RNA binding protein 42

Overview
NameRNA binding protein 42
Smed IDSMED30024244
Length (bp)983
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA binding protein 42 (SMED30024244) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA binding protein 42 (SMED30024244) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA binding protein 42 (SMED30024244) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA binding protein 42 (SMED30024244) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024244

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024244h1SMcG0021753 SmedASXL_005835SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30024244h1SMcG0021753 SmedASXL_005835SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA binding protein 42 vs. Ensembl Human
Match: RBM42 (RNA binding motif protein 42 [Source:HGNC Symbol;Acc:HGNC:28117])

HSP 1 Score: 139.428 bits (350), Expect = 3.369e-37
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R    V
Sbjct:  307 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVV 413          
BLAST of RNA binding protein 42 vs. Ensembl Human
Match: RBM42 (RNA binding motif protein 42 [Source:HGNC Symbol;Acc:HGNC:28117])

HSP 1 Score: 139.043 bits (349), Expect = 6.099e-37
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R    V
Sbjct:  331 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVV 437          
BLAST of RNA binding protein 42 vs. Ensembl Human
Match: RBM42 (RNA binding motif protein 42 [Source:HGNC Symbol;Acc:HGNC:28117])

HSP 1 Score: 139.428 bits (350), Expect = 6.822e-37
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R    V
Sbjct:  361 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVV 467          
BLAST of RNA binding protein 42 vs. Ensembl Human
Match: RBM42 (RNA binding motif protein 42 [Source:HGNC Symbol;Acc:HGNC:28117])

HSP 1 Score: 139.043 bits (349), Expect = 7.608e-37
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R    V
Sbjct:  339 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVV 445          
BLAST of RNA binding protein 42 vs. Ensembl Human
Match: RBM42 (RNA binding motif protein 42 [Source:HGNC Symbol;Acc:HGNC:28117])

HSP 1 Score: 78.1814 bits (191), Expect = 1.359e-16
Identity = 32/53 (60.38%), Postives = 43/53 (81.13%), Query Frame = 2
Query:  650 AHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            A V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R
Sbjct:  114 AKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDR 166          
BLAST of RNA binding protein 42 vs. Ensembl Celegans
Match: rbm-42 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:Q9N394])

HSP 1 Score: 144.05 bits (362), Expect = 1.463e-40
Identity = 58/102 (56.86%), Postives = 83/102 (81.37%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R  GG+VW DP++A+WD+ND+R+F G+LG E SD+LL K F  YPSF+KA VVR+ +T + KG+GF+SF ++EDY++A +E +GKYVG+RPIKL +S W++R
Sbjct:  183 RSGGGQVWEDPSLAEWDENDFRVFCGDLGNEVSDELLAKAFRKYPSFQKAKVVRESRTNKSKGYGFVSFRDSEDYVRAMREMDGKYVGNRPIKLRKSAWKER 284          
BLAST of RNA binding protein 42 vs. Ensembl Celegans
Match: tiar-3 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q93194])

HSP 1 Score: 67.781 bits (164), Expect = 2.137e-12
Identity = 31/86 (36.05%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  563 YRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTE 820
            + +FVG+L  + S++LL  TF+ +    +A V+RD +T + KG+GF+SF N ++   A    NGK++G R +   R+ W  R+ +E
Sbjct:  225 FHVFVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSFPNKQNAENAIAGMNGKWIGKRAV---RTNWAARKNSE 307          
BLAST of RNA binding protein 42 vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 56.9954 bits (136), Expect = 4.113e-9
Identity = 27/83 (32.53%), Postives = 47/83 (56.63%), Query Frame = 2
Query:  563 YRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            + +FVG+L  E  +  L + F  +     A V+RD  T + KG+GF+S+   E+  +A ++ NG+++G R I   R+ W  R+
Sbjct:   32 FHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTI---RTNWATRK 111          
BLAST of RNA binding protein 42 vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 56.9954 bits (136), Expect = 4.634e-9
Identity = 27/83 (32.53%), Postives = 47/83 (56.63%), Query Frame = 2
Query:  563 YRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            + +FVG+L  E  +  L + F  +     A V+RD  T + KG+GF+S+   E+  +A ++ NG+++G R I   R+ W  R+
Sbjct:   22 FHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTI---RTNWATRK 101          
BLAST of RNA binding protein 42 vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 56.6102 bits (135), Expect = 9.174e-9
Identity = 27/83 (32.53%), Postives = 47/83 (56.63%), Query Frame = 2
Query:  563 YRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            + +FVG+L  E  +  L + F  +     A V+RD  T + KG+GF+S+   E+  +A ++ NG+++G R I   R+ W  R+
Sbjct:  103 FHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTI---RTNWATRK 182          
BLAST of RNA binding protein 42 vs. Ensembl Fly
Match: CG2931 (gene:FBgn0037342 transcript:FBtr0078753)

HSP 1 Score: 139.428 bits (350), Expect = 1.062e-38
Identity = 56/102 (54.90%), Postives = 81/102 (79.41%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            RIAGG VW D ++ADW  +D+R+F G+LG + +D++L +TF+ +PSF++A VVRDK+TG+ KGFGF+SF    D+++A KE +G+YVGSRPIKL +S W +R
Sbjct:  178 RIAGGTVWEDTSLADWPDDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRYVGSRPIKLRKSTWRQR 279          
BLAST of RNA binding protein 42 vs. Ensembl Fly
Match: CstF64 (gene:FBgn0027841 transcript:FBtr0083660)

HSP 1 Score: 62.7734 bits (151), Expect = 1.272e-10
Identity = 29/86 (33.72%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  548 WDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEK 805
             DK+   +FVGN+ YEA+++ L + FS         +V D+++G+ KGFGF  + + E  L A +  NG  +G R +++  +  EK
Sbjct:   11 MDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEIGGRTLRVDNACTEK 96          
BLAST of RNA binding protein 42 vs. Ensembl Fly
Match: Caper (gene:FBgn0031883 transcript:FBtr0089640)

HSP 1 Score: 59.6918 bits (143), Expect = 1.601e-9
Identity = 26/74 (35.14%), Postives = 45/74 (60.81%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            RL+VG+L +  ++D+L   F  +       ++ D +TGR KG+GFI++ NA+D  KA ++ NG  +  R +K+ 
Sbjct:  336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVG 409          
BLAST of RNA binding protein 42 vs. Ensembl Fly
Match: Caper (gene:FBgn0031883 transcript:FBtr0089636)

