS---ENTFTGLTALAALYLLDNQITSISANAFTDLTALTTLSLALNQITSISANAFTGLTTLAGLSLALNQITGISANAFTGLTTLAGLDLALNQITGISTNA--FTGLTTLAVLRLDNNQIASISANAFTGLTMLFYLTLHNNSFTTLPPGLFKGLRNGLCLSMETSP 406          
BLAST of SMED30024248 vs. TrEMBL
Match: A0A0D2X5D9 (TKL protein kinase OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_009123 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.310e-13
Identity = 61/188 (32.45%), Postives = 91/188 (48.40%), Query Frame = 2
Query:  455 LESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L  L+ L +   Q  SL        N  SGL  + QL + N  L +  S   +   +++ ++L N Q+ ++   AF     L +L +  NQI+ I   +F GL  L  L L+SN+    T   N F  +  L  LD+S N+I +L    F GL  + QLHL NN    + + AF GL +L  L+L +N
Sbjct:  586 LTHLSLLELSNNQITSLPA------NAFSGLTAMTQLSLYNNSLSAVPSSAFTGLTALQALLLYNNQITSVAANAFTGLTALVLLHLYRNQITTIPASAFAGLSALVQLYLNSNRIT--TIFANAFPSLTKLTYLDISNNQITSLPANAFTGLTAMTQLHLYNNLFSTVPSSAFTGLTALQILSLFNN 765          

HSP 2 Score: 82.0333 bits (201), Expect = 1.956e-12
Identity = 60/188 (31.91%), Postives = 91/188 (48.40%), Query Frame = 2
Query:  455 LESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L +L  L +   Q  S+S       N  SGL+KL  L++ N  L +  S   +   ++  ++L N Q+  +   AF     L+ L +  NQI+ ++I +F GL  L  L L +NQ    T   N F  +  L  L L  N ++A+    F GL  L QL L+ N +  +   AF GL +L+YL L +N
Sbjct:  202 LTALVQLYLYNNQITSISA------NAFSGLSKLNTLQLNNNWLSAIPSSAFTGLTALTQLLLYNNQITTVPSSAFTGLTALQFLYLYNNQIATVAINAFSGLTALVQLRLDTNQIT--TVPANAFSGLSKLNTLHLYNNWLSAIPSSAFTGLTALTQLRLDTNQITTVPANAFSGLTALIYLYLYNN 381          

HSP 3 Score: 78.1814 bits (191), Expect = 3.127e-11
Identity = 61/205 (29.76%), Postives = 99/205 (48.29%), Query Frame = 2
Query:  404 ILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            I  I+S +  G  ++  L+  N         N ++ V     N  SGL+KL  L + N  L +  S   +   ++  ++L N Q+  +   AF     L++L +  NQI+ ++I +F GL  L  L L +NQ    + + N F  +  L  L L+ N ++A+    F GL  L QL L NN +  + + AF GL +L +L L +N
Sbjct:   95 ITNIASSAFSGLSVLNTLDLTN---------NQITTVP---ANAFSGLSKLNTLYLYNNWLSAIPSSAFTGLTALTQLLLHNNQITTVPSSAFTGLTALQLLYLYNNQIATVAIDAFSGLTALVQLYLYNNQIT--SISANAFSGLSKLNTLQLNNNWLSAIPSSAFTGLTALTQLLLYNNQITTVPSSAFTGLTALQFLYLYNN 285          

HSP 4 Score: 75.0998 bits (183), Expect = 2.591e-10
Identity = 60/188 (31.91%), Postives = 91/188 (48.40%), Query Frame = 2
Query:  452 NLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSF--NRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            +L  L YL I   Q  SL        N  +GL  + QL + N    +  S   +   +++I+ L N Q+ ++   AF +   L  L +  NQI+ I   +F GL  L+ L L++N      T  + F  +  L +L LS   N+I  +S   F GL  LQ L+LN+N +  I   AF GL +L +L+L
Sbjct:  705 SLTKLTYLDISNNQITSLPA------NAFTGLTAMTQLHLYNNLFSTVPSSAFTGLTALQILSLFNNQISSVAANAFTSLTALVQLQLYGNQITTIPASAFSGLSKLSLLQLNNNWLSAIPT--SAFTGLTALTQLQLSLYGNQITTISASAFAGLTALQALYLNDNTITTIAANAFAGLTALNWLDL 884          

HSP 5 Score: 75.0998 bits (183), Expect = 3.054e-10
Identity = 61/174 (35.06%), Postives = 82/174 (47.13%), Query Frame = 2
Query:  497 NSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            N ++ VA+D     SGL  L QL + N ++ S S+   S    +  + L N  L  I   AF     L  L +  NQI+ +   +F GL  L  L L +NQ    T   N F  +  L++L L  N+I  +    F GL KL  LHL NN L  I + AF GL +L  L L  N
Sbjct:  189 NQIATVAIDA---FSGLTALVQLYLYNNQITSISANAFSGLSKLNTLQLNNNWLSAIPSSAFTGLTALTQLLLYNNQITTVPSSAFTGLTALQFLYLYNNQIA--TVAINAFSGLTALVQLRLDTNQITTVPANAFSGLSKLNTLHLYNNWLSAIPSSAFTGLTALTQLRLDTN 357          

HSP 6 Score: 68.9366 bits (167), Expect = 2.637e-8
Identity = 61/188 (32.45%), Postives = 86/188 (45.74%), Query Frame = 2
Query:  455 LESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L  L YL +   Q  S+   A       SGL  L QL + N  L +  S   +   ++  + L N Q+  +   AF     L  L +  NQI+ IS  +F G+  L  L L SN+      N   F  + +L  L+LS N+I +L    F GL  + QL L NN L  + + AF GL +L  L L +N
Sbjct:  466 LTKLTYLDLSLNQLTSIPAGAF------SGLTALTQLLLYNNWLSAVPSSAFTGLTALLYLYLYNNQITTVAANAFTGLTALVQLQLYGNQITTISASAFAGMSSLVQLYLYSNRITAIFVNA--FTGLTHLSLLELSNNQITSLPANAFSGLTAMTQLSLYNNSLSAVPSSAFTGLTALQALLLYNN 645          

HSP 7 Score: 67.0106 bits (162), Expect = 9.859e-8
Identity = 51/165 (30.91%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  524 IENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            + N  +GL KL  L +   +L S  +   S   ++  ++L N  L  +   AF     L  L +  NQI+ ++  +F GL  L  L L  NQ    T + + F  + +L++L L  NRI A+ +  F GL  L  L L+NN +  +   AF GL ++  L+L +N
Sbjct:  459 LANAFTGLTKLTYLDLSLNQLTSIPAGAFSGLTALTQLLLYNNWLSAVPSSAFTGLTALLYLYLYNNQITTVAANAFTGLTALVQLQLYGNQIT--TISASAFAGMSSLVQLYLYSNRITAIFVNAFTGLTHLSLLELSNNQITSLPANAFSGLTAMTQLSLYNN 621          