HSP 1 Score: 59.6918 bits (143), Expect = 1.601e-9
Identity = 26/74 (35.14%), Postives = 45/74 (60.81%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            RL+VG+L +  ++D+L   F  +       ++ D +TGR KG+GFI++ NA+D  KA ++ NG  +  R +K+ 
Sbjct:  336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVG 409          
BLAST of RNA binding protein 42 vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086738)

HSP 1 Score: 58.9214 bits (141), Expect = 2.583e-9
Identity = 34/84 (40.48%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  569 LFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRP--IKLARSKWEKRQY 814
            L+V NL     DD L   FS Y +   A V+ D++ GR KGFGF+ F  A +   A  E NG+ VGS+P  + LA+ K E++ +
Sbjct:  289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEERKAH 371          
BLAST of RNA binding protein 42 vs. Ensembl Zebrafish
Match: rbm42 (RNA binding motif protein 42 [Source:NCBI gene;Acc:445360])

HSP 1 Score: 137.117 bits (344), Expect = 8.234e-37
Identity = 55/102 (53.92%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R+A G  W D ++ +W+ +D+R+F G+LG E +DD+L + FS YPSF KA VVRDK+TG+ KG+GF+SF +  DY++A +E NG+YVGSRPIKL +S W+ R
Sbjct:  283 RVAAGVSWEDTSLLEWETDDFRIFCGDLGNEVNDDILARAFSRYPSFLKAKVVRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGRYVGSRPIKLRKSTWKDR 384          
BLAST of RNA binding protein 42 vs. Ensembl Zebrafish
Match: cirbpb (cold inducible RNA binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-5841])

HSP 1 Score: 65.0846 bits (157), Expect = 4.183e-12
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            +LF+G L Y+ ++  L + FS Y +  K  V+RD++T R +GFGF++F N ED   A    NGK V  R I++
Sbjct:    6 KLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQVDGRMIRV 78          
BLAST of RNA binding protein 42 vs. Ensembl Zebrafish
Match: cirbpb (cold inducible RNA binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-5841])

HSP 1 Score: 64.6994 bits (156), Expect = 9.675e-12
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            +LF+G L Y+ ++  L + FS Y +  K  V+RD++T R +GFGF++F N ED   A    NGK V  R I++
Sbjct:   23 KLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQVDGRMIRV 95          
BLAST of RNA binding protein 42 vs. Ensembl Zebrafish
Match: cirbpb (cold inducible RNA binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-5841])

HSP 1 Score: 64.6994 bits (156), Expect = 1.023e-11
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            +LF+G L Y+ ++  L + FS Y +  K  V+RD++T R +GFGF++F N ED   A    NGK V  R I++
Sbjct:   24 KLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQVDGRMIRV 96          
BLAST of RNA binding protein 42 vs. Ensembl Zebrafish
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 65.0846 bits (157), Expect = 2.278e-11
Identity = 34/85 (40.00%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  557 NDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            N + +FVG+L  E S D +   F+ +     A VVRD  TG+ KG+GFISF N  D   A ++ NG+++G R I   R+ W  R+
Sbjct:   95 NHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVRDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQI---RTNWATRK 176          
BLAST of RNA binding protein 42 vs. Ensembl Xenopus
Match: corin (corin, serine peptidase [Source:Xenbase;Acc:XB-GENE-950958])

HSP 1 Score: 136.346 bits (342), Expect = 1.727e-36
Identity = 54/102 (52.94%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R A G  W D ++ +W+ +D+R+F G+LG E +DD+L + FS YPSF +A V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S+W+ R
Sbjct:  258 RTAAGTSWEDQSLLEWESDDFRIFCGDLGNEVNDDILARAFSRYPSFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKLRKSQWKDR 359          
BLAST of RNA binding protein 42 vs. Ensembl Xenopus
Match: corin (corin, serine peptidase [Source:Xenbase;Acc:XB-GENE-950958])

HSP 1 Score: 136.346 bits (342), Expect = 1.965e-36
Identity = 54/102 (52.94%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R A G  W D ++ +W+ +D+R+F G+LG E +DD+L + FS YPSF +A V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S+W+ R
Sbjct:  273 RTAAGTSWEDQSLLEWESDDFRIFCGDLGNEVNDDILARAFSRYPSFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKLRKSQWKDR 374          
BLAST of RNA binding protein 42 vs. Ensembl Xenopus
Match: corin (corin, serine peptidase [Source:Xenbase;Acc:XB-GENE-950958])

HSP 1 Score: 135.191 bits (339), Expect = 4.025e-36
Identity = 54/102 (52.94%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R A G  W D ++ +W+ +D+R+F G+LG E +DD+L + FS YPSF +A V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S+W+ R
Sbjct:  249 RTAAGTSWEDQSLLEWESDDFRIFCGDLGNEVNDDILARAFSRYPSFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKLRKSQWKDR 350          
BLAST of RNA binding protein 42 vs. Ensembl Xenopus
Match: ero1a (endoplasmic reticulum oxidoreductase alpha [Source:Xenbase;Acc:XB-GENE-978124])

HSP 1 Score: 60.8474 bits (146), Expect = 4.432e-10
Identity = 33/85 (38.82%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  557 NDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            N   L+V NL YE  D  L K F+ + +   A V+R+   GR KGFGF+ F    +  KA  E NGK + S+P+ +A   W +R+
Sbjct:   34 NSVNLYVKNLSYEIDDYRLKKEFAPFGTITSAKVMRE--GGRSKGFGFVCFSTPAEARKALSEMNGKILASKPLYVA---WAQRK 113          
BLAST of RNA binding protein 42 vs. Ensembl Xenopus
Match: RBM23 (RNA binding motif protein 23 [Source:NCBI gene;Acc:100144745])

HSP 1 Score: 61.6178 bits (148), Expect = 5.181e-10
Identity = 26/74 (35.14%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            RL+VG+L +  ++D+L   F  +   +   ++++  TGR KGFGFI+F +AE   +A ++ NG  +  RP+K+ 
Sbjct:  249 RLYVGSLHFNITEDMLRGIFEPFGKIENIQLLKEPDTGRSKGFGFITFTDAECARRALEQLNGFELAGRPMKVG 322          
BLAST of RNA binding protein 42 vs. Ensembl Mouse
Match: Rbm42 (RNA binding motif protein 42 [Source:MGI Symbol;Acc:MGI:1915285])

HSP 1 Score: 140.198 bits (352), Expect = 2.123e-37
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R    V
Sbjct:  359 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVV 465          
BLAST of RNA binding protein 42 vs. Ensembl Mouse
Match: Rbm42 (RNA binding motif protein 42 [Source:MGI Symbol;Acc:MGI:1915285])

HSP 1 Score: 139.813 bits (351), Expect = 2.208e-37
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R    V
Sbjct:  330 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVV 436          
BLAST of RNA binding protein 42 vs. Ensembl Mouse
Match: Cirbp (cold inducible RNA binding protein [Source:MGI Symbol;Acc:MGI:893588])

HSP 1 Score: 60.4622 bits (145), Expect = 3.909e-11
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            +LFVG L ++ ++  L + FS Y    +  VV+D++T R +GFGF++F N +D   A    NGK V  R I++
Sbjct:    7 KLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRV 79          
BLAST of RNA binding protein 42 vs. Ensembl Mouse
Match: Rbm39 (RNA binding motif protein 39 [Source:MGI Symbol;Acc:MGI:2157953])

HSP 1 Score: 61.2326 bits (147), Expect = 5.368e-10
Identity = 26/74 (35.14%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            RL+VG+L +  ++D+L   F  +   +   ++ D +TGR KG+GFI+F ++E   KA ++ NG  +  RP+K+ 
Sbjct:  251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVG 324          
BLAST of RNA binding protein 42 vs. Ensembl Mouse
Match: Rbm39 (RNA binding motif protein 39 [Source:MGI Symbol;Acc:MGI:2157953])

HSP 1 Score: 61.2326 bits (147), Expect = 5.924e-10
Identity = 26/74 (35.14%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            RL+VG+L +  ++D+L   F  +   +   ++ D +TGR KG+GFI+F ++E   KA ++ NG  +  RP+K+ 
Sbjct:  251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVG 324          
BLAST of RNA binding protein 42 vs. UniProt/SwissProt
Match: sp|Q6AXT7|RBM42_RAT (RNA-binding protein 42 OS=Rattus norvegicus OX=10116 GN=Rbm42 PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.411e-36
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R    V
Sbjct:  359 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVV 465          
BLAST of RNA binding protein 42 vs. UniProt/SwissProt
Match: sp|Q91V81|RBM42_MOUSE (RNA-binding protein 42 OS=Mus musculus OX=10090 GN=Rbm42 PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.485e-36
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R    V
Sbjct:  359 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVV 465          
BLAST of RNA binding protein 42 vs. UniProt/SwissProt
Match: sp|A2VDB3|RBM42_XENLA (RNA-binding protein 42 OS=Xenopus laevis OX=8355 GN=rbm42 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.633e-36
Identity = 55/102 (53.92%), Postives = 79/102 (77.45%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R A G  W D ++ +W+ +D+R+F G+LG E +DD+L + FS YPSF +A V+RDK+TG+ KG+GF+SF +  DY++AT+E NGKYVGSRPIKL +S+W+ R
Sbjct:  273 RTAAGTSWEDQSLLEWEPDDFRIFCGDLGNEVNDDILARAFSRYPSFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRATREMNGKYVGSRPIKLRKSQWKDR 374          
BLAST of RNA binding protein 42 vs. UniProt/SwissProt
Match: sp|Q0P5L0|RBM42_BOVIN (RNA-binding protein 42 OS=Bos taurus OX=9913 GN=RBM42 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.774e-36
Identity = 56/104 (53.85%), Postives = 78/104 (75.00%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQY 814
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R  
Sbjct:  329 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNL 432          
BLAST of RNA binding protein 42 vs. UniProt/SwissProt
Match: sp|Q9BTD8|RBM42_HUMAN (RNA-binding protein 42 OS=Homo sapiens OX=9606 GN=RBM42 PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.276e-36
Identity = 57/107 (53.27%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            R A G  W DP++ +WD +D+R+F G+LG E +DD+L + FS +PSF KA V+RDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R    V
Sbjct:  361 RTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVV 467          
BLAST of RNA binding protein 42 vs. TrEMBL
Match: U6JQM1 (RNA-binding protein 42 OS=Echinococcus granulosus OX=6210 GN=EGR_09362 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.458e-42
Identity = 85/218 (38.99%), Postives = 122/218 (55.96%), Query Frame = 2
Query:  182 VMSALLAAEKGIV---KISTKTSVAPQDNPNKKKIIPQSKEVLPQPAPVYVPKAPEINQMYHQSNV---IXXXXXXXXXXVSSTVLIRDAEMAQHVMQKRAL--ESRVVTKSALKRIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            V  ALLAA  G+    +++  +S+A             +K     PA   VP  P    +  QS +   +      P    +S + + D  +A  +  K +L  E     K   KR+A G VW DPT++DWD ND+R+F G+LG E SDD L++ FS YPSF+KA V+ DK+TG+ +G+GF+SF +  D+ +A +E NGKYVG+RPIKL +S W  RQ
Sbjct:  147 VTRALLAAAAGVTYNHQVAPSSSLASTPASATASTASDTKSATATPATKVVPSVPSKTVVVPQSLLPTQLSSSTTSPSQRGASRLTLLDTSVAPPMRSKASLTEEPYSFQKKVYKRVAAGMVWEDPTLSDWDPNDFRIFCGDLGNEVSDDTLIRAFSRYPSFRKAKVIVDKRTGKSRGYGFVSFSDPNDFTRAMREMNGKYVGNRPIKLKKSDWRNRQ 364          
BLAST of RNA binding protein 42 vs. TrEMBL
Match: W7XFT1 (RNA-binding protein 42 (RBM42)-like RNA recognition motif protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_000933400 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.908e-40
Identity = 66/131 (50.38%), Postives = 93/131 (70.99%), Query Frame = 2
Query:  428 DAEMAQHVMQKRALESRVVTKSALKRIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTE 820
            D+   +  +Q+   E R+  K  + R + G+VW+DP M  W +NDYR+F GNLG E +DD+L  +F  YPSF KA VVRDK++ + KG+GF+SF + +D+LKA KE NGKYVG+RP+KL +S+WEKR + E
Sbjct:   38 DSMKTKRQLQQEKEEERL--KQKIMRKSAGDVWVDPNMGSWAENDYRVFCGNLGNEVTDDVLANSFKKYPSFCKARVVRDKRSQKTKGYGFVSFLDPQDFLKAMKEMNGKYVGNRPVKLMKSEWEKRSFIE 166          
BLAST of RNA binding protein 42 vs. TrEMBL
Match: A0A068Y599 (RNA binding protein 42 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000727000 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.772e-40
Identity = 67/137 (48.91%), Postives = 94/137 (68.61%), Query Frame = 2
Query:  407 SSTVLIRDAEMAQHVMQKRAL--ESRVVTKSALKRIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            +S + + D  +A  +  K +L  E     K   KR+A G VW DPT++DWD ND+R+F G+LG E SDD L++ FS YPSF+KA V+ DK+TG+ +G+GF+SF +  D+ +A +E NGKYVG+RPIKL +S W  RQ
Sbjct:  228 ASRLTLLDTSVAPPMRSKASLTEEPYSFQKKVYKRVAAGMVWEDPTLSDWDPNDFRIFCGDLGNEVSDDTLIRAFSRYPSFRKAKVIVDKRTGKSRGYGFVSFSDPNDFTRAMREMNGKYVGNRPIKLKKSDWRNRQ 364          
BLAST of RNA binding protein 42 vs. TrEMBL
Match: A0A1U7WHY4 (RNA-binding protein 42-like isoform X1 OS=Nicotiana sylvestris OX=4096 GN=LOC104228734 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.213e-40
Identity = 67/136 (49.26%), Postives = 92/136 (67.65%), Query Frame = 2
Query:  404 VSSTVLIRDAEMAQHVMQKRALESRV-VTKSALKRIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            V+ T+     E  +  +    +E +    K A+ R A G+ W DPT+ADW +NDYR+F GNLG E +DD+L+K FS +PSF  A VVRDK+TG+ KG+GF+SF N  D + A KE NGKYVG+RP++L +SKW+ R
Sbjct:   72 VAQTITPEAIENVKAALANSEIEQKAEAKKKAVPRKAAGQTWEDPTLADWPENDYRIFCGNLGNEVNDDVLLKAFSRFPSFNMARVVRDKRTGKTKGYGFVSFSNPSDLVTALKEMNGKYVGNRPVQLRKSKWQDR 207          
BLAST of RNA binding protein 42 vs. TrEMBL
Match: A0A1S3XWL1 (RNA-binding protein 42-like OS=Nicotiana tabacum OX=4097 GN=LOC107769551 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.213e-40
Identity = 67/136 (49.26%), Postives = 92/136 (67.65%), Query Frame = 2
Query:  404 VSSTVLIRDAEMAQHVMQKRALESRV-VTKSALKRIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            V+ T+     E  +  +    +E +    K A+ R A G+ W DPT+ADW +NDYR+F GNLG E +DD+L+K FS +PSF  A VVRDK+TG+ KG+GF+SF N  D + A KE NGKYVG+RP++L +SKW+ R
Sbjct:   72 VAQTITPEAIENVKAALANSEIEQKAEAKKKAVPRKAAGQTWEDPTLADWPENDYRIFCGNLGNEVNDDVLLKAFSRFPSFNMARVVRDKRTGKTKGYGFVSFSNPSDLVTALKEMNGKYVGNRPVQLRKSKWQDR 207          
BLAST of RNA binding protein 42 vs. Ensembl Cavefish
Match: rbm42 (RNA binding motif protein 42 [Source:NCBI gene;Acc:103034983])