HSP 8 Score: 62.3882 bits (150), Expect = 2.927e-6
Identity = 47/158 (29.75%), Postives = 73/158 (46.20%), Query Frame = 2
Query:  536 LSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
             +GL+ L QL + + ++ +  +        +  + + N Q+ ++   AF     +  L +  N  S +   +F GL  L  LSL +NQ    +   N F  +  L++L L  N+I  +    F GL KL  L LNNN L  I   AF GL +L  L L
Sbjct:  679 FAGLSALVQLYLNSNRITTIFANAFPSLTKLTYLDISNNQITSLPANAFTGLTAMTQLHLYNNLFSTVPSSAFTGLTALQILSLFNNQIS--SVAANAFTSLTALVQLQLYGNQITTIPASAFSGLSKLSLLQLNNNWLSAIPTSAFTGLTALTQLQL 834          

HSP 9 Score: 61.2326 bits (147), Expect = 6.622e-6
Identity = 50/161 (31.06%), Postives = 75/161 (46.58%), Query Frame = 2
Query:  536 LSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
             +GL  L+ L + N ++ + +    S   ++  + L   Q+  +   AF    +L  L +  N +S I   +F GL  LT L L +NQ    T   N F  +  LI L L  N+I  +    F GL  L QL+L NN +  I + A  GL +L  L L +N
Sbjct:  271 FTGLTALQFLYLYNNQIATVAINAFSGLTALVQLRLDTNQITTVPANAFSGLSKLNTLHLYNNWLSAIPSSAFTGLTALTQLRLDTNQIT--TVPANAFSGLTALIYLYLYNNQITTVPANAFSGLTALVQLYLYNNQITTIPSSALTGLSALTQLYLYNN 429          

HSP 10 Score: 60.8474 bits (146), Expect = 8.569e-6
Identity = 45/132 (34.09%), Postives = 68/132 (51.52%), Query Frame = 2
Query:  623 SVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            +  I+ L+N Q+ +I   AF +   L  L++  N I+ I+  +F GL  L  L L++NQ    T   N F  +  L  L L  N ++A+    F GL  L QL L+NN +  + + AF GL +L  L L +N
Sbjct:   60 TTTILYLQNNQITSISANAFSSLTLLTYLSLSSNPITNIASSAFSGLSVLNTLDLTNNQIT--TVPANAFSGLSKLNTLYLYNNWLSAIPSSAFTGLTALTQLLLHNNQITTVPSSAFTGLTALQLLYLYNN 189          

HSP 11 Score: 60.4622 bits (145), Expect = 9.831e-6
Identity = 54/183 (29.51%), Postives = 81/183 (44.26%), Query Frame = 2
Query:  536 LSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNG----------------------NGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
             +GL  L QL+++  ++ +  +   S   ++  + L N Q+  +   AF     L  L +  NQI+ I   +  GL  LT L L +NQ      NG                      N F  +  L  LDLS N++ ++    F GL  L QL L NN L  + + AF GL +L+YL L +N
Sbjct:  343 FTGLTALTQLRLDTNQITTVPANAFSGLTALIYLYLYNNQITTVPANAFSGLTALVQLYLYNNQITTIPSSALTGLSALTQLYLYNNQITSVPANGFSGLTALTDLRLFNNTITSILANAFTGLTKLTYLDLSLNQLTSIPAGAFSGLTALTQLLLYNNWLSAVPSSAFTGLTALLYLYLYNN 525          
BLAST of SMED30024248 vs. TrEMBL
Match: A0A0D2U6J4 (LRRNT domain-containing protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_002031 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 4.461e-13
Identity = 68/224 (30.36%), Postives = 104/224 (46.43%), Query Frame = 2
Query:  356 FTYQRKLT--FFNYCKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNP 1021
            FT    LT  FF Y +  I  I +D+  G      L SL YL +   Q  S+SG A       +GL  L  L +   ++ S  ++  +   ++  + L+N Q+ +I   AF     L  L    NQI+ I   +F G+  LT+LSL  N+      + N F  +  L  L L  N+I ++ +  F GL  L  L+L+ N +  I + +F  L +L  L L +NP
Sbjct:  126 FTGLTALTALFFAYNQ--ITSIPADTFTG------LTSLTYLSLQNNQVTSISGTAF------TGLTALTSLSLGPNQITSIPADTFTGLTALTTLSLQNNQITSISGTAFTGLTALTCLYFGSNQITSIPAGAFTGMTSLTYLSLYLNKITSI--SANAFAGLTALTYLSLFNNKITSIPVGAFTGLTGLTDLYLDGNQITSIPSSSFTNLTALTALALQNNP 333          

HSP 2 Score: 70.8626 bits (172), Expect = 3.700e-9
Identity = 46/149 (30.87%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  557 KQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYL 1003
             QL ++   + S S+   +   ++  + L+  Q+  I    F     L  L   +NQI+ I   +F GL  LT+LSL +NQ      +G  F  +  L  L L  N+I ++    F GL  L  L L NN +  I   AF GL +L  L
Sbjct:   85 TQLTLDLNSITSISANAFTGLTALTYLSLQYNQITGIPAGTFTGLTALTALFFAYNQITSIPADTFTGLTSLTYLSLQNNQVTSI--SGTAFTGLTALTSLSLGPNQITSIPADTFTGLTALTTLSLQNNQITSISGTAFTGLTALTCL 231          
BLAST of SMED30024248 vs. TrEMBL
Match: A0A0D2VQM3 (TKL protein kinase OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_003855 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 7.255e-13
Identity = 57/163 (34.97%), Postives = 84/163 (51.53%), Query Frame = 2
Query:  536 LSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPK 1024
             +GLN L +L + N ++ S S+   +   S++++ L N Q+ +I   AF     L  L++  NQI+ IS  +F GL  LT LSL SN      +  + F  +  L  L+L  N+I  +S   F GL  L+ L+LNNN +      AF GL +L  L L  NP 
Sbjct:   80 FTGLNALIRLDLSNNQITSISANAFTGAISLQVLYLYNNQIPSISASAFTGLTNLTQLSLQNNQITSISSSAFTGLTALTDLSLGSNWLSAIPS--SAFTGLTALTHLNLYNNQITTISANAFSGLAALRFLYLNNNQITTFSASAFAGLTALSRLALNANPA 240          

HSP 2 Score: 69.3218 bits (168), Expect = 1.873e-8
Identity = 52/160 (32.50%), Postives = 81/160 (50.62%), Query Frame = 2
Query:  530 NFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            N  +G   L+ L + N ++ S S+   +   ++  + L+N Q+ +I   AF     L  L++  N +S I   +F GL  LTHL+L +NQ    T + N F  +  L  L L+ N+I   S   F GL  L +L LN N    +    F+GL +L+YL+L
Sbjct:  102 NAFTGAISLQVLYLYNNQIPSISASAFTGLTNLTQLSLQNNQITSISSSAFTGLTALTDLSLGSNWLSAIPSSAFTGLTALTHLNLYNNQIT--TISANAFSGLAALRFLYLNNNQITTFSASAFAGLTALSRLALNANPATTLPPGLFKGLPNLMYLSL 259          

HSP 3 Score: 61.2326 bits (147), Expect = 5.421e-6
Identity = 51/153 (33.33%), Postives = 72/153 (47.06%), Query Frame = 2
Query:  599 SEYLSVCQSVEI-------------IILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            SE L  CQS  +             + L + Q+ +I   AF     L  L +  NQI+ IS  +F G   L  L L +NQ    +   + F  + NL +L L  N+I ++S   F GL  L  L L +N L  I + AF GL +L +LNL +N
Sbjct:   40 SETLVSCQSKALTSIPTDIPVTTVSLFLYDNQITSIFSSAFTGLNALIRLDLSNNQITSISANAFTGAISLQVLYLYNNQIPSIS--ASAFTGLTNLTQLSLQNNQITSISSSAFTGLTALTDLSLGSNWLSAIPSSAFTGLTALTHLNLYNN 190          
BLAST of SMED30024248 vs. TrEMBL
Match: A0A0D2VM23 (Uncharacterized protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_002334 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 8.736e-13
Identity = 55/158 (34.81%), Postives = 83/158 (52.53%), Query Frame = 2
Query:  545 LNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L KL QL ++N  + S S+   +   ++  + L   Q+ +I   AF +   L+ L +  N+I+ IS  +F GL  L +L LS NQ    +   N F ++ +L  L L FN++++L+   F GL  L QL L NN +  I   AF GL +L  L  LHN
Sbjct:    9 LTKLTQLSLDNTPITSISANAFAGLSALTQMFLYQTQITSISASAFADLRSLQKLYLYGNRITSISANAFTGLTKLAYLDLSYNQITSIS--ANAFADLSSLTDLRLYFNQMSSLAANTFTGLSALTQLSLLNNQITAISANAFTGLNALKLL-YLHN 163          
BLAST of SMED30024248 vs. Ensembl Cavefish
Match: lrig2 (leucine rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:103036991])

HSP 1 Score: 71.633 bits (174), Expect = 1.064e-12
Identity = 58/196 (29.59%), Postives = 99/196 (50.51%), Query Frame = 2
Query:  443 MIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAAL---SMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            + K LE+L  L +   Q+N   G+   ++  L GL+ +++L++E+  L   +  +L     + ++ +    +  I  +A+  C +L+ L + FN +SR+   +F GL  L  L++  N+  H    G G F  + N+  LD+  N I+     S+ MF+G+ KL  L L  N +  I   AFEGL  L  L+L  N
Sbjct:  193 IFKELEALKSLKM---QRN---GITKLMDGALFGLDNMEELELEHNNLTELNKGWLYGLHMLRVLRVSQNNIGLIRADAWEFCHRLEELDLSFNHLSRLEDWAFTGLGLLQTLNVGENRLTHL---GEGVFSGLANVHTLDIRNNDISLAIEDSVGMFVGMKKLNTLILQKNKIRTITKRAFEGLGELEQLDLSKN 379          
BLAST of SMED30024248 vs. Ensembl Cavefish
Match: lrig3 (leucine rich repeats and immunoglobulin like domains 3 [Source:NCBI gene;Acc:103037077])

HSP 1 Score: 70.0922 bits (170), Expect = 3.303e-12
Identity = 68/216 (31.48%), Postives = 107/216 (49.54%), Query Frame = 2
Query:  374 LTFFNYCKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQL-----KIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYL 1003
            LTF    ++  LK+  + I  + M      L+ + I   + N+L+ V+   + +L GL  L+QL      I  IK D+W       CQ +  + L + QL  ++  +F+    L+ L+I  N++S I+  +F+GL  L  L L  N+      + NG F  + NL KL L  NRI +++ K F GL  L+QL L+NN +  I   AF  +  L  L
Sbjct:  218 LTFHGLHRLRSLKMQRNGIT-RLMDGAFWGLSNMEILQLEYNNLTEVS---KGWLYGLLTLQQLHLAHNAISRIKPDAWE-----FCQKLAELDLNSNQLARLEEGSFMGLSVLEQLSIGHNRVSFIADGAFRGLSLLNTLDLKYNEISWTIEDMNGPFSALNNLRKLFLQGNRIRSVTKKSFTGLDLLEQLDLSNNAIMSIQGNAFSQMKKLEEL 424          

HSP 2 Score: 59.3066 bits (142), Expect = 8.877e-9
Identity = 49/152 (32.24%), Postives = 78/152 (51.32%), Query Frame = 2
Query:  677 AFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLN-PIKA--NLIKIFISADSIQCVEMKS 1123
            AF     ++IL + +N ++ +S     GL  L  L L+ N       +   F +   L +LDL+ N++A L    F+GL  L+QL + +N + FI + AF GL  L  L+L +N   I + +  +N P  A  NL K+F+  + I+ V  KS
Sbjct:  243 AFWGLSNMEILQLEYNNLTEVSKGWLYGLLTLQQLHLAHNAISRIKPDAWEFCQ--KLAELDLNSNQLARLEEGSFMGLSVLEQLSIGHNRVSFIADGAFRGLSLLNTLDLKYNE--ISWTIEDMNGPFSALNNLRKLFLQGNRIRSVTKKS 390          
BLAST of SMED30024248 vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 68.1662 bits (165), Expect = 1.594e-11
Identity = 53/174 (30.46%), Postives = 90/174 (51.72%), Query Frame = 2
Query:  695 QLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL-------LHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSN----DCQ 1183
            Q++ + + FN ++RI+  SF G++ L  L +  N   H   NG  FR++ +L  + +S+N++  +S   F GL  L +LHL++N LEFI   AF+GL SL  L L       LH        +L   P+ + L  +++S + +  +  K  L+  P  ++ +F   N    DC+
Sbjct:   50 QVERMNLGFNTMNRITDSSFAGMRKLELLMMHGNDI-HNIPNG-AFRDLISLQMMKVSYNKLKIISRNTFQGLWNLARLHLDHNRLEFIHPDAFQGLTSLRLLQLEGNRLQQLHPATFATLSVLGHFPV-STLKHLYLSENGLTSLSQK-MLAGMPH-LENLFLHENPWVCDCR 218          
BLAST of SMED30024248 vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 68.1662 bits (165), Expect = 1.598e-11
Identity = 53/174 (30.46%), Postives = 90/174 (51.72%), Query Frame = 2
Query:  695 QLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL-------LHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSN----DCQ 1183
            Q++ + + FN ++RI+  SF G++ L  L +  N   H   NG  FR++ +L  + +S+N++  +S   F GL  L +LHL++N LEFI   AF+GL SL  L L       LH        +L   P+ + L  +++S + +  +  K  L+  P  ++ +F   N    DC+
Sbjct:   58 QVERMNLGFNTMNRITDSSFAGMRKLELLMMHGNDI-HNIPNG-AFRDLISLQMMKVSYNKLKIISRNTFQGLWNLARLHLDHNRLEFIHPDAFQGLTSLRLLQLEGNRLQQLHPATFATLSVLGHFPV-STLKHLYLSENGLTSLSQK-MLAGMPH-LENLFLHENPWVCDCR 226          
BLAST of SMED30024248 vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 68.1662 bits (165), Expect = 1.610e-11
Identity = 53/174 (30.46%), Postives = 90/174 (51.72%), Query Frame = 2
Query:  695 QLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL-------LHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSN----DCQ 1183
            Q++ + + FN ++RI+  SF G++ L  L +  N   H   NG  FR++ +L  + +S+N++  +S   F GL  L +LHL++N LEFI   AF+GL SL  L L       LH        +L   P+ + L  +++S + +  +  K  L+  P  ++ +F   N    DC+
Sbjct:   58 QVERMNLGFNTMNRITDSSFAGMRKLELLMMHGNDI-HNIPNG-AFRDLISLQMMKVSYNKLKIISRNTFQGLWNLARLHLDHNRLEFIHPDAFQGLTSLRLLQLEGNRLQQLHPATFATLSVLGHFPV-STLKHLYLSENGLTSLSQK-MLAGMPH-LENLFLHENPWVCDCR 226          
BLAST of SMED30024248 vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 77.0258 bits (188), Expect = 2.906e-15
Identity = 68/218 (31.19%), Postives = 109/218 (50.00%), Query Frame = 2
Query:  374 LTFFNYCKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLK-----IENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            L+FF    +  L++  ++I G+ M      L  L I     N+L+ V    + +L GL+ L+QL      +  I LD+W       CQ ++ + L +  L  I+   FV    L+ L +  N +S I+  +FK L+ L  L L+ N+      + +G F  + NL KL LS N+I +++ K FIGL +L  L L+NN L  I + +F  L +L  + L
Sbjct:  106 LSFFGLESLQSLRLQRNNI-GRLMDGAFWRLEKLEILHLDFNALTNVT---KGWLYGLSSLQQLNMSHNNVSRIDLDAWE-----FCQKLDELDLSHNHLSRIEEGTFVGLGMLRSLLLAHNHLSNIADGAFKELRSLLTLDLAGNEISWTIEDMHGAFTGLENLNKLVLSENKIKSIAKKAFIGLERLHSLDLSNNALMSIQDGSFSSLKALTEMRL 314          
BLAST of SMED30024248 vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 72.7886 bits (177), Expect = 5.831e-14
Identity = 60/187 (32.09%), Postives = 89/187 (47.59%), Query Frame = 2
Query:  491 QKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLC 1048
            Q N L+ V+     +L GL  L+ L +    + +  SE    C+++  + L +  L  ++  AFV    L+ L++  N IS I   +F+GL  L  L L  NQ      +  G F  +  L KL L  N+I +++ K F+GL +L QL L  N +  I   AF        L LLH  KL   +LLC
Sbjct:   99 QHNRLTEVS---TGWLYGLQSLRHLHVSRNAITAMDSEAWKFCENLWELDLSHNGLTRLNEAAFVELGALQSLSLAHNAISHIVEGAFRGLSSLRILDLGGNQISWTVEDMQGAFTGLSALSKLSLHGNQIKSIAKKAFVGLERLGQLDLMGNAIVSIQANAFN------TLKLLHQMKLNTSELLC 276          
BLAST of SMED30024248 vs. Ensembl Sea Lamprey
Match: LRRTM4 (leucine rich repeat transmembrane neuronal 4 [Source:HGNC Symbol;Acc:HGNC:19411])