HSP 1 Score: 140.198 bits (352), Expect = 3.375e-38
Identity = 57/102 (55.88%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R A G  W D ++++WD +D+R+F G+LG E +DD+L + FS YPSF KA VVRDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R
Sbjct:  264 RTAAGTTWEDTSLSEWDTDDFRIFCGDLGNEVNDDILARAFSRYPSFLKAKVVRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKLRKSMWKDR 365          
BLAST of RNA binding protein 42 vs. Ensembl Cavefish
Match: rbm42 (RNA binding motif protein 42 [Source:NCBI gene;Acc:103034983])

HSP 1 Score: 140.584 bits (353), Expect = 4.357e-38
Identity = 57/102 (55.88%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R A G  W D ++++WD +D+R+F G+LG E +DD+L + FS YPSF KA VVRDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R
Sbjct:  291 RTAAGTTWEDTSLSEWDTDDFRIFCGDLGNEVNDDILARAFSRYPSFLKAKVVRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKLRKSMWKDR 392          
BLAST of RNA binding protein 42 vs. Ensembl Cavefish
Match: rbm42 (RNA binding motif protein 42 [Source:NCBI gene;Acc:103034983])

HSP 1 Score: 140.198 bits (352), Expect = 1.355e-37
Identity = 57/102 (55.88%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R A G  W D ++++WD +D+R+F G+LG E +DD+L + FS YPSF KA VVRDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W+ R
Sbjct:  334 RTAAGTTWEDTSLSEWDTDDFRIFCGDLGNEVNDDILARAFSRYPSFLKAKVVRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKLRKSMWKDR 435          
BLAST of RNA binding protein 42 vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 63.929 bits (154), Expect = 2.977e-11
Identity = 33/85 (38.82%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  557 NDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            N + +FVG+L  E S D +   F+ +     A VV+D  TG+ KG+GFISF N  D   A ++ NG+++G R I   R+ W  R+
Sbjct:   93 NHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQI---RTNWATRK 174          
BLAST of RNA binding protein 42 vs. Ensembl Cavefish
Match: cirbpa (cold inducible RNA binding protein a [Source:ZFIN;Acc:ZDB-GENE-050417-329])

HSP 1 Score: 61.2326 bits (147), Expect = 4.489e-11
Identity = 27/73 (36.99%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            +LF+G L ++ ++  L + FS Y      HV R+++T R +GFGF++F N +D   A +  NGK V  R I++
Sbjct:    6 KLFIGGLSFDTTEQSLEEAFSKYGVITNVHVARNRETNRSRGFGFVTFENPDDAKDALEGMNGKSVDGRAIRV 78          
BLAST of RNA binding protein 42 vs. Ensembl Sea Lamprey
Match: rbm42 (RNA binding motif protein 42 [Source:NCBI gene;Acc:445360])

HSP 1 Score: 130.568 bits (327), Expect = 1.396e-35
Identity = 56/107 (52.34%), Postives = 75/107 (70.09%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFN----GKYVGSRPIKLARSKWEKRQ 811
            R A G  W D ++ DWD ND+R+F G+LG E SDD L + FS YP+F +A VVRDK++G+ KG+GF+SF +  D+++A +E N    GKYVGSRPIKL +S W  R 
Sbjct:  216 RSAAGITWEDASLMDWDPNDFRIFCGDLGNEVSDDTLARAFSRYPTFLRAKVVRDKRSGKTKGYGFVSFKDPNDFVRAMREMNGVDAGKYVGSRPIKLRKSTWRDRN 322          
BLAST of RNA binding protein 42 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 62.003 bits (149), Expect = 5.869e-11
Identity = 27/84 (32.14%), Postives = 47/84 (55.95%), Query Frame = 2
Query:  536 TMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            TM        RL+VG+L +  ++D+L   F  +   +   ++ D  TGR +G+GF++F +AE   KA ++ NG  +  RP+K+ 
Sbjct:  250 TMQKSTAGPMRLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKALEQLNGFELAGRPMKVG 333          
BLAST of RNA binding protein 42 vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 58.9214 bits (141), Expect = 2.467e-10
Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 2
Query:  557 NDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            + Y +FVG+L  E S D L   F+ +     A VV+D  TG+ KG+GF+SF    D   A ++  G+++G R I   R+ W  R
Sbjct:    1 DHYHVFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQI---RTNWATR 81          
BLAST of RNA binding protein 42 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 59.6918 bits (143), Expect = 3.075e-10
Identity = 26/73 (35.62%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            RL+VG+L +  ++ +L+  F  +       ++ D +TGR KGFGFI+F +A+   KA ++ NG  +  RP+K+
Sbjct:  273 RLYVGSLHFNITEAMLMGIFEPFGKIDNIQLMMDPETGRSKGFGFITFSSADCAKKALEQLNGFELAGRPMKV 345          
BLAST of RNA binding protein 42 vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 58.9214 bits (141), Expect = 5.064e-10
Identity = 31/84 (36.90%), Postives = 51/84 (60.71%), Query Frame = 2
Query:  569 LFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRP--IKLARSKWEKRQY 814
            L+V NL    +D+ L K FS + +   A V+ ++  GR +GFGF+ F + E+  KA  E NG+ +GS+P  + LA+ K E++ +
Sbjct:  157 LYVKNLDDNINDERLWKEFSPFGTITSAKVMMEE--GRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEERKMH 238          

HSP 2 Score: 48.1358 bits (113), Expect = 1.460e-6
Identity = 27/85 (31.76%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  569 LFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEV 823
            +++ N G +  D+ L + F  Y     +  V   + G+ KGFGF+SF   ED  KA  E N K +  R I + R++ +  + TE+
Sbjct:   53 VYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTEL 137          
BLAST of RNA binding protein 42 vs. Ensembl Yeast
Match: NOP13 (Nucleolar protein found in preribosomal complexes; contains an RNA recognition motif (RRM); relative distribution to the nucleolus increases upon DNA replication stress [Source:SGD;Acc:S000005119])

HSP 1 Score: 65.0846 bits (157), Expect = 3.075e-12
Identity = 33/88 (37.50%), Postives = 49/88 (55.68%), Query Frame = 2
Query:  569 LFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA----RSKWEKRQYTE 820
            LFVGNL ++ +DDLL K F H     K  +   + +G+CKGF FI F N E    A K+ + + +  RP+++     RSK + R+  E
Sbjct:  241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDKSCRKIAGRPLRMEYGEDRSKRQVRKKVE 328          
BLAST of RNA binding protein 42 vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 64.6994 bits (156), Expect = 4.277e-12
Identity = 31/120 (25.83%), Postives = 57/120 (47.50%), Query Frame = 2
Query:  425 RDAEMAQHVMQKRALESRVVTKSALKRIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
             DA +A   +  + +E+ +V  +          W   +      + + LFVG+L     D+ L   F  +PS+   HV+ D +TG  +G+GF+SF + +D   A     G+ +  RP+++
Sbjct:  126 HDANIALQTLNGKQIENNIVKIN----------WAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRI 235          
BLAST of RNA binding protein 42 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 53.5286 bits (127), Expect = 1.474e-8
Identity = 24/72 (33.33%), Postives = 40/72 (55.56%), Query Frame = 2
Query:  569 LFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            LF+GNL + A  D + + F+ +       +    +T + KGFG++ F N ED  KA     G+Y+ +RP++L
Sbjct:  269 LFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340          

HSP 2 Score: 51.2174 bits (121), Expect = 8.853e-8
Identity = 25/70 (35.71%), Postives = 37/70 (52.86%), Query Frame = 2
Query:  569 LFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPI 778
            +FVG L +   D+ L K F H      A V+ ++ T R +G+G++ F N     KA +E  GK +  RPI
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPI 239          
BLAST of RNA binding protein 42 vs. Ensembl Yeast
Match: MIP6 (Putative RNA-binding protein; interacts with Mex67p, which is a component of the nuclear pore involved in nuclear mRNA export; MIP6 has a paralog, PES4, that arose from the whole genome duplication [Source:SGD;Acc:S000001057])

HSP 1 Score: 53.9138 bits (128), Expect = 1.721e-8
Identity = 26/72 (36.11%), Postives = 41/72 (56.94%), Query Frame = 2
Query:  569 LFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            LF+GNL    ++++L K F  Y SF+ A V RD  T +  G+G+++F +  D   A KEFN      + +K+
Sbjct:  113 LFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKI 184          
BLAST of RNA binding protein 42 vs. Ensembl Yeast
Match: NAM8 (RNA binding protein, component of the U1 snRNP protein; mutants are defective in meiotic recombination and in formation of viable spores, involved in the formation of DSBs through meiosis-specific splicing of REC107 pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA binding domains RRM2 and RRM3 are required for Nam8p meiotic function [Source:SGD;Acc:S000001128])

HSP 1 Score: 52.373 bits (124), Expect = 4.047e-8
Identity = 26/86 (30.23%), Postives = 47/86 (54.65%), Query Frame = 2
Query:  557 NDYRLFVGNLGYEASDDLLVKTF-SHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            N+  +FVG+L    ++  L + F + Y S   A +V D+ TG  KG+GF+ F N+++   A  E  G ++  R IK+  +  +++ 
Sbjct:  161 NNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAIKVGPTSGQQQH 246          
BLAST of RNA binding protein 42 vs. Ensembl Nematostella
Match: EDO39989 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H9])