HSP 1 Score: 66.2402 bits (160), Expect = 7.541e-12
Identity = 49/145 (33.79%), Postives = 72/145 (49.66%), Query Frame = 2
Query:  656 LENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNN--------------DLEFID----------NMAFEGLISLVYLNLLHN 1018
            L+ +++  F +  QL  L +  N +  +   +F+G++ L  L LSSN+  +   NG  FR I NL  LDLS+N++  L   +F GL KLQ LHL +N              +LEF+D            AF GL  L  L++ HN
Sbjct:   76 LQELNYNQFASFRQLTWLYLDHNYVHTVDAHAFQGIRRLKELILSSNRISNLA-NGT-FRPISNLRNLDLSYNQLQILDPDLFRGLRKLQSLHLRSNTIKTMPVRIFQDCRNLEFLDLGYNRLRSLARNAFAGLTRLTELHMEHN 218          

HSP 2 Score: 56.6102 bits (135), Expect = 7.435e-9
Identity = 53/211 (25.12%), Postives = 101/211 (47.87%), Query Frame = 2
Query:  392 CKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENF--LSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            CK  +  +  +S+  K + +N+ +       GT   SL   +L   N+   +   +L  L +++  + +  +      + ++ +IL + ++ N+    F     L+ L + +NQ+  +    F+GL+ L  L L SN  +  T     F++  NL  LDL +NR+ +L+   F GL +L +LH+ +N    ++   F  L+SL +L L  N
Sbjct:   41 CKCDVKIVYCESLGLKGLPRNISA-------GTLGLSLRYNSLQELNYNQFASFRQLTWLYLDHNYVHTVDAHAFQGIRRLKELILSSNRISNLANGTFRPISNLRNLDLSYNQLQILDPDLFRGLRKLQSLHLRSNTIK--TMPVRIFQDCRNLEFLDLGYNRLRSLARNAFAGLTRLTELHMEHNQFSKVNFAHFPRLMSLRHLYLQGN 242          
BLAST of SMED30024248 vs. Ensembl Sea Lamprey
Match: LRRTM4 (leucine rich repeat transmembrane neuronal 4 [Source:HGNC Symbol;Acc:HGNC:19411])

HSP 1 Score: 65.0846 bits (157), Expect = 1.927e-11
Identity = 53/168 (31.55%), Postives = 86/168 (51.19%), Query Frame = 2
Query:  527 ENFLSGLNKLKQLKIEN--IKLDSWSSEYLSVCQSVEIIILKN--LQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            EN  SGL +L  L +++  I+L +    ++   +  E+ +  N  ++L N  F   VN   ++ L I FNQ+  +    F+GL+ L +L + SNQ    T     F++  ++  LDL +NR+  L+   F GL +L +LHL +N    ++   F  LISL  L L  N
Sbjct:   76 ENHFSGLKQLTWLYLDHNHIQLVA-EGAFVGARRLKELTLSSNKLIRLPNATFHPLVN---MRSLDISFNQLQMLEAGQFRGLRKLQYLHMRSNQLR--TVPVRIFQDCRSIELLDLGYNRLRVLARNAFTGLGRLTELHLEHNQFAKLNLAHFPRLISLRTLYLQWN 237          

HSP 2 Score: 53.5286 bits (127), Expect = 8.899e-8
Identity = 48/190 (25.26%), Postives = 87/190 (45.79%), Query Frame = 2
Query:  620 QSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSNDCQSP 1189
            + ++ + +++ QL  +    F +C  +++L + +N++  ++  +F GL  LT L L  NQ      N   F  + +L  L L +NRI+ L   M      LQ L L+ N+++ I    F+GL  L  L L  N +L       ++     L  + ++ +S QC +    ++ +  S Q        C SP
Sbjct:  155 RKLQYLHMRSNQLRTVPVRIFQDCRSIELLDLGYNRLRVLARNAFTGLGRLTELHLEHNQFAKL--NLAHFPRLISLRTLYLQWNRISVLMQGMAWTWSSLQTLDLSGNEIQLIGPGFFQGLSKLHNLRLDSN-RLAAVSSETMSAWTG-LSSLNLAGNSWQCNQNICSIAIWLNSFQGTQEGVMRCGSP 340          