HSP 1 Score: 130.954 bits (328), Expect = 7.748e-38
Identity = 54/103 (52.43%), Postives = 78/103 (75.73%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            R+AGG+VW D ++A WD ND+R+F G+LG E +D+ L + F+ Y SF KA +VRDKK+ + KG+GF+SF +  D++KA +E NGKY+GSRP+KL +S W+ R 
Sbjct:    7 RVAGGQVWEDASLAQWDPNDFRIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKDPNDFIKAMREMNGKYIGSRPVKLRKSTWKDRN 109          
BLAST of RNA binding protein 42 vs. Ensembl Nematostella
Match: EDO29724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2U1])

HSP 1 Score: 63.1586 bits (152), Expect = 6.999e-13
Identity = 29/79 (36.71%), Postives = 49/79 (62.03%), Query Frame = 2
Query:  560 DYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSK 796
            +YR ++GNL Y   +  L + F H        V+ D++TGR +GFGF++FG+ E+  KA  EF+G+    RP+K+ +++
Sbjct:    4 EYRCYIGNLSYSVDEQALEEKF-HGCDVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKVNQAQ 81          
BLAST of RNA binding protein 42 vs. Ensembl Nematostella
Match: EDO35156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMB2])

HSP 1 Score: 62.7734 bits (151), Expect = 8.740e-13
Identity = 29/79 (36.71%), Postives = 49/79 (62.03%), Query Frame = 2
Query:  560 DYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSK 796
            +YR ++GNL Y   +  L + F H        V+ D++TGR +GFGF++FG+ E+  KA  EF+G+    RP+K+ +++
Sbjct:    4 EYRCYIGNLSYSVDEQALEEKF-HGCDVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKVNQAQ 81          
BLAST of RNA binding protein 42 vs. Ensembl Nematostella
Match: EDO29381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3T1])

HSP 1 Score: 61.2326 bits (147), Expect = 3.697e-12
Identity = 30/89 (33.71%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  530 DPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSK 796
            DP MA+      + ++GNL Y   +  L   F  Y +    +++ D++TGR +GFGF++FG+ E+  KA  EF+G+ +  RP+K+ +++
Sbjct:    1 DPEMAE-----NKCYIGNLSYSVDEQALEDKFHGY-NVVDVNIITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNKAQ 83          
BLAST of RNA binding protein 42 vs. Ensembl Nematostella
Match: EDO35150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMA3])

HSP 1 Score: 59.3066 bits (142), Expect = 2.601e-10
Identity = 27/84 (32.14%), Postives = 53/84 (63.10%), Query Frame = 2
Query:  545 DWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSK 796
            D +  +Y+ ++GNL Y   +  L + F  Y +     V+ D++TGR +GFGF++FG+ ++  KA  +F+G+ +  RP+K+ +++
Sbjct:  106 DLEMAEYKCYIGNLSYSVDEQALEEKFHGY-NVVDVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQ 188          
BLAST of RNA binding protein 42 vs. Ensembl Medaka
Match: ENSORLT00000004211.2 (RNA binding motif protein 42 [Source:NCBI gene;Acc:101168891])

HSP 1 Score: 137.502 bits (345), Expect = 5.451e-37
Identity = 56/102 (54.90%), Postives = 76/102 (74.51%), Query Frame = 2
Query:  503 RIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKR 808
            R A G  W D ++ +W+ +D+R+F G+LG E +DD+L + FS YPSF KA VVRDK+TG+ KG+GF+SF +  DY++A +E NGKYVGSRPIKL +S W  R
Sbjct:  284 RTAAGTTWEDQSLLEWESDDFRIFCGDLGNEVNDDILARAFSRYPSFLKAKVVRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKLRKSMWRDR 385          
BLAST of RNA binding protein 42 vs. Ensembl Medaka
Match: cirbpa (cold inducible RNA binding protein [Source:NCBI gene;Acc:101165004])

HSP 1 Score: 67.0106 bits (162), Expect = 3.672e-13
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            +LF+G L +E ++D L   F  Y + +K  V+RDK+TGR +GFGF+ + N ED   A    NGK +  R I++
Sbjct:    5 KLFIGGLSFETNEDSLAAAFGKYGTIEKVDVIRDKETGRSRGFGFVKYDNVEDAKDALDAMNGKTLDGRAIRV 77          
BLAST of RNA binding protein 42 vs. Ensembl Medaka
Match: cirbpa (cold inducible RNA binding protein [Source:NCBI gene;Acc:101165004])

HSP 1 Score: 67.0106 bits (162), Expect = 5.695e-13
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKL 784
            +LF+G L +E ++D L   F  Y + +K  V+RDK+TGR +GFGF+ + N ED   A    NGK +  R I++
Sbjct:    6 KLFIGGLSFETNEDSLAAAFGKYGTIEKVDVIRDKETGRSRGFGFVKYDNVEDAKDALDAMNGKTLDGRAIRV 78          
BLAST of RNA binding protein 42 vs. Ensembl Medaka
Match: ENSORLT00000012445.2 (RNA-binding protein 39 [Source:NCBI gene;Acc:101155103])

HSP 1 Score: 62.3882 bits (150), Expect = 1.715e-10
Identity = 27/74 (36.49%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            RL+VG+L +  ++D+L   F  +   +   ++ D +TGR KG+GFI+F +AE   KA ++ NG  +  RP+K+ 
Sbjct:  227 RLYVGSLHFNITEDMLRGIFEPFGRIENIQLMMDSETGRSKGYGFITFSDAECAKKALEQLNGFELAGRPMKVG 300          
BLAST of RNA binding protein 42 vs. Ensembl Medaka
Match: rbm39b (RNA-binding protein 39 [Source:NCBI gene;Acc:101167788])