HSP 3 Score: 51.9878 bits (123), Expect = 2.375e-7
Identity = 38/121 (31.40%), Postives = 60/121 (49.59%), Query Frame = 2
Query:  656 LENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            L+++    F    QL  L +  N I  ++  +F G + L  L+LSSN+          F  + N+  LD+SFN++  L    F GL KLQ LH+ +N L  +    F+   S+  L+L +N
Sbjct:   71 LKSLPENHFSGLKQLTWLYLDHNHIQLVAEGAFVGARRLKELTLSSNKLIRLPNAT--FHPLVNMRSLDISFNQLQMLEAGQFRGLRKLQYLHMRSNQLRTVPVRIFQDCRSIELLDLGYN 189          
BLAST of SMED30024248 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004554.1 (pep scaffold:Pmarinus_7.0:GL476584:51477:255513:-1 gene:ENSPMAG00000004069.1 transcript:ENSPMAT00000004554.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 4.247e-10
Identity = 44/117 (37.61%), Postives = 62/117 (52.99%), Query Frame = 2
Query:  671 FEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNP 1021
            F+  VN   L+ L +  NQ+S + +  F  L  LT+L L  NQ +        F  +GNL +L L  N++ AL   +F  LV LQ+L L NN L+ I   AF+ L SL ++ L  NP
Sbjct:   73 FDRLVN---LQKLYLWGNQLSALPVGVFDKLTQLTYLGLYVNQLKSVPRGL--FDGLGNLQQLYLRANQLTALPAGVFDRLVNLQELTLYNNQLKSIPRGAFDNLKSLTHIWLFGNP 184          
BLAST of SMED30024248 vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 63.1586 bits (152), Expect = 1.874e-10
Identity = 55/183 (30.05%), Postives = 90/183 (49.18%), Query Frame = 2
Query:  494 KNSLSGVALDIENFLS-------GLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQ---LENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            +N L  + LD  NF +       GL  L+ L +++ ++ +  +   +  +S  ++   NL+   L +I    F +   LK+L +  N+I  IS  SF  L+ L  L LS+N         NG FR + NL  L L  NRI A++   F+GL  ++ L+L+ N +  I   +F+G+  L  L L
Sbjct:  294 QNKLQQLYLDRNNFTAIQTSSFFGLRDLQNLYLQSNQISTIITTKFADWRSFPVLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLDGNRITAIAATAFLGLENIKYLNLSANIITSIQENSFQGMDKLQKLWL 476          

HSP 2 Score: 52.373 bits (124), Expect = 3.898e-7
Identity = 56/176 (31.82%), Postives = 84/176 (47.73%), Query Frame = 2
Query:  494 KNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEH-FTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            KN L+ V  D    LS L  LK+L +      S  +   +   S+E++ L   ++  I   AF    +L+ L +  N  + I   SF GL+ L +L L SNQ     TT    +R    L KL+L  NR++ +    F  L+ L+ L+L NN +  I   +F  L SL  L+L +N
Sbjct:  233 KNRLTSVPSDA---LSQLQSLKRLDLSRNFFTSILASAFNRLSSLEVLKLSKNRISTIR-GAFWGQNKLQQLYLDRNNFTAIQTSSFFGLRDLQNLYLQSNQISTIITTKFADWRSFPVLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNN 404          
BLAST of SMED30024248 vs. Ensembl Nematostella
Match: EDO31669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXA1])

HSP 1 Score: 53.5286 bits (127), Expect = 1.734e-7
Identity = 55/208 (26.44%), Postives = 91/208 (43.75%), Query Frame = 2
Query:  530 NFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISL----VYLNLLH---------NPKL--IVFDLLCL----NPIKANLIKIFISAD 1096
            +F  GLN ++ L +   +              ++ + L+   ++ I+F AF N   L+ L +  N++ R++   F  L YL  LSL  N+    T   + F  + +L +L L  N+I  +    F  L  L  L+L++N L  I      GL ++    VY N L          NP+L  IV+D+  L     P  AN++   +  D
Sbjct:   89 DFFLGLNNIRTLDLSGNRFSKIRFNTFGYLPGMKKLNLRRNGIKEIEFGAFRNLTALESLILSKNKLRRLTYAMFDTLSYLRLLSLVDNRLTGLTR--SMFSGLKSLRELYLQRNQIQDIEPWTFTSLKSLASLYLDSNQLTVISRDTLLGLTNVKDIHVYFNKLRYVARDAFKPNPQLTRIVWDVPALFRRTRPEFANMVGNMLHCD 294          
BLAST of SMED30024248 vs. Ensembl Medaka
Match: lgr4 (leucine rich repeat containing G protein-coupled receptor 4 [Source:NCBI gene;Acc:101167435])

HSP 1 Score: 67.3958 bits (163), Expect = 2.671e-11
Identity = 57/180 (31.67%), Postives = 88/180 (48.89%), Query Frame = 2
Query:  530 NFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKA 1066
            N       +++L++    L     E LS    +++++L+N QL+++   A  N   L+ L +  N I+ +   SF+GL+ L HL L  N   H T    G      NL  L L+ NRI  +    F  L  L  LHL+NN +  I + +F GL++L  L+L  N  L+VF      PI+A
Sbjct:   74 NVFKSFPYMEELRLAGNDLTFIHPEALSGLHQLKVLMLQNNQLKSVPSAALKNLQSLQSLRLDANHITTVPDESFQGLQQLRHLWLDDN---HLTQVPVGSLTHQANLQALTLALNRITYIPANAFANLTSLVVLHLHNNRIREIASNSFAGLVNLETLDLNFN-NLMVFP----KPIEA 245          
BLAST of SMED30024248 vs. Ensembl Medaka
Match: lgr4 (leucine rich repeat containing G protein-coupled receptor 4 [Source:NCBI gene;Acc:101167435])

HSP 1 Score: 67.0106 bits (162), Expect = 2.970e-11
Identity = 57/181 (31.49%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  527 ENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNG-FREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKA 1066
             N       +++L++    L     E LS    +++++L+N QL+++   A  N   L+ L +  N I+ +   SF+GL+ L HL L  N   H T    G      NL  L L+ NRI  +    F  L  L  LHL+NN +  I + +F GL++L  L+L  N  L+VF      PI+A
Sbjct:   73 ANVFKSFPYMEELRLAGNDLTFIHPEALSGLHQLKVLMLQNNQLKSVPSAALKNLQSLQSLRLDANHITTVPDESFQGLQQLRHLWLDDN---HLTQVPVGSLTHQANLQALTLALNRITYIPANAFANLTSLVVLHLHNNRIREIASNSFAGLVNLETLDLNFN-NLMVFP----KPIEA 245          
BLAST of SMED30024248 vs. Ensembl Medaka
Match: lrrtm4l1 (leucine-rich repeat transmembrane neuronal protein 4-like [Source:NCBI gene;Acc:101154965])

HSP 1 Score: 65.0846 bits (157), Expect = 9.584e-11
Identity = 69/226 (30.53%), Postives = 106/226 (46.90%), Query Frame = 2
Query:  596 SSEYLSVCQSVEI----IILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNN--------------DLEFID----------NMAFEGLISLVYLNLLHNP-KLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSNDCQS 1186
            SS +L V +++ +    + L+  +L  +    F +  Q+  + +  NQIS I   +F+G++ L  L LSSN+    + + + F  I NL  LDLSFN++  L    F GL KLQ LHL +N               LEF+D             F GL  L+ L+L HN    I F L    P  ANL  +++  + I+ V     L     ++QK+  S N+ Q+
Sbjct:   67 SSGFLEVPENISVGCQGLSLRYNELHTLLPYQFAHLSQILWIYLDHNQISAIDSRAFQGVRRLKELILSSNRIT--SLHNSTFHGIPNLRSLDLSFNKLEILQPGQFHGLRKLQNLHLRSNGLSNIPIRVFLECRSLEFLDLGYNRIKALTRTTFLGLQRLMELHLEHNQFTRINFFLF---PRLANLRSLYLQWNRIRVV--NQGLPWIWYTLQKLDLSGNEIQT 285          

HSP 2 Score: 59.6918 bits (143), Expect = 4.784e-9
Identity = 57/182 (31.32%), Postives = 83/182 (45.60%), Query Frame = 2
Query:  635 IILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCE----------------HFTTNG------NGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVE 1114
            I L + Q+  ID  AF    +LK L +  N+I+ +   +F G+  L  L LS N+ E                H  +NG        F E  +L  LDL +NRI AL+   F+GL +L +LHL +N    I+   F  L +L  L L  N   +V   L    I   L K+ +S + IQ ++
Sbjct:  108 IYLDHNQISAIDSRAFQGVRRLKELILSSNRITSLHNSTFHGIPNLRSLDLSFNKLEILQPGQFHGLRKLQNLHLRSNGLSNIPIRVFLECRSLEFLDLGYNRIKALTRTTFLGLQRLMELHLEHNQFTRINFFLFPRLANLRSLYLQWNRIRVVNQGLPW--IWYTLQKLDLSGNEIQTLD 287          
BLAST of SMED30024248 vs. Ensembl Medaka
Match: lrrtm4l1 (leucine-rich repeat transmembrane neuronal protein 4-like [Source:NCBI gene;Acc:101154965])

HSP 1 Score: 65.0846 bits (157), Expect = 1.093e-10
Identity = 67/225 (29.78%), Postives = 106/225 (47.11%), Query Frame = 2
Query:  596 SSEYLSVCQSVEI----IILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNN--------------DLEFID----------NMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSNDCQS 1186
            SS +L V +++ +    + L+  +L  +    F +  Q+  + +  NQIS I   +F+G++ L  L LSSN+    + + + F  I NL  LDLSFN++  L    F GL KLQ LHL +N               LEF+D             F GL  L+ L+L HN +    +   L P  ANL  +++  + I+ V     L     ++QK+  S N+ Q+
Sbjct:   67 SSGFLEVPENISVGCQGLSLRYNELHTLLPYQFAHLSQILWIYLDHNQISAIDSRAFQGVRRLKELILSSNRIT--SLHNSTFHGIPNLRSLDLSFNKLEILQPGQFHGLRKLQNLHLRSNGLSNIPIRVFLECRSLEFLDLGYNRIKALTRTTFLGLQRLMELHLEHN-QFTRINFF-LFPRLANLRSLYLQWNRIRVV--NQGLPWIWYTLQKLDLSGNEIQT 285          

HSP 2 Score: 59.3066 bits (142), Expect = 5.994e-9
Identity = 57/182 (31.32%), Postives = 83/182 (45.60%), Query Frame = 2
Query:  635 IILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCE----------------HFTTNG------NGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVE 1114
            I L + Q+  ID  AF    +LK L +  N+I+ +   +F G+  L  L LS N+ E                H  +NG        F E  +L  LDL +NRI AL+   F+GL +L +LHL +N    I+   F  L +L  L L  N   +V   L    I   L K+ +S + IQ ++
Sbjct:  108 IYLDHNQISAIDSRAFQGVRRLKELILSSNRITSLHNSTFHGIPNLRSLDLSFNKLEILQPGQFHGLRKLQNLHLRSNGLSNIPIRVFLECRSLEFLDLGYNRIKALTRTTFLGLQRLMELHLEHNQFTRINFFLFPRLANLRSLYLQWNRIRVVNQGLPW--IWYTLQKLDLSGNEIQTLD 287          
BLAST of SMED30024248 vs. Ensembl Medaka
Match: ENSORLT00000041850.1 (leucine rich repeat containing G protein-coupled receptor 5 [Source:NCBI gene;Acc:101157030])

HSP 1 Score: 65.0846 bits (157), Expect = 1.132e-10
Identity = 52/173 (30.06%), Postives = 83/173 (47.98%), Query Frame = 2
Query:  500 SLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHN 1018
            S++ + L     LS L+ L++L++    L        +   ++++++L+N QL ++  EAF N   L+ L +  N IS +   SF GL+ L HL L  N             E+  L  + L+ N I  +    F  L +L  LHLNNN +  +    F GL SL  L+L +N
Sbjct:   85 SMNNMTLISAGALSSLHFLQELRLPGNDLSFIPKGAFAGLYNLKVLMLQNNQLRSVPAEAFNNLHNLQSLRLDANHISGVPAGSFSGLRSLRHLWLDDNALTEVPA--EALSELPALQAMTLALNHIRHVPDHAFSALGRLVVLHLNNNRIVSMGTNCFHGLHSLETLDLNYN 255          

HSP 2 Score: 53.1434 bits (126), Expect = 6.992e-7
Identity = 52/195 (26.67%), Postives = 88/195 (45.13%), Query Frame = 2
Query:  425 SIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNL 1009
            S+P  +   NL +L  L +D    N +SGV        SGL  L+ L +++  L    +E LS   +++ + L    + ++   AF    +L +L +  N+I  +    F GL  L  L L+ NQ   F T     R + +L +L    N+I ++    F G   L  +   +N ++ +   AF+ L  L  L+L
Sbjct:  139 SVPA-EAFNNLHNLQSLRLDA---NHISGVP---AGSFSGLRSLRHLWLDDNALTEVPAEALSELPALQAMTLALNHIRHVPDHAFSALGRLVVLHLNNNRIVSMGTNCFHGLHSLETLDLNYNQLMEFPT---AIRSLRHLKELGFHSNKIQSIPDHAFTGNPSLTTVFFYDNPIQSVGRTAFQNLPELRTLSL 323          
BLAST of SMED30024248 vs. Planmine SMEST
Match: SMESG000055844.1 (SMESG000055844.1)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 442/460 (96.09%), Postives = 444/460 (96.52%), Query Frame = 2
Query:  146 MYIVQFLSAIITIELWRFTLARIPCPQKLCRCDENGQPWKCEIRRDQDQIDCSQDLSLSEPINVNLNLINFTYQRKLTFFNYCKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSNDCQSPSEMTRHTTTVSETLPLKAGSPNXXXXXXXXXXXXXXXXGIFVGVFTGCSMKKKIRKYKNSCSDRLTSHSNSLRNYDPYPGNHTIPNHLPLLNETPKLSPRYRSNPILSNTSV 1525
            MYIVQFLSAIITIELWRFTLAR+PCPQKLCRCDENGQPWKCEIRRDQDQIDCSQDLSLSEPINVNLNLINFTYQRKLTFFNYCKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAF               ISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLS NRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLL+NPKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSNDCQSPSEMTRHTTTVSETLPLKAGSPNMVLIVVVAVAVTLLMVGIFVGVFTGCSMKKKIRKYKNSCSDRLTSHSNSLRNYDPYPGNHTIPNHLPLLNETPKLSPRYRSNPILSNTSV
Sbjct:    1 MYIVQFLSAIITIELWRFTLARVPCPQKLCRCDENGQPWKCEIRRDQDQIDCSQDLSLSEPINVNLNLINFTYQRKLTFFNYCKVGILKISSDSIPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAF---------------ISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSSNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLNNPKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSNDCQSPSEMTRHTTTVSETLPLKAGSPNMVLIVVVAVAVTLLMVGIFVGVFTGCSMKKKIRKYKNSCSDRLTSHSNSLRNYDPYPGNHTIPNHLPLLNETPKLSPRYRSNPILSNTSV 445          
BLAST of SMED30024248 vs. Planmine SMEST
Match: SMESG000052792.1 (SMESG000052792.1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.614e-8
Identity = 86/320 (26.88%), Postives = 140/320 (43.75%), Query Frame = 2
Query:  215 PCPQKLCRCDENGQPWKCEIRR-DQDQIDCSQDLSLSEPINVNLNLINFTYQRKLTF----FNYC-KVGILKISSDS---IPGKQMIKNLESLNYLIIDGTQKNSLSGVALDIEN-FLSGLNKLKQLKIENIKLDSWSSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISILSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSMKMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLLCLNPIKANLIKIFISADSIQCVEMKSKLSDFPK 1144
            PC QK CRC    +  K E+     D+ D     ++  PI +          +KL F       C ++  L I+++S   +   QM K +  L  L++    +         IEN FL     LK L I   +++  S    S C   E I L + ++  I  + F +C ++  L +  N+++ I  L F     L +L LS N+          F+ +  +  L+L+ N +  +  ++  GL  LQ L L+ N +E I+  AF  L SL Y+NL  NP L    +L L     NL  + +    ++CV+   + SD+ K
Sbjct:   31 PC-QKKCRCKHKEKSSKIEVAHCTVDEKDTFVSCNVEWPILL-------MTVKKLRFNADLLAACQRISGLLITTESSLIVLMPQMFKLVSRLETLVVQAPIQT--------IENQFLKNFVSLKILHISETRIEHLSRGMFSDCPITERIRLSSNRISVIADKTFDSCNRVVNLDLGNNRLTVIRRLIFNEGHSLQNLDLSRNRITRI--EDFSFKNLKKMKVLNLNANLLMRIKPEILFGLESLQYLFLSKNSIETIEEDAFVNLKSLKYINLEKNPLLRPNMVLFL-----NLDNLTVLLTGVKCVD--EQYSDYSK 325          
The following BLAST results are available for this feature:
BLAST of SMED30024248 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRTM28.446e-1137.40leucine rich repeat transmembrane neuronal 2 [Sour... [more]
LRRTM39.683e-1137.19leucine rich repeat transmembrane neuronal 3 [Sour... [more]
LINGO21.428e-1032.30leucine rich repeat and Ig domain containing 2 [So... [more]
LINGO21.428e-1032.30leucine rich repeat and Ig domain containing 2 [So... [more]
LINGO21.428e-1032.30leucine rich repeat and Ig domain containing 2 [So... [more]
back to top
BLAST of SMED30024248 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lron-152.932e-1136.09ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
sym-13.801e-829.52SYM-1 protein [Source:UniProtKB/TrEMBL;Acc:G5EFP4... [more]
let-42.891e-724.87Leucine-rich repeat-containing protein let-4 [Sou... [more]
egg-69.369e-627.48Leucine-rich repeat-containing protein egg-6 [Sou... [more]
back to top
BLAST of SMED30024248 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rk1.129e-1134.38gene:FBgn0003255 transcript:FBtr0080610[more]
CG75096.674e-1128.52gene:FBgn0035575 transcript:FBtr0073362[more]
Con9.866e-1029.32gene:FBgn0005775 transcript:FBtr0309972[more]
Con9.866e-1029.32gene:FBgn0005775 transcript:FBtr0073375[more]
sli1.376e-927.83gene:FBgn0264089 transcript:FBtr0330733[more]
back to top
BLAST of SMED30024248 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrig35.937e-1234.21leucine-rich repeats and immunoglobulin-like domai... [more]
LRRTM47.188e-1227.52leucine rich repeat transmembrane neuronal 4 [Sour... [more]
lrig11.807e-1131.65leucine-rich repeats and immunoglobulin-like domai... [more]
lrig12.075e-1131.65leucine-rich repeats and immunoglobulin-like domai... [more]
lrig12.165e-1131.65leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of SMED30024248 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vasn7.664e-1040.38vasorin [Source:NCBI gene;Acc:448556][more]
vasn8.420e-1040.38vasorin [Source:NCBI gene;Acc:448556][more]
IGFALS1.460e-928.77insulin like growth factor binding protein acid la... [more]
rorc2.075e-932.03RAR related orphan receptor C [Source:Xenbase;Acc:... [more]
rorc2.118e-932.03RAR related orphan receptor C [Source:Xenbase;Acc:... [more]
back to top
BLAST of SMED30024248 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lgr62.725e-1125.51leucine-rich repeat-containing G protein-coupled r... [more]
Lrrtm36.100e-1137.19leucine rich repeat transmembrane neuronal 3 [Sour... [more]
Lrig26.379e-1131.82leucine-rich repeats and immunoglobulin-like domai... [more]
Lrrtm26.601e-1137.40leucine rich repeat transmembrane neuronal 2 [Sour... [more]
Lrig26.647e-1131.82leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of SMED30024248 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UVD5|LGR6_MOUSE1.906e-1025.51Leucine-rich repeat-containing G-protein coupled r... [more]
sp|O43300|LRRT2_HUMAN4.056e-1037.40Leucine-rich repeat transmembrane neuronal protein... [more]
sp|D3ZAL8|LRRT3_RAT4.085e-1037.19Leucine-rich repeat transmembrane neuronal protein... [more]
sp|Q8BZ81|LRRT3_MOUSE4.267e-1037.19Leucine-rich repeat transmembrane neuronal protein... [more]
sp|Q52KR2|LRIG2_MOUSE4.462e-1031.82Leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of SMED30024248 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0D2WM221.540e-1329.61Uncharacterized protein OS=Capsaspora owczarzaki (... [more]
A0A0D2X5D93.310e-1332.45TKL protein kinase OS=Capsaspora owczarzaki (strai... [more]
A0A0D2U6J44.461e-1330.36LRRNT domain-containing protein OS=Capsaspora owcz... [more]
A0A0D2VQM37.255e-1334.97TKL protein kinase OS=Capsaspora owczarzaki (strai... [more]
A0A0D2VM238.736e-1334.81Uncharacterized protein OS=Capsaspora owczarzaki (... [more]
back to top
BLAST of SMED30024248 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrig21.064e-1229.59leucine rich repeats and immunoglobulin like domai... [more]
lrig33.303e-1231.48leucine rich repeats and immunoglobulin like domai... [more]
mxra5a1.594e-1130.46matrix-remodeling-associated protein 5 [Source:NCB... [more]
mxra5a1.598e-1130.46matrix-remodeling-associated protein 5 [Source:NCB... [more]
mxra5a1.610e-1130.46matrix-remodeling-associated protein 5 [Source:NCB... [more]
back to top
BLAST of SMED30024248 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrig32.906e-1531.19leucine-rich repeats and immunoglobulin-like domai... [more]
lrig35.831e-1432.09leucine-rich repeats and immunoglobulin-like domai... [more]
LRRTM47.541e-1233.79leucine rich repeat transmembrane neuronal 4 [Sour... [more]
LRRTM41.927e-1131.55leucine rich repeat transmembrane neuronal 4 [Sour... [more]
ENSPMAT00000004554.14.247e-1037.61pep scaffold:Pmarinus_7.0:GL476584:51477:255513:-1... [more]
back to top
BLAST of SMED30024248 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024248 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO481791.874e-1030.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316691.734e-726.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30024248 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgr42.671e-1131.67leucine rich repeat containing G protein-coupled r... [more]
lgr42.970e-1131.49leucine rich repeat containing G protein-coupled r... [more]
lrrtm4l19.584e-1130.53leucine-rich repeat transmembrane neuronal protein... [more]
lrrtm4l11.093e-1029.78leucine-rich repeat transmembrane neuronal protein... [more]
ENSORLT00000041850.11.132e-1030.06leucine rich repeat containing G protein-coupled r... [more]
back to top
BLAST of SMED30024248 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000055844.10.000e+096.09SMESG000055844.1[more]
SMESG000052792.11.614e-826.88SMESG000052792.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024248 ID=SMED30024248|Name=SMED30024248|organism=Schmidtea mediterranea sexual|type=transcript|length=1592bp
GTCAACACAAAGTACATCACAATGTGAGTTTCACTAATTACAATGGATGT
TAACAGAGTATTTGTAGACGTTTACGACTCTTGATCACAGTTGACATAAT
ATACCAAATACAGTCGTTGTACATAATTGATATGTAAAAACTGATATGTA
TATCGTTCAATTTCTCTCTGCAATAATCACAATAGAATTGTGGAGATTTA
CCCTTGCCAGAATACCCTGTCCCCAAAAACTGTGCCGTTGTGATGAGAAT
GGCCAGCCATGGAAATGTGAAATCAGACGAGATCAAGACCAGATTGACTG
CAGTCAAGATTTATCCCTTTCTGAACCGATTAATGTAAATTTGAATTTAA
TTAATTTCACTTATCAACGAAAACTGACGTTTTTCAACTACTGTAAAGTA
GGAATTTTAAAAATCTCCTCAGACTCGATTCCAGGGAAACAAATGATCAA
AAACCTCGAATCATTGAATTATCTCATAATCGACGGAACCCAGAAAAACT
CTCTTTCCGGTGTTGCTTTGGACATAGAAAATTTTCTTTCTGGATTAAAT
AAACTGAAGCAACTGAAAATCGAAAACATCAAACTGGATTCCTGGTCGAG
TGAATATTTATCCGTCTGTCAGTCGGTCGAGATTATCATACTTAAAAATC
TACAGCTGGAAAACATTGACTTCGAAGCTTTCGTAAACTGTTTTCAATTA
AAAATACTAACTATTATTTTCAATCAGATTTCAAGGATTTCGATTTTATC
CTTTAAAGGGCTAAAATATTTGACTCATTTATCTTTATCGTCCAATCAAT
GCGAACATTTCACAACCAATGGGAATGGTTTCCGGGAAATCGGCAATTTA
ATAAAACTCGATCTTTCATTCAATAGAATTGCTGCATTGTCAATGAAAAT
GTTTATTGGATTGGTTAAACTTCAACAGTTGCACTTAAATAATAATGATC
TGGAATTCATTGACAATATGGCTTTTGAAGGATTGATAAGTCTGGTATAC
TTAAATCTTCTACACAATCCCAAACTAATTGTGTTTGATTTGCTCTGTCT
TAATCCCATTAAAGCAAATCTGATAAAAATTTTCATTAGCGCTGATTCTA
TTCAATGTGTCGAAATGAAATCGAAATTGTCTGATTTTCCCAAAAGTGTT
CAAAAAGTGTTTTATTCATCTAACGACTGTCAAAGTCCCAGTGAAATGAC
TCGTCACACAACTACTGTTTCAGAAACACTTCCATTGAAAGCAGGCTCTC
CCAATATGGTTTTGATTGTTGTTGTTGCAGTAGCAGTGACGCTTTTGATG
GTTGGGATTTTTGTCGGAGTTTTTACCGGATGTTCGATGAAAAAGAAAAT
TCGAAAATATAAAAACAGTTGCTCAGACAGGTTAACGAGCCACTCGAACA
GTTTAAGGAATTACGACCCCTACCCTGGAAATCACACAATTCCAAACCAC
TTGCCGCTACTAAATGAAACTCCGAAATTATCGCCTCGATACAGAAGCAA
TCCAATTTTGTCGAATACGAGTGTATAATATGTATATATTTTATTTAAAC
AGAGAAAAGCTTTTTTCTTTTTTTATCACTAATAAAGCGCAT
back to top

protein sequence of SMED30024248-orf-1

>SMED30024248-orf-1 ID=SMED30024248-orf-1|Name=SMED30024248-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=461bp
MYIVQFLSAIITIELWRFTLARIPCPQKLCRCDENGQPWKCEIRRDQDQI
DCSQDLSLSEPINVNLNLINFTYQRKLTFFNYCKVGILKISSDSIPGKQM
IKNLESLNYLIIDGTQKNSLSGVALDIENFLSGLNKLKQLKIENIKLDSW
SSEYLSVCQSVEIIILKNLQLENIDFEAFVNCFQLKILTIIFNQISRISI
LSFKGLKYLTHLSLSSNQCEHFTTNGNGFREIGNLIKLDLSFNRIAALSM
KMFIGLVKLQQLHLNNNDLEFIDNMAFEGLISLVYLNLLHNPKLIVFDLL
CLNPIKANLIKIFISADSIQCVEMKSKLSDFPKSVQKVFYSSNDCQSPSE
MTRHTTTVSETLPLKAGSPNMVLIVVVAVAVTLLMVGIFVGVFTGCSMKK
KIRKYKNSCSDRLTSHSNSLRNYDPYPGNHTIPNHLPLLNETPKLSPRYR
SNPILSNTSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003591Leu-rich_rpt_typical-subtyp
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0001968fibronectin binding
GO:0004860protein kinase inhibitor activity
GO:0005518collagen binding
GO:0043236laminin binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0006469negative regulation of protein kinase activity
GO:0019221cytokine-mediated signaling pathway
GO:0030335positive regulation of cell migration
GO:0046426negative regulation of JAK-STAT cascade
GO:0046813receptor-mediated virion attachment to host cell
GO:0090005negative regulation of establishment of protein localization to plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 232..255
e-value: 21.0
score: 10.7
coord: 256..279
e-value: 0.013
score: 24.7
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 234..291
e-value: 9.3E-11
score: 41.3
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 28..360
e-value: 1.9E-32
score: 113.8
NoneNo IPR availablePANTHERPTHR46473FAMILY NOT NAMEDcoord: 160..399
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.688
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 65..344
NoneNo IPR availableTMHMMTMhelixcoord: 371..393