HSP 1 Score: 61.6178 bits (148), Expect = 3.645e-10
Identity = 27/74 (36.49%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  566 RLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            RL+VG+L +  ++++L   F  +   +   ++ D +TGR KG+GFISF +AE   KA ++ NG  +  RP+K+ 
Sbjct:  230 RLYVGSLHFNITEEMLRGIFEPFGKIEGIQLMMDSETGRSKGYGFISFADAECAKKALEQLNGFELAGRPMKVG 303          
BLAST of RNA binding protein 42 vs. Planmine SMEST
Match: SMESG000027406.1 (SMESG000027406.1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.306e-9
Identity = 25/73 (34.25%), Postives = 43/73 (58.90%), Query Frame = 2
Query:  569 LFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            +FV NL  E  D  L + F  + + +   ++RD  T +CKGFGF++  N E+ L A +  NG  +G+R ++++
Sbjct:  305 IFVYNLAPETDDATLWQLFGPFGAVQTVKIIRDTATNKCKGFGFVTMSNYEEALLAIQSLNGFTLGNRILQVS 377          
BLAST of RNA binding protein 42 vs. Planmine SMEST
Match: SMESG000049916.1 (SMESG000049916.1)

HSP 1 Score: 58.151 bits (139), Expect = 3.731e-9
Identity = 30/101 (29.70%), Postives = 53/101 (52.48%), Query Frame = 2
Query:  494 ALKRIAGGEVWIDPTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSK 796
            +++ I      IDP       N Y L V NL  +  +  L +TF  + + +  ++ RD +TG+C+GFG I+  N  + L A +  NG  + +R +++A S+
Sbjct:  527 SIETIPTTTHLIDP------NNLYCLVVYNLSPDTKEATLWQTFGPFGAVQSVNLARDPQTGKCRGFGLITMPNYHEALLAIQHLNGNSLDNRALQIAFSQ 621          
BLAST of RNA binding protein 42 vs. Planmine SMEST
Match: SMESG000073709.1 (SMESG000073709.1)

HSP 1 Score: 57.3806 bits (137), Expect = 5.074e-9
Identity = 26/85 (30.59%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  557 NDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            N Y +FVG++  E     L + FS +    +  +++D  T + KG+GF+++   E+  +A  + NGK++G+R I   R+ W  R+
Sbjct:  106 NHYHIFVGDIAPEIETQFLRERFSLFGRVTECKIIKDMHTQKPKGYGFVAYATKEEAEEALNKMNGKFLGTRQI---RTNWAIRR 187          
BLAST of RNA binding protein 42 vs. Planmine SMEST
Match: SMESG000073709.1 (SMESG000073709.1)

HSP 1 Score: 57.3806 bits (137), Expect = 5.330e-9
Identity = 26/85 (30.59%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  557 NDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQ 811
            N Y +FVG++  E     L + FS +    +  +++D  T + KG+GF+++   E+  +A  + NGK++G+R I   R+ W  R+
Sbjct:  111 NHYHIFVGDIAPEIETQFLRERFSLFGRVTECKIIKDMHTQKPKGYGFVAYATKEEAEEALNKMNGKFLGTRQI---RTNWAIRR 192          
BLAST of RNA binding protein 42 vs. Planmine SMEST
Match: SMESG000081081.1 (SMESG000081081.1)

HSP 1 Score: 57.3806 bits (137), Expect = 6.149e-9
Identity = 24/75 (32.00%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  563 YRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGRCKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLA 787
            + +FV NL  E  +  L + F  + + +   +VRD  T +CKGFGF++  N E+ L + +  NG  +G+R ++++
Sbjct:  338 WCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVS 412          
The following BLAST results are available for this feature:
BLAST of RNA binding protein 42 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBM423.369e-3753.27RNA binding motif protein 42 [Source:HGNC Symbol;A... [more]
RBM426.099e-3753.27RNA binding motif protein 42 [Source:HGNC Symbol;A... [more]
RBM426.822e-3753.27RNA binding motif protein 42 [Source:HGNC Symbol;A... [more]
RBM427.608e-3753.27RNA binding motif protein 42 [Source:HGNC Symbol;A... [more]
RBM421.359e-1660.38RNA binding motif protein 42 [Source:HGNC Symbol;A... [more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm-421.463e-4056.86RNA Binding Motif protein homolog [Source:UniProt... [more]
tiar-32.137e-1236.05TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-14.113e-932.53TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-14.634e-932.53TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-19.174e-932.53TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG29311.062e-3854.90gene:FBgn0037342 transcript:FBtr0078753[more]
CstF641.272e-1033.72gene:FBgn0027841 transcript:FBtr0083660[more]
Caper1.601e-935.14gene:FBgn0031883 transcript:FBtr0089640[more]
Caper1.601e-935.14gene:FBgn0031883 transcript:FBtr0089636[more]
pAbp2.583e-940.48gene:FBgn0265297 transcript:FBtr0086738[more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm428.234e-3753.92RNA binding motif protein 42 [Source:NCBI gene;Acc... [more]
cirbpb4.183e-1241.10cold inducible RNA binding protein b [Source:ZFIN;... [more]
cirbpb9.675e-1241.10cold inducible RNA binding protein b [Source:ZFIN;... [more]
cirbpb1.023e-1141.10cold inducible RNA binding protein b [Source:ZFIN;... [more]
tia1l2.278e-1140.00cytotoxic granule-associated RNA binding protein 1... [more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
corin1.727e-3652.94corin, serine peptidase [Source:Xenbase;Acc:XB-GEN... [more]
corin1.965e-3652.94corin, serine peptidase [Source:Xenbase;Acc:XB-GEN... [more]
corin4.025e-3652.94corin, serine peptidase [Source:Xenbase;Acc:XB-GEN... [more]
ero1a4.432e-1038.82endoplasmic reticulum oxidoreductase alpha [Source... [more]
RBM235.181e-1035.14RNA binding motif protein 23 [Source:NCBI gene;Acc... [more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbm422.123e-3753.27RNA binding motif protein 42 [Source:MGI Symbol;Ac... [more]
Rbm422.208e-3753.27RNA binding motif protein 42 [Source:MGI Symbol;Ac... [more]
Cirbp3.909e-1138.36cold inducible RNA binding protein [Source:MGI Sym... [more]
Rbm395.368e-1035.14RNA binding motif protein 39 [Source:MGI Symbol;Ac... [more]
Rbm395.924e-1035.14RNA binding motif protein 39 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of RNA binding protein 42 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AXT7|RBM42_RAT1.411e-3653.27RNA-binding protein 42 OS=Rattus norvegicus OX=101... [more]
sp|Q91V81|RBM42_MOUSE1.485e-3653.27RNA-binding protein 42 OS=Mus musculus OX=10090 GN... [more]
sp|A2VDB3|RBM42_XENLA1.633e-3653.92RNA-binding protein 42 OS=Xenopus laevis OX=8355 G... [more]
sp|Q0P5L0|RBM42_BOVIN1.774e-3653.85RNA-binding protein 42 OS=Bos taurus OX=9913 GN=RB... [more]
sp|Q9BTD8|RBM42_HUMAN3.276e-3653.27RNA-binding protein 42 OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of RNA binding protein 42 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U6JQM13.458e-4238.99RNA-binding protein 42 OS=Echinococcus granulosus ... [more]
W7XFT11.908e-4050.38RNA-binding protein 42 (RBM42)-like RNA recognitio... [more]
A0A068Y5992.772e-4048.91RNA binding protein 42 OS=Echinococcus multilocula... [more]
A0A1U7WHY43.213e-4049.26RNA-binding protein 42-like isoform X1 OS=Nicotian... [more]
A0A1S3XWL13.213e-4049.26RNA-binding protein 42-like OS=Nicotiana tabacum O... [more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm423.375e-3855.88RNA binding motif protein 42 [Source:NCBI gene;Acc... [more]
rbm424.357e-3855.88RNA binding motif protein 42 [Source:NCBI gene;Acc... [more]
rbm421.355e-3755.88RNA binding motif protein 42 [Source:NCBI gene;Acc... [more]
tia1l2.977e-1138.82TIA1 cytotoxic granule associated RNA binding prot... [more]
cirbpa4.489e-1136.99cold inducible RNA binding protein a [Source:ZFIN;... [more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm421.396e-3552.34RNA binding motif protein 42 [Source:NCBI gene;Acc... [more]
RBM395.869e-1132.14RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
tia1l2.467e-1036.90cytotoxic granule-associated RNA binding protein 1... [more]
RBM393.075e-1035.62RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
pabpc45.064e-1036.90poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NOP133.075e-1237.50Nucleolar protein found in preribosomal complexes;... [more]
PUB14.277e-1225.83Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NSR11.474e-833.33Nucleolar protein that binds nuclear localization ... [more]
MIP61.721e-836.11Putative RNA-binding protein; interacts with Mex67... [more]
NAM84.047e-830.23RNA binding protein, component of the U1 snRNP pro... [more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399897.748e-3852.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297246.999e-1336.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351568.740e-1336.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293813.697e-1233.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351502.601e-1032.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA binding protein 42 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000004211.25.451e-3754.90RNA binding motif protein 42 [Source:NCBI gene;Acc... [more]
cirbpa3.672e-1341.10cold inducible RNA binding protein [Source:NCBI ge... [more]
cirbpa5.695e-1341.10cold inducible RNA binding protein [Source:NCBI ge... [more]
ENSORLT00000012445.21.715e-1036.49RNA-binding protein 39 [Source:NCBI gene;Acc:10115... [more]
rbm39b3.645e-1036.49RNA-binding protein 39 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of RNA binding protein 42 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027406.11.306e-934.25SMESG000027406.1[more]
SMESG000049916.13.731e-929.70SMESG000049916.1[more]
SMESG000073709.15.074e-930.59SMESG000073709.1[more]
SMESG000073709.15.330e-930.59SMESG000073709.1[more]
SMESG000081081.16.149e-932.00SMESG000081081.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024244 ID=SMED30024244|Name=RNA binding protein 42|organism=Schmidtea mediterranea sexual|type=transcript|length=983bp
CTTAATATTAAAATTTTTTGTATAAATCAATTACTTAACATAAAACTAAC
TAGTCCTATTATTCTTTTATCATTAAAAGACAATGATTGTTCCAAATAAA
GTGAAACAGCAACCTAAAAAGACTTCGACTTCTAAGTCATCTGCAAGTAC
TACTAATAGTAGTCGATCAGATATGGATGATGTCATGTCAGCTTTATTAG
CAGCCGAAAAAGGAATTGTAAAAATTTCAACTAAGACTTCAGTAGCTCCA
CAAGACAATCCTAATAAGAAGAAAATTATACCTCAATCTAAAGAAGTTCT
ACCTCAGCCAGCTCCAGTATATGTTCCAAAAGCACCGGAAATTAATCAAA
TGTATCATCAATCTAATGTAATACCCCCTCCACCACCGCCCCCTCCACTC
CCCGTTTCATCCACTGTTCTCATAAGAGATGCTGAAATGGCCCAACATGT
AATGCAAAAAAGAGCTTTGGAAAGTCGAGTCGTGACTAAATCAGCTCTTA
AAAGAATAGCTGGTGGTGAAGTTTGGATTGATCCTACAATGGCTGATTGG
GATAAAAATGATTATCGATTGTTTGTTGGTAATTTAGGTTACGAGGCATC
AGATGATTTACTTGTAAAAACATTTAGTCATTATCCTTCTTTCAAAAAGG
CTCATGTTGTAAGAGATAAAAAAACTGGTAGATGCAAGGGTTTCGGATTC
ATTAGTTTCGGGAATGCAGAAGACTATTTAAAAGCGACAAAAGAATTTAA
TGGAAAATATGTAGGTAGCAGACCCATTAAGTTGGCTAGGTCCAAATGGG
AAAAGCGACAGTACACTGAAGTATCTAAAGAAGAAAAGAAGAAGAAGAAA
TTAGAAAAAATTCTCAAGAGTTAATTCACAGCTTGTGTATAATTTTATTT
TGTTATTTGAAAACAATAATAAACTAGTTTTATTCTATTTGCTGTAAATA
TATGCTTTTAATGTATTGTCATTTAATTATGTG
back to top

protein sequence of SMED30024244-orf-1

>SMED30024244-orf-1 ID=SMED30024244-orf-1|Name=SMED30024244-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=264bp
MIVPNKVKQQPKKTSTSKSSASTTNSSRSDMDDVMSALLAAEKGIVKIST
KTSVAPQDNPNKKKIIPQSKEVLPQPAPVYVPKAPEINQMYHQSNVIPPP
PPPPPLPVSSTVLIRDAEMAQHVMQKRALESRVVTKSALKRIAGGEVWID
PTMADWDKNDYRLFVGNLGYEASDDLLVKTFSHYPSFKKAHVVRDKKTGR
CKGFGFISFGNAEDYLKATKEFNGKYVGSRPIKLARSKWEKRQYTEVSKE
EKKKKKLEKILKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding