neurexin-2-like

Overview
Nameneurexin-2-like
Smed IDSMED30024216
Length (bp)3544
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of neurexin-2-like (SMED30024216) t-SNE clustered cells

Violin plots show distribution of expression levels for neurexin-2-like (SMED30024216) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of neurexin-2-like (SMED30024216) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for neurexin-2-like (SMED30024216) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024216

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024216SMESG000054585.1 SmedASXL_014287SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30024216SMESG000054585.1 SmedASXL_007840SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30024216SMESG000054585.1 dd_Smed_v4_23270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024216SMESG000054585.1 dd_Smed_v4_23270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30024216SMESG000054585.1 dd_Smed_v4_23270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30024216SMESG000054585.1 dd_Smed_v4_23270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024216SMESG000054585.1 dd_Smed_v6_23270_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of neurexin-2-like vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 311.227 bits (796), Expect = 6.479e-87
Identity = 278/1119 (24.84%), Postives = 486/1119 (43.43%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRS---FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +        ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  V+            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+D S   +ER     GR    FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  288 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEVQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVD-SWPVIER--YPAGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1277          

HSP 2 Score: 60.077 bits (144), Expect = 2.812e-8
Identity = 79/338 (23.37%), Postives = 140/338 (41.42%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG-IKLSFNM--GSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP---RYEYQKWT-EYIFSNYGFQGCIAGFSINGKK--PINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCT------------------KVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            ++F LKT    G++L        DFL + L  GG ++LSF++       +L D       + D  WH + I R    RN  +L ID+V  + V + +  K ++       ++GG+P   R    K T   +     F+G I    +N  +  P++  +  + + P    S     C++     +   C NGG C    +QA CDCS T F G+ C+                  K      +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADT-----PVNDGAWHSVRIRRQ--FRNT-TLFIDQVEAKWVEVKS--KRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPP--NSGGGSPCEAGEEG-EGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTR 374          
BLAST of neurexin-2-like vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 305.064 bits (780), Expect = 7.711e-85
Identity = 279/1146 (24.35%), Postives = 488/1146 (42.58%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVY-SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +        ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  V+            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  288 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEVQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1307          

HSP 2 Score: 60.077 bits (144), Expect = 3.314e-8
Identity = 79/338 (23.37%), Postives = 140/338 (41.42%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG-IKLSFNM--GSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP---RYEYQKWT-EYIFSNYGFQGCIAGFSINGKK--PINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCT------------------KVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            ++F LKT    G++L        DFL + L  GG ++LSF++       +L D       + D  WH + I R    RN  +L ID+V  + V + +  K ++       ++GG+P   R    K T   +     F+G I    +N  +  P++  +  + + P    S     C++     +   C NGG C    +QA CDCS T F G+ C+                  K      +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADT-----PVNDGAWHSVRIRRQ--FRNT-TLFIDQVEAKWVEVKS--KRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPP--NSGGGSPCEAGEEG-EGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTR 374          
BLAST of neurexin-2-like vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 305.064 bits (780), Expect = 8.287e-85
Identity = 278/1141 (24.36%), Postives = 485/1141 (42.51%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +        ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  V+            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  288 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEVQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1299          

HSP 2 Score: 118.627 bits (296), Expect = 3.887e-26
Identity = 152/722 (21.05%), Postives = 295/722 (40.86%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE----------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN-------------DFLLMELIHGGIKLSFNMGS---TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIK----------VSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGR-SFN--EQSII----YIGASPIKKEGKQFVGLISGLIFNGI 3345
            C N G C     +  C+C  T ++G+ C++    +E                      F GSE+   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   L +  D + K+   V   A   ++V     +TF TP++++ + K +   + S++F  +T + +G++L   G                DF  +E++ G + L  +MGS    ++ L    +      D +W+      +D  R+  S +I  V           +++  + D   YLGG+P       +  + WT  +  NYG+ GCI    I+G+   ++ Q + V+     K   +   +     C  N CKN G C   + +  CDCS T + GR C + +  +++   +    ++++Q      +T  +D++   ++++  G  I + +  +D  D + L L+ G++ L  ++    +++   S K          ++D  +  VRV R G S  L +D+ ++   +   +  R  F+  E  II    Y+ + P       F+G +  L FNG+
Sbjct:  228 CLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV---AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVN------DGEWY-----HVDFQRDGRSGTI-SVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALL--NYGYVGCIRDLFIDGQSK-DIRQMAEVQSTAGVKPSCS---KETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSM----FMKIQLP-VVMHTEAEDVSLRFRSQRAYG--ILMATTSRDSADTLRLELDAGRVKLTVNLDC--IRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVP-----SNFIGHLQSLTFNGM 869          

HSP 3 Score: 61.2326 bits (147), Expect = 1.285e-8
Identity = 85/379 (22.43%), Postives = 153/379 (40.37%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG-IKLSFNM--GSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP---RYEYQKWT-EYIFSNYGFQGCIAGFSINGKK--PINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCT------------------KVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLNLGRSFNEQSIIYIGASP 3285
            ++F LKT    G++L        DFL + L  GG ++LSF++       +L D       + D  WH + I R    RN  +L ID+V  + V + +  K ++       ++GG+P   R    K T   +     F+G I    +N  +  P++  +  + + P    S     C++     +   C NGG C    +QA CDCS T F G+ C+                  K      +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R      + +D   + +   + D  +          Y+G SP
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADT-----PVNDGAWHSVRIRRQ--FRNT-TLFIDQVEAKWVEVKS--KRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPP--NSGGGSPCEAGEEG-EGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTM---LGSDDFFYVGGSP 412          
BLAST of neurexin-2-like vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 305.064 bits (780), Expect = 8.394e-85
Identity = 278/1141 (24.36%), Postives = 485/1141 (42.51%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +        ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  V+            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  284 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEVQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1295          

HSP 2 Score: 120.168 bits (300), Expect = 1.254e-26
Identity = 152/718 (21.17%), Postives = 295/718 (41.09%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN-------------DFLLMELIHGGIKLSFNMGS---TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIK----------VSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGR-SFN--EQSII----YIGASPIKKEGKQFVGLISGLIFNGI 3345
            C N G C     +  C+C  T ++G+ C++    +E                  F GSE+   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   L +  D + K+   V   A   ++V     +TF TP++++ + K +   + S++F  +T + +G++L   G                DF  +E++ G + L  +MGS    ++ L    +      D +W+      +D  R+  S +I  V           +++  + D   YLGG+P       +  + WT  +  NYG+ GCI    I+G+   ++ Q + V+     K   +   +     C  N CKN G C   + +  CDCS T + GR C + +  +++   +    ++++Q      +T  +D++   ++++  G  I + +  +D  D + L L+ G++ L  ++    +++   S K          ++D  +  VRV R G S  L +D+ ++   +   +  R  F+  E  II    Y+ + P       F+G +  L FNG+
Sbjct:  228 CLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV---AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVN------DGEWY-----HVDFQRDGRSGTI-SVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALL--NYGYVGCIRDLFIDGQSK-DIRQMAEVQSTAGVKPSCS---KETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSM----FMKIQLP-VVMHTEAEDVSLRFRSQRAYG--ILMATTSRDSADTLRLELDAGRVKLTVNLDC--IRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVP-----SNFIGHLQSLTFNGM 865          

HSP 3 Score: 62.7734 bits (151), Expect = 4.242e-9
Identity = 84/375 (22.40%), Postives = 154/375 (41.07%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG-IKLSFNM--GSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP---RYEYQKWT-EYIFSNYGFQGCIAGFSINGKK--PINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATI--------------NFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLNLGRSFNEQSIIYIGASP 3285
            ++F LKT    G++L        DFL + L  GG ++LSF++       +L D       + D  WH + I R    RN  +L ID+V  + V + +  K ++       ++GG+P   R    K T   +     F+G I    +N  +  P++  +  + + P    S     C++     +   C NGG C    +QA CDCS T F G+ C++    +               +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R      + +D   + +   + D  +          Y+G SP
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADT-----PVNDGAWHSVRIRRQ--FRNT-TLFIDQVEAKWVEVKS--KRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPP--NSGGGSPCEAGEEG-EGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTM---LGSDDFFYVGGSP 408          
BLAST of neurexin-2-like vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 305.064 bits (780), Expect = 8.984e-85
Identity = 278/1141 (24.36%), Postives = 485/1141 (42.51%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +        ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  V+            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  288 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEVQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1299          

HSP 2 Score: 118.627 bits (296), Expect = 3.983e-26
Identity = 152/722 (21.05%), Postives = 295/722 (40.86%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE----------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN-------------DFLLMELIHGGIKLSFNMGS---TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIK----------VSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGR-SFN--EQSII----YIGASPIKKEGKQFVGLISGLIFNGI 3345
            C N G C     +  C+C  T ++G+ C++    +E                      F GSE+   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   L +  D + K+   V   A   ++V     +TF TP++++ + K +   + S++F  +T + +G++L   G                DF  +E++ G + L  +MGS    ++ L    +      D +W+      +D  R+  S +I  V           +++  + D   YLGG+P       +  + WT  +  NYG+ GCI    I+G+   ++ Q + V+     K   +   +     C  N CKN G C   + +  CDCS T + GR C + +  +++   +    ++++Q      +T  +D++   ++++  G  I + +  +D  D + L L+ G++ L  ++    +++   S K          ++D  +  VRV R G S  L +D+ ++   +   +  R  F+  E  II    Y+ + P       F+G +  L FNG+
Sbjct:  228 CLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV---AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVN------DGEWY-----HVDFQRDGRSGTI-SVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALL--NYGYVGCIRDLFIDGQSK-DIRQMAEVQSTAGVKPSCS---KETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSM----FMKIQLP-VVMHTEAEDVSLRFRSQRAYG--ILMATTSRDSADTLRLELDAGRVKLTVNLDC--IRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVP-----SNFIGHLQSLTFNGM 869          

HSP 3 Score: 61.2326 bits (147), Expect = 1.421e-8
Identity = 85/379 (22.43%), Postives = 153/379 (40.37%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG-IKLSFNM--GSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP---RYEYQKWT-EYIFSNYGFQGCIAGFSINGKK--PINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCT------------------KVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLNLGRSFNEQSIIYIGASP 3285
            ++F LKT    G++L        DFL + L  GG ++LSF++       +L D       + D  WH + I R    RN  +L ID+V  + V + +  K ++       ++GG+P   R    K T   +     F+G I    +N  +  P++  +  + + P    S     C++     +   C NGG C    +QA CDCS T F G+ C+                  K      +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R      + +D   + +   + D  +          Y+G SP
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADT-----PVNDGAWHSVRIRRQ--FRNT-TLFIDQVEAKWVEVKS--KRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPP--NSGGGSPCEAGEEG-EGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTM---LGSDDFFYVGGSP 412          
BLAST of neurexin-2-like vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 160.999 bits (406), Expect = 1.604e-39
Identity = 254/1119 (22.70%), Postives = 451/1119 (40.30%), Query Frame = 1
Query:  166 ASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGI-FNDNQWHKVKFIRSL---NKAQKGYDLKIVIE--EDDIIIYKKSFSTLSLFVKTRFLSIGGLS--NPVFRMK--NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFH--RSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFII-FNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQ----SNLT--IKGCYTSTISPSECSKLK-SKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWK-SINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHK---LHLYGSFSLAFYLKTNQKDGVLLMISGTSNDF---LLMELIHGGIKLSFNM-GSTVQILTDNCHGSCSLADNKWHLLEISR--------LDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTR-NTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELER----TDLNLGRSFNEQSIIYIGASPIKKEGKQ---------------FVGLISGLIFNGIKI 3351
            A++    E L + FKT  G  +LFY+GD      V      +I   K       F  SD +      I++ N +    ++D+ WH +   RSL   ++      + ++++   D+I  Y         ++   F  +G +   NP   +   +F GC+ KV Y  D   + +++   +  +G S +      S +C+   +  + +SF   +S++ L  +        L   F+  ++  +I +H     N   +++ E  D  L + I++   VV    +   + +      H+ +D      +L     + V+   I F+T     +L  + +  I +GN    N+   +PS VW   L+KG+ GCI+ + +N          +S K+ Q    SN T    GC  S       ++L   + +PC N G C        C+C  TN++G+ C     A+E +G E     L     ++VE I IRF T    G L        +   +  I + + +  L L +Q  S    F    ++SD  WH L + R  + L L LDG                  W  SI +        +  +S +   +GA+      H + P  P+                +F G ++KL  N     +DY+   +++  Q  K  ++ +      K  + S++F     Y+         L GSF + F  +T  +   LL  +   +D+     +++++G +K ++   G      +        L+D +WH + I +        L +  +  +L IDK  I++V    S K          Y G  P    +       SN GF+GCI+   IN +  ++L + +   +      ++   C   +  C ++ C N G+C+Q +    CDCS T   G  C   S T+ F     S + I  ++    R  TS+D   F  +T + +G +I +E       D+  +FL  G +   Y++G      +  +  ++DGF   +++ R  ++  +Q+D   S   R    +DL L    N Q+ I IGA+   +   Q               + G ISG+  NG+ I
Sbjct:  290 AAVRAKKENLTLTFKTVHGTSMLFYAGDEKSYLHVMLQDGAIIASSK-------FDGSDARI-----IRMFNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGRRDEIRQYAPELD----WISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQS-YGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLP-RWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRL--QTTSMKVSDGEWHHVQLD------RLSRTGSVIVDAIKIDFSTPGVSANL--IIDDPIFIGN--VPNNSLVYPSSVWSIALQKGYTGCIKNIRMNG---------VSTKIGQEFEASNSTGIELGCSLS-------NELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTG----ANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLDG-----------------FWSHSIYL--------QNPISVEIDEVGAAFS---VHSSAP-PPR--------------DEHFKGFLSKLVFNG----NDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMR-SALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQHLSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDK--IKKVESKMSGK---------LYFGSNPLGVSRP------SN-GFRGCISTLRIN-ENALDLYEDADSRM------KVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFD---GSPSAIFYEYAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQ--DYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVL---LNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMI 1277          

HSP 2 Score: 125.176 bits (313), Expect = 1.587e-28
Identity = 158/705 (22.41%), Postives = 298/705 (42.27%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRIC--NKGTRAIEFDGSEFIRLDLGTEFYTEV----ESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ-PQSERQIFKLTNNVS-----DGQWHSLIISRNNRA---------LSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-----KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLL---MISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR----YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFC--TKVSATINFRR---------QVASNNYIQLQFQDRTRNTSRDDIAFGLQTR-KLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLN-----LGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNG 3342
            C N G C +      C+C F+++ GR C   K    + F G E++  D+       V    E++ + F T++ T  L       ++    S + + +++G +I   +   S+ +I ++ N+       D  WH++I+ R+ +          ++L +DG+  + E+  ++ E   + W S + GF                +G+  K+N                     K+  + +F G + K+R    DI    ILL  L+D  +     K +  ++ +          ++F    +YL + + +   S SL+F+ +T   DG++L   ++   + D++  ELI   + +  N+GS V  L      S  ++D +WH +++ RL  + +V+   +D + I+  T   S    N   D P ++G +P     Y    W+  I    G+ GCI    +NG   ++       E  +    ++  +  + L IC+ N C+N G+C +      CDCS T FEG+ C   + +  +N            +V+   +I+++F    R TS   + F      K D   +F+   +      ++LFL++      +  G  +          SD  +  ++VRRLG    L +D   S S   +  ++     +G +F+    ++  A P + E   F G +S L+FNG
Sbjct:  236 CLNDGECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLF------YAGDEKSYLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGR--RDEIRQYAPE---LDWISNSFGF----------------LGSIPKHN-------------------PSKEVNRVSFRGCMKKVR---YDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTT---SMKVSDGEWHHVQLDRLSRTGSVI---VDAIKIDFSTPGVS---ANLIIDDPIFIGNVPNNSLVYPSSVWS--IALQKGYTGCIKNIRMNG---VSTKIGQEFEASNSTGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRF----RTTSSRGVLFDTGANGKNDKITVFLNDSQ------LNLFLQDSSTNNTFSWGKSL----------SDNHWHELQVRRLGQKLLLYLDGFWSHSIYLQNPISVEIDEVGAAFS----VHSSAPPPRDE--HFKGFLSKLVFNG 851          
BLAST of neurexin-2-like vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 160.614 bits (405), Expect = 1.943e-39
Identity = 255/1114 (22.89%), Postives = 446/1114 (40.04%), Query Frame = 1
Query:  166 ASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGI-FNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLS--NPVFRMK--NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFH--RSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFII-FNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQ----SNLT--IKGCYTSTISPSECSKLK-SKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWK-SINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHK---LHLYGSFSLAFYLKTNQKDGVLLMISGTSNDF---LLMELIHGGIKLSFNM-GSTVQILTDNCHGSCSLADNKWHLLEISR--------LDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTR-NTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELER----TDLNLGRSFNEQSIIYIGASPIKKEGKQ---------------FVGLISGLIFNGIKI 3351
            A++    E L + FKT  G  +LFY+GD      V      +I   K       F  SD +      I++ N +    ++D+ WH +   RSL        L +    D+I  Y         ++   F  +G +   NP   +   +F GC+ KV Y  D   + +++   +  +G S +      S +C+   +  + +SF   +S++ L  +        L   F+  ++  +I +H     N   +++ E  D  L + I++   VV    +   + +      H+ +D      +L     + V+   I F+T     +L  + +  I +GN    N+   +PS VW   L+KG+ GCI+ + +N          +S K+ Q    SN T    GC  S       ++L   + +PC N G C        C+C  TN++G+ C     A+E +G E     L     ++VE I IRF T    G L        +   +  I + + +  L L +Q  S    F    ++SD  WH L + R  + L L LDG                  W  SI +        +  +S +   +GA+      H + P  P+                +F G ++KL  N     +DY+   +++  Q  K  ++ +      K  + S++F     Y+         L GSF + F  +T  +   LL  +   +D+     +++++G +K ++   G      +        L+D +WH + I +        L +  +  +L IDK  I++V    S K          Y G  P    +       SN GF+GCI+   IN +  ++L + +   +      ++   C   +  C ++ C N G+C+Q +    CDCS T   G  C   S T+ F     S + I  ++    R  TS+D   F  +T + +G +I +E       D+  +FL  G +   Y++G      +  +  ++DGF   +++ R  ++  +Q+D   S   R    +DL L    N Q+ I IGA+   +   Q               + G ISG+  NG+ I
Sbjct:  290 AAVRAKKENLTLTFKTVHGTSMLFYAGDEKSYLHVMLQDGAIIASSK-------FDGSDARI-----IRMFNSFPSQRYDDDSWHTIILERSLQMMT----LIVDGRRDEIRQYAPELD----WISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQS-YGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLP-RWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRL--QTTSMKVSDGEWHHVQLD------RLSRTGSVIVDAIKIDFSTPGVSANL--IIDDPIFIGN--VPNNSLVYPSSVWSIALQKGYTGCIKNIRMNG---------VSTKIGQEFEASNSTGIELGCSLS-------NELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTG----ANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLDG-----------------FWSHSIYL--------QNPISVEIDEVGAAFS---VHSSAP-PPR--------------DEHFKGFLSKLVFNG----NDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMR-SALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQHLSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDK--IKKVESKMSGK---------LYFGSNPLGVSRP------SN-GFRGCISTLRIN-ENALDLYEDADSRM------KVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFD---GSPSAIFYEYAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQ--DYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVL---LNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMI 1268          

HSP 2 Score: 132.494 bits (332), Expect = 8.140e-31
Identity = 158/696 (22.70%), Postives = 298/696 (42.82%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRIC--NKGTRAIEFDGSEFIRLDLGTEFYTEV----ESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ-PQSERQIFKLTNNVS-----DGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-----KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLL---MISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR----YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFC--TKVSATINFRR---------QVASNNYIQLQFQDRTRNTSRDDIAFGLQTR-KLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLN-----LGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNG 3342
            C N G C +      C+C F+++ GR C   K    + F G E++  D+       V    E++ + F T++ T  L       ++    S + + +++G +I   +   S+ +I ++ N+       D  WH++I+ R+ + ++L +DG+  + E+  ++ E   + W S + GF                +G+  K+N                     K+  + +F G + K+R    DI    ILL  L+D  +     K +  ++ +          ++F    +YL + + +   S SL+F+ +T   DG++L   ++   + D++  ELI   + +  N+GS V  L      S  ++D +WH +++ RL  + +V+   +D + I+  T   S    N   D P ++G +P     Y    W+  I    G+ GCI    +NG   ++       E  +    ++  +  + L IC+ N C+N G+C +      CDCS T FEG+ C   + +  +N            +V+   +I+++F    R TS   + F      K D   +F+   +      ++LFL++      +  G  +          SD  +  ++VRRLG    L +D   S S   +  ++     +G +F+    ++  A P + E   F G +S L+FNG
Sbjct:  236 CLNDGECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLF------YAGDEKSYLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMMTLIVDGR--RDEIRQYAPE---LDWISNSFGF----------------LGSIPKHN-------------------PSKEVNRVSFRGCMKKVR---YDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTT---SMKVSDGEWHHVQLDRLSRTGSVI---VDAIKIDFSTPGVS---ANLIIDDPIFIGNVPNNSLVYPSSVWS--IALQKGYTGCIKNIRMNG---VSTKIGQEFEASNSTGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRF----RTTSSRGVLFDTGANGKNDKITVFLNDSQ------LNLFLQDSSTNNTFSWGKSL----------SDNHWHELQVRRLGQKLLLYLDGFWSHSIYLQNPISVEIDEVGAAFS----VHSSAPPPRDE--HFKGFLSKLVFNG 842          
BLAST of neurexin-2-like vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 160.229 bits (404), Expect = 2.680e-39
Identity = 254/1114 (22.80%), Postives = 447/1114 (40.13%), Query Frame = 1
Query:  166 ASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGI-FNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLS--NPVFRMK--NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFH--RSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFII-FNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQ----SNLT-IK-GCYTSTISPSECSKLK-SKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWK-SINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHK---LHLYGSFSLAFYLKTNQKDGVLLMISGTSNDF---LLMELIHGGIKLSFNM-GSTVQILTDNCHGSCSLADNKWHLLEISR--------LDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTR-NTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELER----TDLNLGRSFNEQSIIYIGASPIKKEGKQ---------------FVGLISGLIFNGIKI 3351
            A++    E L + FKT  G  +LFY+GD      V      +I   K       F  SD +      I++ N +    ++D+ WH +   RSL        L +    D+I  Y         ++   F  +G +   NP   +   +F GC+ KV Y  D   + +++   +  +G S +      S +C+   +  + +SF   +S++ L  +        L   F+  ++  +I +H     N   +++ E  D  L + I++   VV    +   + +      H+ +D      +L     + V+   I F+T     +L  + +  I +GN    N+   +PS VW   L+KG+ GCI+ + +N          +S K+ Q    SN T I+ GC  S       ++L   + +PC N G C        C+C  TN++G+ C     A+E +G E     L     ++VE I IRF T    G L        +   +  I + + +  L L +Q  S    F    ++SD  WH L + R  + L L LDG                  W  SI +        +  +S +   +GA+      H + P  P+                +F G ++KL  N     +DY+   +++  Q  K  ++ +      K  + S++F     Y+         L GSF + F  +T  +   LL  +   +D+     +++++G +K ++   G      +        L+D +WH + I +        L +  +  +L IDK  I++V    S K          Y G  P    +        + GF+GCI+   IN +  ++L + +   +      ++   C   +  C ++ C N G+C+Q +    CDCS T   G  C   S T+ F     S + I  ++    R  TS+D   F  +T + +G +I +E       D+  +FL  G +   Y++G      +  +  ++DGF   +++ R  ++  +Q+D   S   R    +DL L    N Q+ I IGA+   +   Q               + G ISG+  NG+ I
Sbjct:  290 AAVRAKKENLTLTFKTVHGTSMLFYAGDEKSYLHVMLQDGAIIASSK-------FDGSDARI-----IRMFNSFPSQRYDDDSWHTIILERSLQMMT----LIVDGRRDEIRQYAPELD----WISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQS-YGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLP-RWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRL--QTTSMKVSDGEWHHVQLD------RLSRTGSVIVDAIKIDFSTPGVSANL--IIDDPIFIGN--VPNNSLVYPSSVWSIALQKGYTGCIKNIRMNG---------VSTKIGQEFEASNSTGIELGCSLS-------NELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTG----ANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLDG-----------------FWSHSIYL--------QNPISVEIDEVGAAFS---VHSSAP-PPR--------------DEHFKGFLSKLVFNG----NDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMR-SALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQHLSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDK--IKKVESKMSGK---------LYFGSNPLGVSRP-------SNGFRGCISTLRIN-ENALDLYEDADSRM------KVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFD---GSPSAIFYEYAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQ--DYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVL---LNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMI 1268          

HSP 2 Score: 132.88 bits (333), Expect = 6.532e-31
Identity = 158/696 (22.70%), Postives = 298/696 (42.82%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRIC--NKGTRAIEFDGSEFIRLDLGTEFYTEV----ESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ-PQSERQIFKLTNNVS-----DGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-----KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLL---MISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR----YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFC--TKVSATINFRR---------QVASNNYIQLQFQDRTRNTSRDDIAFGLQTR-KLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLN-----LGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNG 3342
            C N G C +      C+C F+++ GR C   K    + F G E++  D+       V    E++ + F T++ T  L       ++    S + + +++G +I   +   S+ +I ++ N+       D  WH++I+ R+ + ++L +DG+  + E+  ++ E   + W S + GF                +G+  K+N                     K+  + +F G + K+R    DI    ILL  L+D  +     K +  ++ +          ++F    +YL + + +   S SL+F+ +T   DG++L   ++   + D++  ELI   + +  N+GS V  L      S  ++D +WH +++ RL  + +V+   +D + I+  T   S    N   D P ++G +P     Y    W+  I    G+ GCI    +NG   ++       E  +    ++  +  + L IC+ N C+N G+C +      CDCS T FEG+ C   + +  +N            +V+   +I+++F    R TS   + F      K D   +F+   +      ++LFL++      +  G  +          SD  +  ++VRRLG    L +D   S S   +  ++     +G +F+    ++  A P + E   F G +S L+FNG
Sbjct:  236 CLNDGECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLF------YAGDEKSYLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMMTLIVDGR--RDEIRQYAPE---LDWISNSFGF----------------LGSIPKHN-------------------PSKEVNRVSFRGCMKKVR---YDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTT---SMKVSDGEWHHVQLDRLSRTGSVI---VDAIKIDFSTPGVS---ANLIIDDPIFIGNVPNNSLVYPSSVWS--IALQKGYTGCIKNIRMNG---VSTKIGQEFEASNSTGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRF----RTTSSRGVLFDTGANGKNDKITVFLNDSQ------LNLFLQDSSTNNTFSWGKSL----------SDNHWHELQVRRLGQKLLLYLDGFWSHSIYLQNPISVEIDEVGAAFS----VHSSAPPPRDE--HFKGFLSKLVFNG 842          
BLAST of neurexin-2-like vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 159.844 bits (403), Expect = 3.752e-39
Identity = 253/1119 (22.61%), Postives = 452/1119 (40.39%), Query Frame = 1
Query:  166 ASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGI-FNDNQWHKVKFIRSL---NKAQKGYDLKIVIE--EDDIIIYKKSFSTLSLFVKTRFLSIGGLS--NPVFRMK--NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFH--RSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFII-FNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQ----SNLT-IK-GCYTSTISPSECSKLK-SKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWK-SINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHK---LHLYGSFSLAFYLKTNQKDGVLLMISGTSNDF---LLMELIHGGIKLSFNM-GSTVQILTDNCHGSCSLADNKWHLLEISR--------LDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTR-NTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELER----TDLNLGRSFNEQSIIYIGASPIKKEGKQ---------------FVGLISGLIFNGIKI 3351
            A++    E L + FKT  G  +LFY+GD      V      +I   K       F  SD +      I++ N +    ++D+ WH +   RSL   ++      + ++++   D+I  Y         ++   F  +G +   NP   +   +F GC+ KV Y  D   + +++   +  +G S +      S +C+   +  + +SF   +S++ L  +        L   F+  ++  +I +H     N   +++ E  D  L + I++   VV    +   + +      H+ +D      +L     + V+   I F+T     +L  + +  I +GN    N+   +PS VW   L+KG+ GCI+ + +N          +S K+ Q    SN T I+ GC  S       ++L   + +PC N G C        C+C  TN++G+ C     A+E +G E     L     ++VE I IRF T    G L        +   +  I + + +  L L +Q  S    F    ++SD  WH L + R  + L L LDG                  W  SI +        +  +S +   +GA+      H + P  P+                +F G ++KL  N     +DY+   +++  Q  K  ++ +      K  + S++F     Y+         L GSF + F  +T  +   LL  +   +D+     +++++G +K ++   G      +        L+D +WH + I +        L +  +  +L IDK  I++V    S K          Y G  P    +        + GF+GCI+   IN +  ++L + +   +      ++   C   +  C ++ C N G+C+Q +    CDCS T   G  C   S T+ F     S + I  ++    R  TS+D   F  +T + +G +I +E       D+  +FL  G +   Y++G      +  +  ++DGF   +++ R  ++  +Q+D   S   R    +DL L    N Q+ I IGA+   +   Q               + G ISG+  NG+ I
Sbjct:  290 AAVRAKKENLTLTFKTVHGTSMLFYAGDEKSYLHVMLQDGAIIASSK-------FDGSDARI-----IRMFNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGRRDEIRQYAPELD----WISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQS-YGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLP-RWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRL--QTTSMKVSDGEWHHVQLD------RLSRTGSVIVDAIKIDFSTPGVSANL--IIDDPIFIGN--VPNNSLVYPSSVWSIALQKGYTGCIKNIRMNG---------VSTKIGQEFEASNSTGIELGCSLS-------NELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTG----ANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLDG-----------------FWSHSIYL--------QNPISVEIDEVGAAFS---VHSSAP-PPR--------------DEHFKGFLSKLVFNG----NDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMR-SALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQHLSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDK--IKKVESKMSGK---------LYFGSNPLGVSRP-------SNGFRGCISTLRIN-ENALDLYEDADSRM------KVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFD---GSPSAIFYEYAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQ--DYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVL---LNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMI 1277          

HSP 2 Score: 124.79 bits (312), Expect = 1.778e-28
Identity = 158/705 (22.41%), Postives = 298/705 (42.27%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRIC--NKGTRAIEFDGSEFIRLDLGTEFYTEV----ESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ-PQSERQIFKLTNNVS-----DGQWHSLIISRNNRA---------LSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-----KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLL---MISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR----YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFC--TKVSATINFRR---------QVASNNYIQLQFQDRTRNTSRDDIAFGLQTR-KLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLN-----LGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNG 3342
            C N G C +      C+C F+++ GR C   K    + F G E++  D+       V    E++ + F T++ T  L       ++    S + + +++G +I   +   S+ +I ++ N+       D  WH++I+ R+ +          ++L +DG+  + E+  ++ E   + W S + GF                +G+  K+N                     K+  + +F G + K+R    DI    ILL  L+D  +     K +  ++ +          ++F    +YL + + +   S SL+F+ +T   DG++L   ++   + D++  ELI   + +  N+GS V  L      S  ++D +WH +++ RL  + +V+   +D + I+  T   S    N   D P ++G +P     Y    W+  I    G+ GCI    +NG   ++       E  +    ++  +  + L IC+ N C+N G+C +      CDCS T FEG+ C   + +  +N            +V+   +I+++F    R TS   + F      K D   +F+   +      ++LFL++      +  G  +          SD  +  ++VRRLG    L +D   S S   +  ++     +G +F+    ++  A P + E   F G +S L+FNG
Sbjct:  236 CLNDGECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLF------YAGDEKSYLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGR--RDEIRQYAPE---LDWISNSFGF----------------LGSIPKHN-------------------PSKEVNRVSFRGCMKKVR---YDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTT---SMKVSDGEWHHVQLDRLSRTGSVI---VDAIKIDFSTPGVS---ANLIIDDPIFIGNVPNNSLVYPSSVWS--IALQKGYTGCIKNIRMNG---VSTKIGQEFEASNSTGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRF----RTTSSRGVLFDTGANGKNDKITVFLNDSQ------LNLFLQDSSTNNTFSWGKSL----------SDNHWHELQVRRLGQKLLLYLDGFWSHSIYLQNPISVEIDEVGAAFS----VHSSAPPPRDE--HFKGFLSKLVFNG 851          
BLAST of neurexin-2-like vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 67.3958 bits (163), Expect = 7.318e-11
Identity = 59/230 (25.65%), Postives = 106/230 (46.09%), Query Frame = 1
Query: 2698 VEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCL-QQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD--IAFGLQTRKLDGTIIFVESKR---KDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASP-IKKE-----GKQFVGLISGLIFNGIKI 3351
            + + DVY +Q  +N      IC ++ C   GQC+ +     +C+C    ++G  C+ +   I    +   + +I+L   +    TS  D  +AF  +T + +G +++ + +R   +   D+I + + NG +   Y++G G   L     +V DG    VR  R G    ++IDN R E++     +    N    I++G  P I K         FVG I+ +  NG+K+
Sbjct: 3126 IVVGDVYSTQEPNN------ICANSTCGMNGQCVPRNMTHYTCECKLY-YDGPTCS-LFKPIEHAARFDGDAFIELSSDEFPHLTSEKDEIVAFKFKTEQQNGVLLW-QGQRPTVQQMEDYISVGIVNGHLHFSYELGGGAAHLISEE-RVDDGKEHSVRFERKGREGQMRIDNYR-EVDGRSTGILAMLNVDGNIFVGGVPDISKATGGLFSNNFVGCIADVELNGVKL 3344          
BLAST of neurexin-2-like vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0084256)

HSP 1 Score: 248.054 bits (632), Expect = 1.487e-66
Identity = 244/981 (24.87%), Postives = 428/981 (43.63%), Query Frame = 1
Query:  592 NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIER-SYSIHLYVDYMNGKAKLKFNN------------------DISVEKFIIFNTSDFPVDLSAL-FNSEIILGN-QFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTE--FYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSIL-LSIENGLLILIIQ-PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKI-LQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINS---VDIIDDY-ILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQF---QDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQ-----FVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEI 3420
            NF+GCL KV + AD + L+++D  +    G   I    +    C    +  +P++F ++ S +VL     P+E             S I +  R+K  +  I +    +Q      V            LI IE  +  I++++D  +G +K++ +                   D  V    ++N    P D + L  +  + LG    + NSV + P+ +W ATLR+GF GC+  ++L+ +  D+       +++ S      C+   +  + C+      +PC N G C   W    C+C  T Y G  C +    + F+GS+ + + LG      T+ E ++IRF T  P G LL  +    +E NS   L +++  G +   ++    E+ +    + ++D  WH++  SR    L L +DG   ++ E     +  ++I  +S+++G G  ++ E I                                   Q     PNFVG++  L  N    +DI+      L+ L    +K+ A+   +  G  +  ++ TF +  +Y+ +  L  Y S S+ F  KT + +G+L+   G  NDF+ +EL++G I  +F++G     + D       + DN+WH + I R     + L++  D   I  +T +N H           Y+GG+ +  Y K    I S  GF+GC+A   +    P      S+     V  S +   C+   T C  N C N G C+QQ+   +C+C  T++ G  C   S    F      NN   +Q+   ++   +T  D+IA G  T + D  ++ VES      D++ L +  G I + Y++G+  + L ++  KV+D  Y  VR +R G +A LQ+D+   +      +    FN  S + +G     + G+      F G+I+GL  N ++I  +   +   P+I  +I GDV++
Sbjct:  507 NFVGCLRKVEFSADTLNLNLIDLAKS---GSKLIQVAGNLEYQCPSG-DPQDPVTFTTRESHLVLP----PWET---------GKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPV------------LIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSW-PAAIWTATLRQGFVGCLRDLVLSGKAIDIA---AFARVQDSASVKPSCH---VQANVCN-----GNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTS----AESNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRAETILGRHSTMEI--RSVHLG-GLFHAEEEI-----------------------------------QMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPY--HAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSR--IHMNDNRWHQVSIRRPGPKTHTLTVD-DSFEIISLTGNNMH----LELAGILYIGGVFKDMYSKLPASISSRSGFEGCLASLDLGDASP------SLTSDAVVPSSLVVSGCEGP-TKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEF-----GNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVESATTQ--DYMELEIVEGNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGK-FSRNGRNRIERPFAGVIAGLSVNKLRILDLAVERD--PHI--TIRGDVQL 1376          

HSP 2 Score: 75.0998 bits (183), Expect = 4.229e-13
Identity = 85/352 (24.15%), Postives = 145/352 (41.19%), Query Frame = 1
Query: 2227 LYGSFSLAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPA-----YLGGMPRYEYQKWT-----EYIFSNYGFQGCI--------AGFSIN------------GKKPINLLQYSIVEIP--DVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSAT--INFR-RQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGI--MKLTDLSIKVSDGFYRRVRVRR 3168
            L G+  L F  KT Q +G++L    G + DF  ++L+ G ++L +N+G   QI+T        L D  WH +++ R D   +++        ++ V+   S K K F F + A     Y+GGMP +   K         IF    F+G I         G S              G  P +  +    E P   V        C+ N      + C++GG C+       C+C    ++G++C K  A     FR  Q  S +  Q   +     +++D I+F  +TR+ +G + +         D+++L L +G + L   +  G   M +    ++  D  + +V V R
Sbjct:  124 LNGTLELEF--KTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRE----LHDGHWHKVQVLRNDEQTSLI--------VDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPR-FRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERN------DPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIV--SAQDAISFYFRTRQPNGLLFYTGHGT----DYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHR 448          
BLAST of neurexin-2-like vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334607)

HSP 1 Score: 248.054 bits (632), Expect = 1.487e-66
Identity = 244/981 (24.87%), Postives = 428/981 (43.63%), Query Frame = 1
Query:  592 NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIER-SYSIHLYVDYMNGKAKLKFNN------------------DISVEKFIIFNTSDFPVDLSAL-FNSEIILGN-QFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTE--FYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSIL-LSIENGLLILIIQ-PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKI-LQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINS---VDIIDDY-ILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQF---QDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQ-----FVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEI 3420
            NF+GCL KV + AD + L+++D  +    G   I    +    C    +  +P++F ++ S +VL     P+E             S I +  R+K  +  I +    +Q      V            LI IE  +  I++++D  +G +K++ +                   D  V    ++N    P D + L  +  + LG    + NSV + P+ +W ATLR+GF GC+  ++L+ +  D+       +++ S      C+   +  + C+      +PC N G C   W    C+C  T Y G  C +    + F+GS+ + + LG      T+ E ++IRF T  P G LL  +    +E NS   L +++  G +   ++    E+ +    + ++D  WH++  SR    L L +DG   ++ E     +  ++I  +S+++G G  ++ E I                                   Q     PNFVG++  L  N    +DI+      L+ L    +K+ A+   +  G  +  ++ TF +  +Y+ +  L  Y S S+ F  KT + +G+L+   G  NDF+ +EL++G I  +F++G     + D       + DN+WH + I R     + L++  D   I  +T +N H           Y+GG+ +  Y K    I S  GF+GC+A   +    P      S+     V  S +   C+   T C  N C N G C+QQ+   +C+C  T++ G  C   S    F      NN   +Q+   ++   +T  D+IA G  T + D  ++ VES      D++ L +  G I + Y++G+  + L ++  KV+D  Y  VR +R G +A LQ+D+   +      +    FN  S + +G     + G+      F G+I+GL  N ++I  +   +   P+I  +I GDV++
Sbjct:  507 NFVGCLRKVEFSADTLNLNLIDLAKS---GSKLIQVAGNLEYQCPSG-DPQDPVTFTTRESHLVLP----PWET---------GKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPV------------LIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSW-PAAIWTATLRQGFVGCLRDLVLSGKAIDIA---AFARVQDSASVKPSCH---VQANVCN-----GNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTS----AESNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRAETILGRHSTMEI--RSVHLG-GLFHAEEEI-----------------------------------QMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPY--HAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSR--IHMNDNRWHQVSIRRPGPKTHTLTVD-DSFEIISLTGNNMH----LELAGILYIGGVFKDMYSKLPASISSRSGFEGCLASLDLGDASP------SLTSDAVVPSSLVVSGCEGP-TKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEF-----GNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVESATTQ--DYMELEIVEGNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGK-FSRNGRNRIERPFAGVIAGLSVNKLRILDLAVERD--PHI--TIRGDVQL 1376          

HSP 2 Score: 75.0998 bits (183), Expect = 4.229e-13
Identity = 85/352 (24.15%), Postives = 145/352 (41.19%), Query Frame = 1
Query: 2227 LYGSFSLAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPA-----YLGGMPRYEYQKWT-----EYIFSNYGFQGCI--------AGFSIN------------GKKPINLLQYSIVEIP--DVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSAT--INFR-RQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGI--MKLTDLSIKVSDGFYRRVRVRR 3168
            L G+  L F  KT Q +G++L    G + DF  ++L+ G ++L +N+G   QI+T        L D  WH +++ R D   +++        ++ V+   S K K F F + A     Y+GGMP +   K         IF    F+G I         G S              G  P +  +    E P   V        C+ N      + C++GG C+       C+C    ++G++C K  A     FR  Q  S +  Q   +     +++D I+F  +TR+ +G + +         D+++L L +G + L   +  G   M +    ++  D  + +V V R
Sbjct:  124 LNGTLELEF--KTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRE----LHDGHWHKVQVLRNDEQTSLI--------VDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPR-FRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERN------DPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIV--SAQDAISFYFRTRQPNGLLFYTGHGT----DYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHR 448          
BLAST of neurexin-2-like vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334609)

HSP 1 Score: 247.669 bits (631), Expect = 2.080e-66
Identity = 245/988 (24.80%), Postives = 429/988 (43.42%), Query Frame = 1
Query:  592 NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIER-SYSIHLYVDYMNGKAKLKFNN------------------DISVEKFIIFNTSDFPVDLSAL-FNSEIILGN-QFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTE--FYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSIL-LSIENGLLILIIQ-PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDG----KILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINS---VDIIDDY-ILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQF---QDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQ-----FVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTS 3432
            NF+GCL KV + AD + L+++D  +    G   I    +    C    +  +P++F ++ S +VL     P+E             S I +  R+K  +  I +    +Q      V            LI IE  +  I++++D  +G +K++ +                   D  V    ++N    P D + L  +  + LG    + NSV + P+ +W ATLR+GF GC+  ++L+ +  D+       +++ S      C+   +  + C+      +PC N G C   W    C+C  T Y G  C +    + F+GS+ + + LG      T+ E ++IRF T  P G LL  +    +E NS   L +++  G +   ++    E+ +    + ++D  WH++  SR    L L +DG    + +  E     +  ++I  +S+++G G  ++ E I                                   Q     PNFVG++  L  N    +DI+      L+ L    +K+ A+   +  G  +  ++ TF +  +Y+ +  L  Y S S+ F  KT + +G+L+   G  NDF+ +EL++G I  +F++G     + D       + DN+WH + I R     + L++  D   I  +T +N H           Y+GG+ +  Y K    I S  GF+GC+A   +    P      S+     V  S +   C+   T C  N C N G C+QQ+   +C+C  T++ G  C   S    F      NN   +Q+   ++   +T  D+IA G  T + D  ++ VES      D++ L +  G I + Y++G+  + L ++  KV+D  Y  VR +R G +A LQ+D+   +      +    FN  S + +G     + G+      F G+I+GL  N ++I  +   +   P+I  +I GDV++   S
Sbjct:  507 NFVGCLRKVEFSADTLNLNLIDLAKS---GSKLIQVAGNLEYQCPSG-DPQDPVTFTTRESHLVLP----PWET---------GKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPV------------LIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSW-PAAIWTATLRQGFVGCLRDLVLSGKAIDIA---AFARVQDSASVKPSCH---VQANVCN-----GNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTS----AESNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSETILGRHSTMEI--RSVHLG-GLFHAEEEI-----------------------------------QMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPY--HAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSR--IHMNDNRWHQVSIRRPGPKTHTLTVD-DSFEIISLTGNNMH----LELAGILYIGGVFKDMYSKLPASISSRSGFEGCLASLDLGDASP------SLTSDAVVPSSLVVSGCEGP-TKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEF-----GNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVESATTQ--DYMELEIVEGNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGK-FSRNGRNRIERPFAGVIAGLSVNKLRILDLAVERD--PHI--TIRGDVQLTPAS 1383          

HSP 2 Score: 75.0998 bits (183), Expect = 3.849e-13
Identity = 85/352 (24.15%), Postives = 145/352 (41.19%), Query Frame = 1
Query: 2227 LYGSFSLAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPA-----YLGGMPRYEYQKWT-----EYIFSNYGFQGCI--------AGFSIN------------GKKPINLLQYSIVEIP--DVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSAT--INFR-RQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGI--MKLTDLSIKVSDGFYRRVRVRR 3168
            L G+  L F  KT Q +G++L    G + DF  ++L+ G ++L +N+G   QI+T        L D  WH +++ R D   +++        ++ V+   S K K F F + A     Y+GGMP +   K         IF    F+G I         G S              G  P +  +    E P   V        C+ N      + C++GG C+       C+C    ++G++C K  A     FR  Q  S +  Q   +     +++D I+F  +TR+ +G + +         D+++L L +G + L   +  G   M +    ++  D  + +V V R
Sbjct:  124 LNGTLELEF--KTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRE----LHDGHWHKVQVLRNDEQTSLI--------VDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPR-FRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERN------DPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIV--SAQDAISFYFRTRQPNGLLFYTGHGT----DYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHR 448          
BLAST of neurexin-2-like vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334611)

HSP 1 Score: 246.899 bits (629), Expect = 2.730e-66
Identity = 244/984 (24.80%), Postives = 428/984 (43.50%), Query Frame = 1
Query:  592 NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIER-SYSIHLYVDYMNGKAKLKFNN------------------DISVEKFIIFNTSDFPVDLSAL-FNSEIILGN-QFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTE--FYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSIL-LSIENGLLILIIQ-PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDG----KILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINS---VDIIDDY-ILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQF---QDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQ-----FVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEI 3420
            NF+GCL KV + AD + L+++D  +    G   I    +    C    +  +P++F ++ S +VL     P+E             S I +  R+K  +  I +    +Q      V            LI IE  +  I++++D  +G +K++ +                   D  V    ++N    P D + L  +  + LG    + NSV + P+ +W ATLR+GF GC+  ++L+ +  D+       +++ S      C+   +  + C+      +PC N G C   W    C+C  T Y G  C +    + F+GS+ + + LG      T+ E ++IRF T  P G LL  +    +E NS   L +++  G +   ++    E+ +    + ++D  WH++  SR    L L +DG    + +  E     +  ++I  +S+++G G  ++ E I                                   Q     PNFVG++  L  N    +DI+      L+ L    +K+ A+   +  G  +  ++ TF +  +Y+ +  L  Y S S+ F  KT + +G+L+   G  NDF+ +EL++G I  +F++G     + D       + DN+WH + I R     + L++  D   I  +T +N H           Y+GG+ +  Y K    I S  GF+GC+A   +    P      S+     V  S +   C+   T C  N C N G C+QQ+   +C+C  T++ G  C   S    F      NN   +Q+   ++   +T  D+IA G  T + D  ++ VES      D++ L +  G I + Y++G+  + L ++  KV+D  Y  VR +R G +A LQ+D+   +      +    FN  S + +G     + G+      F G+I+GL  N ++I  +   +   P+I  +I GDV++
Sbjct:  507 NFVGCLRKVEFSADTLNLNLIDLAKS---GSKLIQVAGNLEYQCPSG-DPQDPVTFTTRESHLVLP----PWET---------GKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPV------------LIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSW-PAAIWTATLRQGFVGCLRDLVLSGKAIDIA---AFARVQDSASVKPSCH---VQANVCN-----GNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTS----AESNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSETILGRHSTMEI--RSVHLG-GLFHAEEEI-----------------------------------QMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPY--HAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSR--IHMNDNRWHQVSIRRPGPKTHTLTVD-DSFEIISLTGNNMH----LELAGILYIGGVFKDMYSKLPASISSRSGFEGCLASLDLGDASP------SLTSDAVVPSSLVVSGCEGP-TKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEF-----GNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVESATTQ--DYMELEIVEGNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGK-FSRNGRNRIERPFAGVIAGLSVNKLRILDLAVERD--PHI--TIRGDVQL 1379          

HSP 2 Score: 75.0998 bits (183), Expect = 4.086e-13
Identity = 85/352 (24.15%), Postives = 145/352 (41.19%), Query Frame = 1
Query: 2227 LYGSFSLAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPA-----YLGGMPRYEYQKWT-----EYIFSNYGFQGCI--------AGFSIN------------GKKPINLLQYSIVEIP--DVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSAT--INFR-RQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGI--MKLTDLSIKVSDGFYRRVRVRR 3168
            L G+  L F  KT Q +G++L    G + DF  ++L+ G ++L +N+G   QI+T        L D  WH +++ R D   +++        ++ V+   S K K F F + A     Y+GGMP +   K         IF    F+G I         G S              G  P +  +    E P   V        C+ N      + C++GG C+       C+C    ++G++C K  A     FR  Q  S +  Q   +     +++D I+F  +TR+ +G + +         D+++L L +G + L   +  G   M +    ++  D  + +V V R
Sbjct:  124 LNGTLELEF--KTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRE----LHDGHWHKVQVLRNDEQTSLI--------VDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPR-FRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERN------DPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIV--SAQDAISFYFRTRQPNGLLFYTGHGT----DYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHR 448          
BLAST of neurexin-2-like vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334610)

HSP 1 Score: 246.514 bits (628), Expect = 4.372e-66
Identity = 244/984 (24.80%), Postives = 428/984 (43.50%), Query Frame = 1
Query:  592 NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIER-SYSIHLYVDYMNGKAKLKFNN------------------DISVEKFIIFNTSDFPVDLSAL-FNSEIILGN-QFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTE--FYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSIL-LSIENGLLILIIQ-PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDG----KILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINS---VDIIDDY-ILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQF---QDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQ-----FVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEI 3420
            NF+GCL KV + AD + L+++D  +    G   I    +    C    +  +P++F ++ S +VL     P+E             S I +  R+K  +  I +    +Q      V            LI IE  +  I++++D  +G +K++ +                   D  V    ++N    P D + L  +  + LG    + NSV + P+ +W ATLR+GF GC+  ++L+ +  D+       +++ S      C+   +  + C+      +PC N G C   W    C+C  T Y G  C +    + F+GS+ + + LG      T+ E ++IRF T  P G LL  +    +E NS   L +++  G +   ++    E+ +    + ++D  WH++  SR    L L +DG    + +  E     +  ++I  +S+++G G  ++ E I                                   Q     PNFVG++  L  N    +DI+      L+ L    +K+ A+   +  G  +  ++ TF +  +Y+ +  L  Y S S+ F  KT + +G+L+   G  NDF+ +EL++G I  +F++G     + D       + DN+WH + I R     + L++  D   I  +T +N H           Y+GG+ +  Y K    I S  GF+GC+A   +    P      S+     V  S +   C+   T C  N C N G C+QQ+   +C+C  T++ G  C   S    F      NN   +Q+   ++   +T  D+IA G  T + D  ++ VES      D++ L +  G I + Y++G+  + L ++  KV+D  Y  VR +R G +A LQ+D+   +      +    FN  S + +G     + G+      F G+I+GL  N ++I  +   +   P+I  +I GDV++
Sbjct:  507 NFVGCLRKVEFSADTLNLNLIDLAKS---GSKLIQVAGNLEYQCPSG-DPQDPVTFTTRESHLVLP----PWET---------GKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPV------------LIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSW-PAAIWTATLRQGFVGCLRDLVLSGKAIDIA---AFARVQDSASVKPSCH---VQANVCN-----GNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTS----AESNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSETILGRHSTMEI--RSVHLG-GLFHAEEEI-----------------------------------QMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPY--HAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSR--IHMNDNRWHQVSIRRPGPKTHTLTVD-DSFEIISLTGNNMH----LELAGILYIGGVFKDMYSKLPASISSRSGFEGCLASLDLGDASP------SLTSDAVVPSSLVVSGCEGP-TKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEF-----GNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVESATTQ--DYMELEIVEGNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGK-FSRNGRNRIERPFAGVIAGLSVNKLRILDLAVERD--PHI--TIRGDVQL 1379          

HSP 2 Score: 75.0998 bits (183), Expect = 4.270e-13
Identity = 85/352 (24.15%), Postives = 145/352 (41.19%), Query Frame = 1
Query: 2227 LYGSFSLAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPA-----YLGGMPRYEYQKWT-----EYIFSNYGFQGCI--------AGFSIN------------GKKPINLLQYSIVEIP--DVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSAT--INFR-RQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGI--MKLTDLSIKVSDGFYRRVRVRR 3168
            L G+  L F  KT Q +G++L    G + DF  ++L+ G ++L +N+G   QI+T        L D  WH +++ R D   +++        ++ V+   S K K F F + A     Y+GGMP +   K         IF    F+G I         G S              G  P +  +    E P   V        C+ N      + C++GG C+       C+C    ++G++C K  A     FR  Q  S +  Q   +     +++D I+F  +TR+ +G + +         D+++L L +G + L   +  G   M +    ++  D  + +V V R
Sbjct:  124 LNGTLELEF--KTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRE----LHDGHWHKVQVLRNDEQTSLI--------VDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPR-FRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERN------DPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIV--SAQDAISFYFRTRQPNGLLFYTGHGT----DYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHR 448          
BLAST of neurexin-2-like vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 304.294 bits (778), Expect = 8.974e-85
Identity = 280/1130 (24.78%), Postives = 475/1130 (42.04%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQP-ISFSKTCQQKIED---FNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH--------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSAL-FNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVY-SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQ--------------IDNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L+        L   +++G P +  S     K E+    +P++F +  SF+ L  K    +   +   F+    + ++ F   K                  F ++E  D  L + + +             ++    Y +    D  +G         ISV    I    + P +   L  + ++ LG      +   FP+EVW A L  G+ GC+  + ++ +  D++R    +   Q  + +K        PS CSK   K   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++      S+ ++ ++ L ++ G + L +      +      N++D +WH++ + R  ++L L +D        +   +E             G I  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN +               IG + +V   VTF +  +Y+ +  L  Y S  L F  KT   DG++L   G  NDF+++EL+ G +    ++G+   ++  N +    L DN WH + ISR   + N+ ++ ID     ++T   +  AKN +     Y+GG+ +  Y+   + + S  GFQGC+A   +NG+ P   LQ   +        Q+   C+   T C+++ C N G CLQQ+E  SCDCS T++ G  C     T  F R       I   +    R ++R D +A G  T++ D  ++ V+S     GD++ L +E G I + +++G   + + + S  V+DG Y  VR  R G +A LQ              IDN R  + R  +   LGR               FN Q+ I IG    +K  + F G +SGL +NG+K+
Sbjct:  277 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLE--------LSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLD-KWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGT--------ISVNS--IRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRR----IAEAQRAVGVK--------PS-CSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLGKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVD--------DLQPSE-------------GQITGDHTQLEFHNVETG--------------------IVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAM---------------IGYRSIVADPVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSN--TPLNDNHWHNVMISRD--TNNLHTVKIDT----KITTQTTMGAKNLDLKGDLYVGGVAKDMYKDLPKLVHSKEGFQGCLASVDLNGRLPD--LQSDALST----AGQVERGCEGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRD---GGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSS-SGLGDYLQLQIERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGG--WEKGSRPFQGQLSGLYYNGLKV 1277          

HSP 2 Score: 65.4698 bits (158), Expect = 4.670e-10
Identity = 71/334 (21.26%), Postives = 138/334 (41.32%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG---IKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVT-IHNSHKAKNFNFDRPAYLGGMP----RYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNH-CKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATIN--------------FRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            ++F +KT    G+L+        DFL + LIH G   ++ S        + +D      ++ D++WH +      L RN  + ++  V+ EE+  +    K ++       +LGG+P        +  +  I     ++G I    +NG +P+ +    +                 N  IC+ +H C NGG C    ++  CDCS T F+G+ C++  A +               +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R
Sbjct:   51 MSFNMKTKSAHGLLVYFDDEGFCDFLEL-LIHNGRLSLRFSIFCAEPATVFSDT-----AVNDSRWHAVT-----LRRNFKNTTL--VVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNGSEPVLIGSDGV-----------------NSDICEADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTR 350          
BLAST of neurexin-2-like vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 300.442 bits (768), Expect = 1.749e-83
Identity = 282/1140 (24.74%), Postives = 477/1140 (41.84%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQP-ISFSKTCQQKIED---FNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH--------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSAL-FNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ----------PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVY-SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQ--------------IDNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L+        L   +++G P +  S     K E+    +P++F +  SF+ L  K    +   +   F+    + ++ F   K                  F ++E  D  L + + +             ++    Y +    D  +G         ISV    I    + P +   L  + ++ LG      +   FP+EVW A L  G+ GC+  + ++ +  D++R    +   Q  + +K        PS CSK   K   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++      S+ ++ ++ L ++ G + L +            +    IF    N++D +WH++ + R  ++L L +D        +   +E             G I  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN +               IG + +V   VTF +  +Y+ +  L  Y S  L F  KT   DG++L   G  NDF+++EL+ G +    ++G+   ++  N +    L DN WH + ISR   + N+ ++ ID     ++T   +  AKN +     Y+GG+ +  Y+   + + S  GFQGC+A   +NG+ P   LQ   +        Q+   C+   T C+++ C N G CLQQ+E  SCDCS T++ G  C     T  F R       I   +    R ++R D +A G  T++ D  ++ V+S     GD++ L +E G I + +++G   + + + S  V+DG Y  VR  R G +A LQ              IDN R  + R  +   LGR               FN Q+ I IG    +K  + F G +SGL +NG+K+
Sbjct:  281 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLE--------LSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLD-KWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGT--------ISVNS--IRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRR----IAEAQRAVGVK--------PS-CSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFS-GQNLNDNEWHTVRVVRRGKSLKLMVD--------DLQPSE-------------GQITGDHTQLEFHNVETG--------------------IVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAM---------------IGYRSIVADPVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSN--TPLNDNHWHNVMISRD--TNNLHTVKIDT----KITTQTTMGAKNLDLKGDLYVGGVAKDMYKDLPKLVHSKEGFQGCLASVDLNGRLPD--LQSDALST----AGQVERGCEGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRD---GGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSS-SGLGDYLQLQIERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGG--WEKGSRPFQGQLSGLYYNGLKV 1290          

HSP 2 Score: 63.929 bits (154), Expect = 1.429e-9
Identity = 71/338 (21.01%), Postives = 138/338 (40.83%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG---IKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVT-IHNSHKAKNFNFDRPAYLGGMP----RYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNH-CKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATIN------------------FRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            ++F +KT    G+L+        DFL + LIH G   ++ S        + +D      ++ D++WH +      L RN  + ++  V+ EE+  +    K ++       +LGG+P        +  +  I     ++G I    +NG +P+ +    +                 N  IC+ +H C NGG C    ++  CDCS T F+G+ C++  A +                   +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R
Sbjct:   51 MSFNMKTKSAHGLLVYFDDEGFCDFLEL-LIHNGRLSLRFSIFCAEPATVFSDT-----AVNDSRWHAVT-----LRRNFKNTTL--VVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNGSEPVLIGSDGV-----------------NSDICEADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTR 354          
BLAST of neurexin-2-like vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 300.056 bits (767), Expect = 2.319e-83
Identity = 282/1140 (24.74%), Postives = 477/1140 (41.84%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQP-ISFSKTCQQKIED---FNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH--------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSAL-FNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ----------PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVY-SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQ--------------IDNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L+        L   +++G P +  S     K E+    +P++F +  SF+ L  K    +   +   F+    + ++ F   K                  F ++E  D  L + + +             ++    Y +    D  +G         ISV    I    + P +   L  + ++ LG      +   FP+EVW A L  G+ GC+  + ++ +  D++R    +   Q  + +K        PS CSK   K   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++      S+ ++ ++ L ++ G + L +            +    IF    N++D +WH++ + R  ++L L +D        +   +E             G I  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN +               IG + +V   VTF +  +Y+ +  L  Y S  L F  KT   DG++L   G  NDF+++EL+ G +    ++G+   ++  N +    L DN WH + ISR   + N+ ++ ID     ++T   +  AKN +     Y+GG+ +  Y+   + + S  GFQGC+A   +NG+ P   LQ   +        Q+   C+   T C+++ C N G CLQQ+E  SCDCS T++ G  C     T  F R       I   +    R ++R D +A G  T++ D  ++ V+S     GD++ L +E G I + +++G   + + + S  V+DG Y  VR  R G +A LQ              IDN R  + R  +   LGR               FN Q+ I IG    +K  + F G +SGL +NG+K+
Sbjct:  281 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLE--------LSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLD-KWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGT--------ISVNS--IRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRR----IAEAQRAVGVK--------PS-CSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFS-GQNLNDNEWHTVRVVRRGKSLKLMVD--------DLQPSE-------------GQITGDHTQLEFHNVETG--------------------IVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAM---------------IGYRSIVADPVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSN--TPLNDNHWHNVMISRD--TNNLHTVKIDT----KITTQTTMGAKNLDLKGDLYVGGVAKDMYKDLPKLVHSKEGFQGCLASVDLNGRLPD--LQSDALST----AGQVERGCEGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRD---GGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSS-SGLGDYLQLQIERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGG--WEKGSRPFQGQLSGLYYNGLKV 1290          

HSP 2 Score: 63.929 bits (154), Expect = 1.428e-9
Identity = 71/338 (21.01%), Postives = 138/338 (40.83%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG---IKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVT-IHNSHKAKNFNFDRPAYLGGMP----RYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNH-CKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATIN------------------FRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            ++F +KT    G+L+        DFL + LIH G   ++ S        + +D      ++ D++WH +      L RN  + ++  V+ EE+  +    K ++       +LGG+P        +  +  I     ++G I    +NG +P+ +    +                 N  IC+ +H C NGG C    ++  CDCS T F+G+ C++  A +                   +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R
Sbjct:   51 MSFNMKTKSAHGLLVYFDDEGFCDFLEL-LIHNGRLSLRFSIFCAEPATVFSDT-----AVNDSRWHAVT-----LRRNFKNTTL--VVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNGSEPVLIGSDGV-----------------NSDICEADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTR 354          
BLAST of neurexin-2-like vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 297.36 bits (760), Expect = 2.818e-83
Identity = 292/1191 (24.52%), Postives = 492/1191 (41.31%), Query Frame = 1
Query:   58 WWILY-------NKFSLAILENRHGGLTTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQK-GYDL------KIVIEEDDIIIYKK-SFSTLSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQP-ISFSKTCQQKIED---FNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH--------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSAL-FNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ----------PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQ--------------IDNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            W I+Y         F L +   R   + T    + + ++  P    S S EI  + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +    G+ +       + I  D I+     +    ++     F  +GG         +PV    NF+GCL +V+YK +++ L+        L   +++G P +  S     K E+    +P++F +  SF+ L  K    +   +   F+    + ++ F   K                  F ++E  D  L + + +             ++    Y +    D  +G         ISV    I    + P +   L  + ++ LG      +   FP+EVW A L  G+ GC+  + ++ +  D++R    +   Q  + +K        PS CSK   K   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++      S+ ++ ++ L ++ G + L +            +    IF    N++D +WH++ + R  ++L L +D        +   +E             G I  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN +               IG + +V   VTF +  +Y+ +  L  Y S  L F  KT   DG++L   G  NDF+++EL+ G +    ++G+   ++  N +    L DN WH + ISR   + N+ ++ ID     ++T   +  AKN +     Y+GG+ +  Y+   + + S  GFQGC+A   +NG+ P   LQ   +        Q+   C+   T C+++ C N G CLQQ+E  SCDCS T++ G  C     T  F R       I   +    R ++R D +A G  T++ D  ++ V+S     GD++ L +E G I + +++G   + + + S  V+DG Y  VR  R G +A LQ              IDN R  + R  +   LGR               FN Q+ I IG    +K  + F G +SGL +NG+K+
Sbjct:   33 WKIIYCLYESLRTLFFLYVFAEREEYMATFKGSEYFCYDLSPNPIQSSSDEI-TLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLE--------LSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLD-KWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGT--------ISVNS--IRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRR----IAEAQRAVGVK--------PS-CSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFS-GQNLNDNEWHTVRVVRRGKSLKLMVD--------DLQPSE-------------GQITGDHTQLEFHNVETG--------------------IVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAM---------------IGYRSIVADPVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSN--TPLNDNHWHNVMISRD--TNNLHTVKIDT----KITTQTTMGAKNLDLKGDLYVGGVAKDMYKDLPKLVHSKEGFQGCLASVDLNGRLPD--LQSDALST----AGQVERGCEGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRD---GGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSS-SGLGDYLQLQIERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGG--WEKGSRPFQGQLSGLYYNGLKV 1093          
BLAST of neurexin-2-like vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 298.901 bits (764), Expect = 4.626e-83
Identity = 282/1140 (24.74%), Postives = 477/1140 (41.84%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQP-ISFSKTCQQKIED---FNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH--------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSAL-FNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ----------PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVY-SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQ--------------IDNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L+        L   +++G P +  S     K E+    +P++F +  SF+ L  K    +   +   F+    + ++ F   K                  F ++E  D  L + + +             ++    Y +    D  +G         ISV    I    + P +   L  + ++ LG      +   FP+EVW A L  G+ GC+  + ++ +  D++R    +   Q  + +K        PS CSK   K   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++      S+ ++ ++ L ++ G + L +            +    IF    N++D +WH++ + R  ++L L +D        +   +E             G I  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN +               IG + +V   VTF +  +Y+ +  L  Y S  L F  KT   DG++L   G  NDF+++EL+ G +    ++G+   ++  N +    L DN WH + ISR   + N+ ++ ID     ++T   +  AKN +     Y+GG+ +  Y+   + + S  GFQGC+A   +NG+ P   LQ   +        Q+   C+   T C+++ C N G CLQQ+E  SCDCS T++ G  C     T  F R       I   +    R ++R D +A G  T++ D  ++ V+S     GD++ L +E G I + +++G   + + + S  V+DG Y  VR  R G +A LQ              IDN R  + R  +   LGR               FN Q+ I IG    +K  + F G +SGL +NG+K+
Sbjct:  277 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLE--------LSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLD-KWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGT--------ISVNS--IRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRR----IAEAQRAVGVK--------PS-CSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFS-GQNLNDNEWHTVRVVRRGKSLKLMVD--------DLQPSE-------------GQITGDHTQLEFHNVETG--------------------IVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAM---------------IGYRSIVADPVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSN--TPLNDNHWHNVMISRD--TNNLHTVKIDT----KITTQTTMGAKNLDLKGDLYVGGVAKDMYKDLPKLVHSKEGFQGCLASVDLNGRLPD--LQSDALST----AGQVERGCEGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRD---GGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSS-SGLGDYLQLQIERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGG--WEKGSRPFQGQLSGLYYNGLKV 1286          

HSP 2 Score: 65.0846 bits (157), Expect = 5.537e-10
Identity = 71/334 (21.26%), Postives = 138/334 (41.32%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG---IKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVT-IHNSHKAKNFNFDRPAYLGGMP----RYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNH-CKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATIN--------------FRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            ++F +KT    G+L+        DFL + LIH G   ++ S        + +D      ++ D++WH +      L RN  + ++  V+ EE+  +    K ++       +LGG+P        +  +  I     ++G I    +NG +P+ +    +                 N  IC+ +H C NGG C    ++  CDCS T F+G+ C++  A +               +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R
Sbjct:   51 MSFNMKTKSAHGLLVYFDDEGFCDFLEL-LIHNGRLSLRFSIFCAEPATVFSDT-----AVNDSRWHAVT-----LRRNFKNTTL--VVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNGSEPVLIGSDGV-----------------NSDICEADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTR 350          
BLAST of neurexin-2-like vs. Ensembl Xenopus
Match: gldc (glycine decarboxylase [Source:Xenbase;Acc:XB-GENE-1221322])

HSP 1 Score: 282.722 bits (722), Expect = 1.383e-77
Identity = 275/1128 (24.38%), Postives = 463/1128 (41.05%), Query Frame = 1
Query:  166 ASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNK-AQKGYDLK------IVIEEDDIIIYKK-SFSTLSLFVKTRFLSIGGLSN-------PVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYF-----HRSKNNDHFISVEARDRQLI---------IGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY-SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQID-----------NSRSE-----LERTDLNLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            + I  S + + + F+T Q + ++ ++G   +   ++     +  +  LG  A+                L+    G FNDN WH V+  R+L + A  G+ L       + I  D I+     +    ++     F  IGG  N       PV    NF+GCL  V+YK ++  L++     +   G  ++         C+  +   +P++F +  SF+ L  + +  +   +   F+    S ++ F      R    D+F +VE  +  L          I +   HK +    E C +DI+R        D   G   +   N      F +   S+  +DL    + ++ LG           P EVW A+L  GF GCI  + ++ +  D++R     +L  +      C   T       + +  SSPC N G C   W    C+C  T Y G  C +    + +DG+ ++++ L    +TE E + +RF +    G LL+    + +     E +   + L++    + ++  P    +       ++D +WH++ + R  + L L++D   ++                      G +  + T L    L  G                    I T       L  NF+G +  LR N    +D             +++ ++N  A   + ++   V F T  AYL + +L  Y S  L F  +    DG+LL   G   DF+ +EL+ G I   F++G+   ++  N      L DN+WH + ISR     NV +L ID      VT H S  A N +     Y+GG+PR  Y    + + S  GFQGC+A   +NG+ P  LL  ++  +       +   C    T C +  C N G CLQQ++  +CDC+ T++ G  C     T  F +  A    I   +    R ++R D +A G  T++ D  ++ V+S     GD++ L ++ G + + +++G   + + +    VSDG Y  VR  R G +A LQ+D           N  SE      +R    LGR               FN Q+ I +G    K +G+ F G ISGL +NG+K+
Sbjct:  299 SPIQSSADEITLSFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFE--------------ALVEPVNGKFNDNSWHDVRVTRNLRQHAGIGHALVNKLHYLVTISVDGILTSTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPV--SNNFMGCLKDVVYKNNDFKLELSRLASE---GDPKMRLSGDLVFRCEN-VPSLDPVTFQNPNSFLRLP-RWETKKAGSISFDFRTTEPSGLLLFSQGRPRRQPKADYF-AVELLEGTLYLLLDLGSGGIKVKASHKKIN-DGEWCHVDIQR--------DGRKGSISVNSRN----TPFQVGGESEI-LDL----DGDMYLGGLPEPREDLQLPPEVWTASLGLGFVGCIRDLFVDGKSRDIRRL---AELPGAPGLAPFCTRET-------QRQCTSSPCRNGGQCREGWNRYICDCVGTGYLGDSCEREAAVLSYDGTMYLKVLLPGVSHTEAEDVSLRFMSQRAYGLLLATTSKESADTLRLELDGGKVKLTVNLDCIRIVCGPSKGPETLFAGQKLNDNEWHTVRVLRRGKYLQLSVDNVTVE----------------------GHMAGDHTRLELHHLETG--------------------IMTERRFVSALPSNFLGHLTALRYNGAPYLDMC--------QDGELRCELNTRAGSLRPILADPVVFQTGPAYLALPQLQAYASMHLLFMFRGRNPDGLLLYNGGQGPDFIAVELVKGYIHYVFDLGNGPSLMKGNSER--PLNDNQWHSVAISR--DPGNVHTLRIDG---RTVTQH-STGASNLDLKGELYIGGLPRNMYATLPKLVASRDGFQGCLASVDLNGRLP-ELLNDALHRV-----GPVERGCDGPSTTCSEESCGNLGVCLQQWDGFTCDCTMTSYGGPLCNDPGTTYIFGKGGA---LITYTWPPNDRPSTRADRLAVGFTTQQKDAVLLRVDSA-TGLGDYLQLHIDQGTVGVIFNVGTDDITIEEPGALVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNPDSERLALARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAEIKVGG---KDQGRPFQGQISGLYYNGLKV 1305          

HSP 2 Score: 91.2781 bits (225), Expect = 8.961e-18
Identity = 151/677 (22.30%), Postives = 271/677 (40.03%), Query Frame = 1
Query: 1375 SSPCANQGYCENYWP-EISCNCDFTNYKGRIC----------NKGTRAIEF----------------------DGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQL-HIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY---------SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN-----DFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP------RYEYQKWTEYIFSNYGFQGCIAGFSINGK-KPINLLQYSIVEIPDVYKSQIAHNC-QSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMG-----AGIMKLTD---LSIKVSDGFYRRVRVRRLGSSAWLQIDN 3201
            ++PC N G C +    E+ C+C  T Y G  C          N+G  +I F                       G+EF   DL  +   +  + I + F T+   G +L    S      +  + LS+++G + L+I   S   E  +  +    +D  WH + ++RN R  +    G  L  ++++     + I    I    G    + T+L      +IG S    D     P SP              +  NF+G +  +   + D     + L+RL+       ++ +P    S  +V+          VTF  P ++L + +     + S++F  +T +  G+LL   G        D+  +EL+ G + L  ++GS   I     H    + D +W  ++I R D  +  +S     V           +++  + D   YLGG+P      +   + WT  +    GF GCI    ++GK + I  L     E+P      +A  C +     C  + C+NGGQC + + +  CDC  T + G  C + +A +++   +    Y+++       +T  +D++    +++  G ++   S  K+  D + L L+ GK+ L  ++       G  K  +      K++D  +  VRV R G    L +DN
Sbjct:  214 ANPCLNGGRCRDEEEGEVRCDCRDTGYHGENCSEVPAHLTLSNQGMDSIHFFFNSLPIPSFLFSRKEEYAATFRGNEFFCYDLSHSPIQSSADEITLSFRTLQRNGLMLHTGKS------ADYVNLSLKSGAVWLVINLGSGAFEALVEPVNGKFNDNSWHDVRVTRNLRQHAGI--GHALVNKLHY----LVTISVDGILTSTGYTQEDYTMLGSDDFFYIGGSPNTADL----PGSP--------------VSNNFMGCLKDVVYKNNDF---KLELSRLA-------SEGDPKMRLSGDLVFRCENVPSLDPVTFQNPNSFLRLPRWETKKAGSISFDFRTTEPSGLLLFSQGRPRRQPKADYFAVELLEGTLYLLLDLGSG-GIKVKASHKK--INDGEWCHVDIQR-DGRKGSIS-----VNSRNTPFQVGGESEILDLDGDMYLGGLPEPREDLQLPPEVWTASL--GLGFVGCIRDLFVDGKSRDIRRL----AELPGA--PGLAPFCTRETQRQCTSSPCRNGGQCREGWNRYICDCVGTGYLGDSCEREAAVLSYDGTM----YLKVLLPG-VSHTEAEDVSLRFMSQRAYGLLLATTS--KESADTLRLELDGGKVKLTVNLDCIRIVCGPSKGPETLFAGQKLNDNEWHTVRVLRRGKYLQLSVDN 826          
BLAST of neurexin-2-like vs. Ensembl Xenopus
Match: gldc (glycine decarboxylase [Source:Xenbase;Acc:XB-GENE-1221322])

HSP 1 Score: 283.108 bits (723), Expect = 1.435e-77
Identity = 275/1129 (24.36%), Postives = 463/1129 (41.01%), Query Frame = 1
Query:  166 ASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNK-AQKGYDLK------IVIEEDDIIIYKK-SFSTLSLFVKTRFLSIGGLSN-------PVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYF------HRSKNNDHFISVEARDRQLI---------IGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY-SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQID-----------NSRSE-----LERTDLNLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            + I  S + + + F+T Q + ++ ++G   +   ++     +  +  LG  A+                L+    G FNDN WH V+  R+L + A  G+ L       + I  D I+     +    ++     F  IGG  N       PV    NF+GCL  V+YK ++  L++     +   G  ++         C+  +   +P++F +  SF+ L  + +  +   +   F+    S ++ F       R    D+F +VE  +  L          I +   HK +    E C +DI+R        D   G   +   N      F +   S+  +DL    + ++ LG           P EVW A+L  GF GCI  + ++ +  D++R     +L  +      C   T       + +  SSPC N G C   W    C+C  T Y G  C +    + +DG+ ++++ L    +TE E + +RF +    G LL+    + +     E +   + L++    + ++  P    +       ++D +WH++ + R  + L L++D   ++                      G +  + T L    L  G                    I T       L  NF+G +  LR N    +D             +++ ++N  A   + ++   V F T  AYL + +L  Y S  L F  +    DG+LL   G   DF+ +EL+ G I   F++G+   ++  N      L DN+WH + ISR     NV +L ID      VT H S  A N +     Y+GG+PR  Y    + + S  GFQGC+A   +NG+ P  LL  ++  +       +   C    T C +  C N G CLQQ++  +CDC+ T++ G  C     T  F +  A    I   +    R ++R D +A G  T++ D  ++ V+S     GD++ L ++ G + + +++G   + + +    VSDG Y  VR  R G +A LQ+D           N  SE      +R    LGR               FN Q+ I +G    K +G+ F G ISGL +NG+K+
Sbjct:  254 SPIQSSADEITLSFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFE--------------ALVEPVNGKFNDNSWHDVRVTRNLRQHAGIGHALVNKLHYLVTISVDGILTSTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPV--SNNFMGCLKDVVYKNNDFKLELSRLASE---GDPKMRLSGDLVFRCEN-VPSLDPVTFQNPNSFLRLP-RWETKKAGSISFDFRTTEPSGLLLFSQGRPPERQPKADYF-AVELLEGTLYLLLDLGSGGIKVKASHKKIN-DGEWCHVDIQR--------DGRKGSISVNSRN----TPFQVGGESEI-LDL----DGDMYLGGLPEPREDLQLPPEVWTASLGLGFVGCIRDLFVDGKSRDIRRL---AELPGAPGLAPFCTRET-------QRQCTSSPCRNGGQCREGWNRYICDCVGTGYLGDSCEREAAVLSYDGTMYLKVLLPGVSHTEAEDVSLRFMSQRAYGLLLATTSKESADTLRLELDGGKVKLTVNLDCIRIVCGPSKGPETLFAGQKLNDNEWHTVRVLRRGKYLQLSVDNVTVE----------------------GHMAGDHTRLELHHLETG--------------------IMTERRFVSALPSNFLGHLTALRYNGAPYLDMC--------QDGELRCELNTRAGSLRPILADPVVFQTGPAYLALPQLQAYASMHLLFMFRGRNPDGLLLYNGGQGPDFIAVELVKGYIHYVFDLGNGPSLMKGNSER--PLNDNQWHSVAISR--DPGNVHTLRIDG---RTVTQH-STGASNLDLKGELYIGGLPRNMYATLPKLVASRDGFQGCLASVDLNGRLP-ELLNDALHRV-----GPVERGCDGPSTTCSEESCGNLGVCLQQWDGFTCDCTMTSYGGPLCNDPGTTYIFGKGGA---LITYTWPPNDRPSTRADRLAVGFTTQQKDAVLLRVDSA-TGLGDYLQLHIDQGTVGVIFNVGTDDITIEEPGALVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNPDSERLALARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAEIKVGG---KDQGRPFQGQISGLYYNGLKV 1261          

HSP 2 Score: 103.99 bits (258), Expect = 9.937e-22
Identity = 150/648 (23.15%), Postives = 270/648 (41.67%), Query Frame = 1
Query: 1375 SSPCANQGYCENYWP-EISCNCDFTNYKGRICNKGTR--AIEFDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQL-HIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY---------SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISG------TSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP------RYEYQKWTEYIFSNYGFQGCIAGFSINGK-KPINLLQYSIVEIPDVYKSQIAHNC-QSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMG-----AGIMKLTD---LSIKVSDGFYRRVRVRRLGSSAWLQIDN 3201
            ++PC N G C +    E+ C+C  T Y G  C++G    A  F G+EF   DL  +   +  + I + F T+   G +L    S      +  + LS+++G + L+I   S   E  +  +    +D  WH + ++RN R  +    G  L  ++++     + I    I    G    + T+L      +IG S    D     P SP              +  NF+G +  +   + D     + L+RL+       ++ +P    S  +V+          VTF  P ++L + +     + S++F  +T +  G+LL   G         D+  +EL+ G + L  ++GS   I     H    + D +W  ++I R D  +  +S     V           +++  + D   YLGG+P      +   + WT  +    GF GCI    ++GK + I  L     E+P      +A  C +     C  + C+NGGQC + + +  CDC  T + G  C + +A +++   +    Y+++       +T  +D++    +++  G ++   S  K+  D + L L+ GK+ L  ++       G  K  +      K++D  +  VRV R G    L +DN
Sbjct:  199 ANPCLNGGRCRDEEEGEVRCDCRDTGYHGENCSEGKEEYAATFRGNEFFCYDLSHSPIQSSADEITLSFRTLQRNGLMLHTGKS------ADYVNLSLKSGAVWLVINLGSGAFEALVEPVNGKFNDNSWHDVRVTRNLRQHAGI--GHALVNKLHY----LVTISVDGILTSTGYTQEDYTMLGSDDFFYIGGSPNTADL----PGSP--------------VSNNFMGCLKDVVYKNNDF---KLELSRLA-------SEGDPKMRLSGDLVFRCENVPSLDPVTFQNPNSFLRLPRWETKKAGSISFDFRTTEPSGLLLFSQGRPPERQPKADYFAVELLEGTLYLLLDLGSG-GIKVKASHKK--INDGEWCHVDIQR-DGRKGSIS-----VNSRNTPFQVGGESEILDLDGDMYLGGLPEPREDLQLPPEVWTASL--GLGFVGCIRDLFVDGKSRDIRRL----AELPGA--PGLAPFCTRETQRQCTSSPCRNGGQCREGWNRYICDCVGTGYLGDSCEREAAVLSYDGTM----YLKVLLPG-VSHTEAEDVSLRFMSQRAYGLLLATTS--KESADTLRLELDGGKVKLTVNLDCIRIVCGPSKGPETLFAGQKLNDNEWHTVRVLRRGKYLQLSVDN 782          
BLAST of neurexin-2-like vs. Ensembl Xenopus
Match: gldc (glycine decarboxylase [Source:Xenbase;Acc:XB-GENE-1221322])

HSP 1 Score: 283.108 bits (723), Expect = 1.665e-77
Identity = 275/1129 (24.36%), Postives = 463/1129 (41.01%), Query Frame = 1
Query:  166 ASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNK-AQKGYDLK------IVIEEDDIIIYKK-SFSTLSLFVKTRFLSIGGLSN-------PVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYF------HRSKNNDHFISVEARDRQLI---------IGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY-SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQID-----------NSRSE-----LERTDLNLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            + I  S + + + F+T Q + ++ ++G   +   ++     +  +  LG  A+                L+    G FNDN WH V+  R+L + A  G+ L       + I  D I+     +    ++     F  IGG  N       PV    NF+GCL  V+YK ++  L++     +   G  ++         C+  +   +P++F +  SF+ L  + +  +   +   F+    S ++ F       R    D+F +VE  +  L          I +   HK +    E C +DI+R        D   G   +   N      F +   S+  +DL    + ++ LG           P EVW A+L  GF GCI  + ++ +  D++R     +L  +      C   T       + +  SSPC N G C   W    C+C  T Y G  C +    + +DG+ ++++ L    +TE E + +RF +    G LL+    + +     E +   + L++    + ++  P    +       ++D +WH++ + R  + L L++D   ++                      G +  + T L    L  G                    I T       L  NF+G +  LR N    +D             +++ ++N  A   + ++   V F T  AYL + +L  Y S  L F  +    DG+LL   G   DF+ +EL+ G I   F++G+   ++  N      L DN+WH + ISR     NV +L ID      VT H S  A N +     Y+GG+PR  Y    + + S  GFQGC+A   +NG+ P  LL  ++  +       +   C    T C +  C N G CLQQ++  +CDC+ T++ G  C     T  F +  A    I   +    R ++R D +A G  T++ D  ++ V+S     GD++ L ++ G + + +++G   + + +    VSDG Y  VR  R G +A LQ+D           N  SE      +R    LGR               FN Q+ I +G    K +G+ F G ISGL +NG+K+
Sbjct:  266 SPIQSSADEITLSFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFE--------------ALVEPVNGKFNDNSWHDVRVTRNLRQHAGIGHALVNKLHYLVTISVDGILTSTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPV--SNNFMGCLKDVVYKNNDFKLELSRLASE---GDPKMRLSGDLVFRCEN-VPSLDPVTFQNPNSFLRLP-RWETKKAGSISFDFRTTEPSGLLLFSQGRPPERQPKADYF-AVELLEGTLYLLLDLGSGGIKVKASHKKIN-DGEWCHVDIQR--------DGRKGSISVNSRN----TPFQVGGESEI-LDL----DGDMYLGGLPEPREDLQLPPEVWTASLGLGFVGCIRDLFVDGKSRDIRRL---AELPGAPGLAPFCTRET-------QRQCTSSPCRNGGQCREGWNRYICDCVGTGYLGDSCEREAAVLSYDGTMYLKVLLPGVSHTEAEDVSLRFMSQRAYGLLLATTSKESADTLRLELDGGKVKLTVNLDCIRIVCGPSKGPETLFAGQKLNDNEWHTVRVLRRGKYLQLSVDNVTVE----------------------GHMAGDHTRLELHHLETG--------------------IMTERRFVSALPSNFLGHLTALRYNGAPYLDMC--------QDGELRCELNTRAGSLRPILADPVVFQTGPAYLALPQLQAYASMHLLFMFRGRNPDGLLLYNGGQGPDFIAVELVKGYIHYVFDLGNGPSLMKGNSER--PLNDNQWHSVAISR--DPGNVHTLRIDG---RTVTQH-STGASNLDLKGELYIGGLPRNMYATLPKLVASRDGFQGCLASVDLNGRLP-ELLNDALHRV-----GPVERGCDGPSTTCSEESCGNLGVCLQQWDGFTCDCTMTSYGGPLCNDPGTTYIFGKGGA---LITYTWPPNDRPSTRADRLAVGFTTQQKDAVLLRVDSA-TGLGDYLQLHIDQGTVGVIFNVGTDDITIEEPGALVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNPDSERLALARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAEIKVGG---KDQGRPFQGQISGLYYNGLKV 1273          

HSP 2 Score: 97.4413 bits (241), Expect = 1.097e-19
Identity = 147/656 (22.41%), Postives = 267/656 (40.70%), Query Frame = 1
Query: 1375 SSPCANQGYCENYWP-EISCNCDFTNYKGRICNKGT-----------------RAIEFDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQL-HIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHV--VYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISG------TSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP------RYEYQKWTEYIFSNYGFQGCIAGFSINGK-KPINLLQYSIVEIPDVYKSQIAHNC-QSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMG-----AGIMKLTD---LSIKVSDGFYRRVRVRRLGSSAWLQIDN 3201
            ++PC N G C +    E+ C+C  T Y G  C++G                   A  F G+EF   DL  +   +  + I + F T+   G +L    S      +  + LS+++G + L+I   S   E  +  +    +D  WH + ++RN R  +    G  L  ++++     + I    I    G    + T+L      +IG S    D     P SP              +  NF+G +  +   + D   +   L    D + ++   +       ++V  +  VTF  P ++L + +     + S++F  +T +  G+LL   G         D+  +EL+ G + L  ++GS   I     H    + D +W  ++I R D  +  +S     V           +++  + D   YLGG+P      +   + WT  +    GF GCI    ++GK + I  L     E+P      +A  C +     C  + C+NGGQC + + +  CDC  T + G  C + +A +++   +    Y+++       +T  +D++    +++  G ++   S  K+  D + L L+ GK+ L  ++       G  K  +      K++D  +  VRV R G    L +DN
Sbjct:  196 ANPCLNGGRCRDEEEGEVRCDCRDTGYHGENCSEGECCYGNSMAFAHMLVREEYAATFRGNEFFCYDLSHSPIQSSADEITLSFRTLQRNGLMLHTGKS------ADYVNLSLKSGAVWLVINLGSGAFEALVEPVNGKFNDNSWHDVRVTRNLRQHAGI--GHALVNKLHY----LVTISVDGILTSTGYTQEDYTMLGSDDFFYIGGSPNTADL----PGSP--------------VSNNFMGCLKDVVYKNNDFKLELSRLASEGDPKMRLSGDL---VFRCENVPSLDPVTFQNPNSFLRLPRWETKKAGSISFDFRTTEPSGLLLFSQGRPPERQPKADYFAVELLEGTLYLLLDLGSG-GIKVKASHKK--INDGEWCHVDIQR-DGRKGSIS-----VNSRNTPFQVGGESEILDLDGDMYLGGLPEPREDLQLPPEVWTASL--GLGFVGCIRDLFVDGKSRDIRRL----AELPGA--PGLAPFCTRETQRQCTSSPCRNGGQCREGWNRYICDCVGTGYLGDSCEREAAVLSYDGTM----YLKVLLPG-VSHTEAEDVSLRFMSQRAYGLLLATTS--KESADTLRLELDGGKVKLTVNLDCIRIVCGPSKGPETLFAGQKLNDNEWHTVRVLRRGKYLQLSVDN 794          
BLAST of neurexin-2-like vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 267.7 bits (683), Expect = 1.540e-72
Identity = 272/1160 (23.45%), Postives = 484/1160 (41.72%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQK-GYDLK------IVIEEDDIIIYKK-SFSTLSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDV-----LDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYP--------EECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEII-------LGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSER---------QIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN---------SRSEL--------------ERTDLNLGRS---FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y+     +  I  S++ + + FKT+Q + ++ ++G   +   +A     +  +  LG  A+                ++      FNDN+WH+VK  R+L +    G+ +       + I  D I+     +    ++     F  +GG         +PV    NF+GCL +V+YK ++I L++     +  T+ K++G       + F   C+  +   +PISF S  +++ L  K        +   F+    + +I F   K  D             F +VE  D  L + + +    +            E C +DI+R           +G++             I  NT   P   +A   SEI+       LG      +    P+E+W A L  G+ GCI  + ++    ++++    +   Q+   +K         S CS+L  K   S PC N   C + W    C+C  T + GR C +    + +DG  ++++ +    +TE E + +RF +    G L++    D    ++ ++ L ++ G + L++     R         +       ++D +WH++ + R  + L L +D  + +                      G +  + T L +  +  G       +   + F+  V               +F+G +  L  N +  ID    L +  D  + +++A+    +I    +   VTF T  +YL +  L  Y S  L F  KT   DG +L  SG  NDF+ +EL+ G I   F++G+   ++  N      L DN+WH + I+R +   N  +L +D   + +V     + AKN +     Y+ G+ +  Y    + + S  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G C+QQ+E  +CDCS T++ G  C    AT  F +   S   I   +    R ++R D +A G  T   +G ++ ++S      D++ L +  GKI + +++G+  + + + S  V+DG Y  V+  R G +A LQ+DN           +EL              E    + GR    FN Q+ I IG       G+ F G +SGL +NG+K+
Sbjct:  257 GSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKSADYVNLALKGGAVSLVINLGSGAFE--------------AIVEPTNDKFNDNEWHEVKVTRNLRQHSGIGHAMVNKLHCLVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDIRLELSRLARIGDTKMKIYG------DVVFK--CEN-VATLDPISFESPEAYISLP-KWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQR-----------DGRSGT-----------ISVNTKRTP--FTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQ----LAEAQNAAGVK---------SSCSRLSGKQCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRD----SADTLRLELDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAE----------------------GTMVGDHTRLEFHNIETG-------FMTEKRFASAV-------------PSSFIGHLQSLMFNGLLYID----LCKNGDIDYCELKARFGMRSI----IADPVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSER--PLNDNQWHNVVITRDN--SNTHTLKVDTKAVTQVI----NGAKNLDLKGELYIAGLVQSMYSTLPKLVASRDGFQGCLASVDLNGRLP-DLIGDALHR-----SGQIERGCEGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGK---SGGLILYTWPHNDRPSTRTDRLAVGFSTTVKEGILVRIDSA-PGLMDYLQLHIVQGKIGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGGNTELHQKPKLPFKISRTPEDGQQDKGRPLTIFNTQAQIAIGG---MDRGRPFQGQLSGLYYNGLKV 1278          

HSP 2 Score: 111.694 bits (278), Expect = 4.300e-24
Identity = 157/714 (21.99%), Postives = 292/714 (40.90%), Query Frame = 1
Query: 1381 PCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFD------------GSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPS-DFSEF----NSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVN-FHSNEKLQIVWKSINIGFGAINSNETILSWQQL-HIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISG-------------TSNDFLLMELIHGGIKLSFNMGS-TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTD--------LSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSE---------LERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGI 3345
            PC N G C     E +C+C  T Y G+ C++G   +  D            GSE++  DL      +  + I + F T    G +L    S D+        + S+++++ +G    I++P +++         +D +WH + ++RN R  S      I    VN  H    + I    I    G    + T+L      ++G S    D     P SP              +  NF+G + ++   + DI  +   L R+ D + K+   V       ++V     ++F +P+AY+ + K +     S++F  +T + +G++L   G             T  DF  +EL+ G + L  +MGS T+++   N   +    D +W  ++I R   S  +       V  +      S +++  + +   YLGG+P          + WT  +  NYG+ GCI    I+G+   N+ Q +  +     KS  +         C    CKN   C   + +  CDC+ T   GR C + ++ +++   +    Y+++       +T  +D++   ++++  G  + V +  +D  D + L L+ GK+ L  ++    +               K++D  +  VRV R G +  L +D+  +E         LE  ++  G    ++   +  A P       F+G +  L+FNG+
Sbjct:  206 PCENGGACLLLDGEPTCDCTATGYVGKFCSEGLAHLMIDDQAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKSADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDK--------FNDNEWHEVKVTRNLRQHS-----GIGHAMVNKLHC--LVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDIRLELSRLARIGDTKMKIYGDV---VFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKAN----DGEWCHVDIQRDGRSGTI------SVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAML--NYGYVGCIRDLFIDGRSK-NIRQLAEAQNAAGVKSSCSRLSGKQ---CDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGM----YMKI-IMPVVMHTEAEDVSLRFKSQRAYG--LLVATTSRDSADTLRLELDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTEKR---FASAVP-----SSFIGHLQSLMFNGL 852          

HSP 3 Score: 81.6481 bits (200), Expect = 7.754e-15
Identity = 81/321 (25.23%), Postives = 140/321 (43.61%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMG-STVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLT-ICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNN--------YIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            L+F L+TN   G+LL    G   DFL + L  G ++L F++  +   I++D       + D  WH L +SR  L R  L L   +    EV     H     N     ++GG+P     +       +       AG+ ++       ++Y   E P +  S   H  + +L  +C +N C+NGG CL    + +CDC+ T + G+FC++  A +    Q    N        Y+          +S D+I    +TR+ +G I+          D+++L L+ G + L  ++G+G  +  +   + K +D  +  V+V R
Sbjct:   51 LSFQLRTNVSAGLLLYFDDGGICDFLCLSLADGHVQLRFSIDCAETAIVSDK-----KVNDGGWHFLMLSRNRL-RTTLVLD-GEAKPGEVRPQRQH----MNIVSDLFVGGVP--SDIRSGALTLGSVRDMSAFAGYLLD-------IKYGNTE-PRLLGS---HGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEGLAHLMIDDQAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHT----GKSADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDKFNDNEWHEVKVTR 343          
BLAST of neurexin-2-like vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 267.314 bits (682), Expect = 2.062e-72
Identity = 272/1160 (23.45%), Postives = 484/1160 (41.72%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQK-GYDLK------IVIEEDDIIIYKK-SFSTLSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDV-----LDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYP--------EECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEII-------LGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSER---------QIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN---------SRSEL--------------ERTDLNLGRS---FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y+     +  I  S++ + + FKT+Q + ++ ++G   +   +A     +  +  LG  A+                ++      FNDN+WH+VK  R+L +    G+ +       + I  D I+     +    ++     F  +GG         +PV    NF+GCL +V+YK ++I L++     +  T+ K++G       + F   C+  +   +PISF S  +++ L  K        +   F+    + +I F   K  D             F +VE  D  L + + +    +            E C +DI+R           +G++             I  NT   P   +A   SEI+       LG      +    P+E+W A L  G+ GCI  + ++    ++++    +   Q+   +K         S CS+L  K   S PC N   C + W    C+C  T + GR C +    + +DG  ++++ +    +TE E + +RF +    G L++    D ++    ++ L ++ G + L++     R         +       ++D +WH++ + R  + L L +D  + +                      G +  + T L +  +  G       +   + F+  V               +F+G +  L  N +  ID    L +  D  + +++A+    +I    +   VTF T  +YL +  L  Y S  L F  KT   DG +L  SG  NDF+ +EL+ G I   F++G+   ++  N      L DN+WH + I+R +   N  +L +D   + +V     + AKN +     Y+ G+ +  Y    + + S  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G C+QQ+E  +CDCS T++ G  C    AT  F +   S   I   +    R ++R D +A G  T   +G ++ ++S      D++ L +  GKI + +++G+  + + + S  V+DG Y  V+  R G +A LQ+DN           +EL              E    + GR    FN Q+ I IG       G+ F G +SGL +NG+K+
Sbjct:  267 GSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKSADYVNLALKGGAVSLVINLGSGAFE--------------AIVEPTNDKFNDNEWHEVKVTRNLRQHSGIGHAMVNKLHCLVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDIRLELSRLARIGDTKMKIYG------DVVFK--CEN-VATLDPISFESPEAYISLP-KWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQR-----------DGRSGT-----------ISVNTKRTP--FTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQ----LAEAQNAAGVK---------SSCSRLSGKQCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSAD----TLRLELDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAE----------------------GTMVGDHTRLEFHNIETG-------FMTEKRFASAV-------------PSSFIGHLQSLMFNGLLYID----LCKNGDIDYCELKARFGMRSI----IADPVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSER--PLNDNQWHNVVITRDN--SNTHTLKVDTKAVTQVI----NGAKNLDLKGELYIAGLVQSMYSTLPKLVASRDGFQGCLASVDLNGRLP-DLIGDALHR-----SGQIERGCEGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGK---SGGLILYTWPHNDRPSTRTDRLAVGFSTTVKEGILVRIDSA-PGLMDYLQLHIVQGKIGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGGNTELHQKPKLPFKISRTPEDGQQDKGRPLTIFNTQAQIAIGG---MDRGRPFQGQLSGLYYNGLKV 1288          

HSP 2 Score: 105.531 bits (262), Expect = 4.205e-22
Identity = 156/724 (21.55%), Postives = 290/724 (40.06%), Query Frame = 1
Query: 1381 PCANQGYCENYWPEISCNCDFTNYKGRICNKG----------------------TRAIEFDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPS-DFSEF----NSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVN-FHSNEKLQIVWKSINIGFGAINSNETILSWQQL-HIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISG-------------TSNDFLLMELIHGGIKLSFNMGS-TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTD--------LSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSE---------LERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGI 3345
            PC N G C     E +C+C  T Y G+ C++                            F GSE++  DL      +  + I + F T    G +L    S D+        + S+++++ +G    I++P +++         +D +WH + ++RN R  S      I    VN  H    + I    I    G    + T+L      ++G S    D     P SP              +  NF+G + ++   + DI  +   L R+ D + K+   V       ++V     ++F +P+AY+ + K +     S++F  +T + +G++L   G             T  DF  +EL+ G + L  +MGS T+++   N   +    D +W  ++I R   S  +       V  +      S +++  + +   YLGG+P          + WT  +  NYG+ GCI    I+G+   N+ Q +  +     KS  +         C    CKN   C   + +  CDC+ T   GR C + ++ +++   +    Y+++       +T  +D++   ++++  G  + V +  +D  D + L L+ GK+ L  ++    +               K++D  +  VRV R G +  L +D+  +E         LE  ++  G    ++   +  A P       F+G +  L+FNG+
Sbjct:  206 PCENGGACLLLDGEPTCDCTATGYVGKFCSEAHLQNGVVGPIFKTFCTSPAAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKSADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDK--------FNDNEWHEVKVTRNLRQHS-----GIGHAMVNKLHC--LVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDIRLELSRLARIGDTKMKIYGDV---VFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKAN----DGEWCHVDIQRDGRSGTI------SVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAML--NYGYVGCIRDLFIDGRSK-NIRQLAEAQNAAGVKSSCSRLSGKQ---CDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGM----YMKI-IMPVVMHTEAEDVSLRFKSQRAYG--LLVATTSRDSADTLRLELDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTEKR---FASAVP-----SSFIGHLQSLMFNGL 862          

HSP 3 Score: 75.485 bits (184), Expect = 5.731e-13
Identity = 80/331 (24.17%), Postives = 142/331 (42.90%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMG-STVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLT-ICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKV---------------SATINFRRQVAS---NNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            L+F L+TN   G+LL    G   DFL + L  G ++L F++  +   I++D       + D  WH L +SR  L R  L L   +    EV     H     N     ++GG+P     +       +       AG+ ++       ++Y   E P +  S   H  + +L  +C +N C+NGG CL    + +CDC+ T + G+FC++                ++       VA+   + Y+          +S D+I    +TR+ +G I+          D+++L L+ G + L  ++G+G  +  +   + K +D  +  V+V R
Sbjct:   51 LSFQLRTNVSAGLLLYFDDGGICDFLCLSLADGHVQLRFSIDCAETAIVSDK-----KVNDGGWHFLMLSRNRL-RTTLVLD-GEAKPGEVRPQRQH----MNIVSDLFVGGVP--SDIRSGALTLGSVRDMSAFAGYLLD-------IKYGNTE-PRLLGS---HGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEAHLQNGVVGPIFKTFCTSPAAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHT----GKSADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDKFNDNEWHEVKVTR 353          
BLAST of neurexin-2-like vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 313.153 bits (801), Expect = 8.975e-88
Identity = 277/1119 (24.75%), Postives = 487/1119 (43.52%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRS---FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +     +  ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  ++            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+D S   +ER     GR    FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  288 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEIQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVD-SWPVIER--YPAGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1277          
BLAST of neurexin-2-like vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 307.375 bits (786), Expect = 1.014e-85
Identity = 278/1146 (24.26%), Postives = 489/1146 (42.67%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +     +  ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  ++            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  288 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEIQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1307          
BLAST of neurexin-2-like vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 306.99 bits (785), Expect = 1.367e-85
Identity = 277/1141 (24.28%), Postives = 486/1141 (42.59%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +     +  ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  ++            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  288 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEIQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1299          

HSP 2 Score: 119.013 bits (297), Expect = 1.914e-26
Identity = 152/720 (21.11%), Postives = 296/720 (41.11%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE----------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN-------------DFLLMELIHGGIKLSFNMGS-TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIK----------VSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGR-SFN--EQSII----YIGASPIKKEGKQFVGLISGLIFNGI 3345
            C N G C     +  C+C  T ++G+ C++    +E                      F GSE+   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   L +  D + K+   V   A   ++V     +TF TP++++ + K +   + S++F  +T + +G++L   G                DF  +E++ G + L  +MGS T++I          + D +W+      +D  R+  S +I  V           +++  + D   YLGG+P       +  + WT  +  NYG+ GCI    I+G+   ++ Q + ++     K   +   +     C  N CKN G C   + +  CDCS T + GR C + +  +++   +    ++++Q      +T  +D++   ++++  G  I + +  +D  D + L L+ G++ L  ++    +++   S K          ++D  +  VRV R G S  L +D+ ++   +   +  R  F+  E  II    Y+ + P       F+G +  L FNG+
Sbjct:  228 CLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV---AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKK----VNDGEWY-----HVDFQRDGRSGTI-SVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALL--NYGYVGCIRDLFIDGQSK-DIRQMAEIQSTAGVKPSCS---KETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSM----FMKIQLP-VVMHTEAEDVSLRFRSQRAYG--ILMATTSRDSADTLRLELDAGRVKLTVNLDC--IRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVP-----SNFIGHLQSLTFNGM 869          
BLAST of neurexin-2-like vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 305.834 bits (782), Expect = 3.220e-85
Identity = 277/1141 (24.28%), Postives = 486/1141 (42.59%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +     +  ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  ++            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  288 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEIQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1299          

HSP 2 Score: 118.627 bits (296), Expect = 2.930e-26
Identity = 152/720 (21.11%), Postives = 296/720 (41.11%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE----------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN-------------DFLLMELIHGGIKLSFNMGS-TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIK----------VSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGR-SFN--EQSII----YIGASPIKKEGKQFVGLISGLIFNGI 3345
            C N G C     +  C+C  T ++G+ C++    +E                      F GSE+   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   L +  D + K+   V   A   ++V     +TF TP++++ + K +   + S++F  +T + +G++L   G                DF  +E++ G + L  +MGS T++I          + D +W+      +D  R+  S +I  V           +++  + D   YLGG+P       +  + WT  +  NYG+ GCI    I+G+   ++ Q + ++     K   +   +     C  N CKN G C   + +  CDCS T + GR C + +  +++   +    ++++Q      +T  +D++   ++++  G  I + +  +D  D + L L+ G++ L  ++    +++   S K          ++D  +  VRV R G S  L +D+ ++   +   +  R  F+  E  II    Y+ + P       F+G +  L FNG+
Sbjct:  228 CLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV---AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKK----VNDGEWY-----HVDFQRDGRSGTI-SVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALL--NYGYVGCIRDLFIDGQSK-DIRQMAEIQSTAGVKPSCS---KETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSM----FMKIQLP-VVMHTEAEDVSLRFRSQRAYG--ILMATTSRDSADTLRLELDAGRVKLTVNLDC--IRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVP-----SNFIGHLQSLTFNGM 869          
BLAST of neurexin-2-like vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 305.449 bits (781), Expect = 3.510e-85
Identity = 277/1141 (24.28%), Postives = 486/1141 (42.59%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +     +  ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  ++            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  284 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEIQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1295          

HSP 2 Score: 120.168 bits (300), Expect = 9.865e-27
Identity = 152/716 (21.23%), Postives = 296/716 (41.34%), Query Frame = 1
Query: 1384 CANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN-------------DFLLMELIHGGIKLSFNMGS-TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIK----------VSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGR-SFN--EQSII----YIGASPIKKEGKQFVGLISGLIFNGI 3345
            C N G C     +  C+C  T ++G+ C++    +E                  F GSE+   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   L +  D + K+   V   A   ++V     +TF TP++++ + K +   + S++F  +T + +G++L   G                DF  +E++ G + L  +MGS T++I          + D +W+      +D  R+  S +I  V           +++  + D   YLGG+P       +  + WT  +  NYG+ GCI    I+G+   ++ Q + ++     K   +   +     C  N CKN G C   + +  CDCS T + GR C + +  +++   +    ++++Q      +T  +D++   ++++  G  I + +  +D  D + L L+ G++ L  ++    +++   S K          ++D  +  VRV R G S  L +D+ ++   +   +  R  F+  E  II    Y+ + P       F+G +  L FNG+
Sbjct:  228 CLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV---AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKK----VNDGEWY-----HVDFQRDGRSGTI-SVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALL--NYGYVGCIRDLFIDGQSK-DIRQMAEIQSTAGVKPSCS---KETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSM----FMKIQLP-VVMHTEAEDVSLRFRSQRAYG--ILMATTSRDSADTLRLELDAGRVKLTVNLDC--IRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVP-----SNFIGHLQSLTFNGM 865          
BLAST of neurexin-2-like vs. UniProt/SwissProt
Match: sp|Q9ULB1|NRX1A_HUMAN (Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.112e-86
Identity = 278/1119 (24.84%), Postives = 486/1119 (43.43%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRS---FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +        ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  V+            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+D S   +ER     GR    FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  288 GSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEVQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVD-SWPVIER--YPAGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1277          

HSP 2 Score: 60.077 bits (144), Expect = 1.350e-7
Identity = 79/338 (23.37%), Postives = 140/338 (41.42%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGG-IKLSFNM--GSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP---RYEYQKWT-EYIFSNYGFQGCIAGFSINGKK--PINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCT------------------KVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            ++F LKT    G++L        DFL + L  GG ++LSF++       +L D       + D  WH + I R    RN  +L ID+V  + V + +  K ++       ++GG+P   R    K T   +     F+G I    +N  +  P++  +  + + P    S     C++     +   C NGG C    +QA CDCS T F G+ C+                  K      +      + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADT-----PVNDGAWHSVRIRRQ--FRNT-TLFIDQVEAKWVEVKS--KRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPP--NSGGGSPCEAGEEG-EGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTR 374          
BLAST of neurexin-2-like vs. UniProt/SwissProt
Match: sp|Q9CS84|NRX1A_MOUSE (Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 SV=3)

HSP 1 Score: 284.648 bits (727), Expect = 1.957e-77
Identity = 244/984 (24.80%), Postives = 429/984 (43.60%), Query Frame = 1
Query:  592 NFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +     +  ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  ++            T+ + PS CSK  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  440 NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEIQ-----------STAGVKPS-CSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1314          
BLAST of neurexin-2-like vs. UniProt/SwissProt
Match: sp|Q28146|NRX1A_BOVIN (Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 3.448e-77
Identity = 245/985 (24.87%), Postives = 429/985 (43.55%), Query Frame = 1
Query:  592 NFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSAL-FNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +     +  ++    Y +    D  +G         ISV       T+  P +   L  + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  V+            T+ + PS CS+  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  456 NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTA--PGESQILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEVQ-----------STAGVKPS-CSRETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGISCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1330          

HSP 2 Score: 110.538 bits (275), Expect = 6.425e-23
Identity = 168/810 (20.74%), Postives = 322/810 (39.75%), Query Frame = 1
Query: 1171 VKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLK-RSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSP-CANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE--------------------------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVN-FHSNEKLQIVWKSINIGFGAINSNETILSWQQL-HIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN-------------DFLLMELIHGGIKLSFNMGS-TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIK----------VSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGR-SFN--EQSII----YIGASPIKKEGKQFVGLISGLIFNGI 3345
            V   P E+  A L+       E+      + D++  S L++ +    + +     ++   S C   +      C N G C     +  C+C  T ++G+ C++    +E                                      F GSE+   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R  S      I    VN  H +  + +    I    G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   L +  D + K+   V   A   ++V     +TF TP++++ + K +   + S++F  +T + +G++L   G                DF  +E++ G + L  +MGS T++I          + D +W+      +D  R+  S +I  V           +++  + D   YLGG+P       +  + WT  +  NYG+ GCI    I+G+   ++ Q + V+     K   +   +     C  N CKN G C   + +  CDCS T + GR C + +  +++   +    ++++Q      +T  +D++   ++++  G  I + +  +D  D + L L+ G++ L  ++    +++   S K          ++D  +  VRV R G S  L +D+ ++   +   +  R  F+  E  II    Y+ + P       F+G +  L FNG+
Sbjct:  155 VGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSLALPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQTS-----GIGHAMVNKLHCSVTISV--DGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV---AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKK----VNDGEWY-----HVDFQRDGRSGTI-SVNTLRTPYTAPGESQILDLDDELYLGGLPENKAGLVFPTEVWTALL--NYGYVGCIRDLFIDGQSK-DIRQMAEVQSTAGVKPSCS---RETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSM----FMKIQLP-VVMHTEAEDVSLRFRSQRAYG--ILMATTSRDSADTLRLELDAGRVKLTVNLDC--IRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVP-----SNFIGHLQSLTFNGM 900          
BLAST of neurexin-2-like vs. UniProt/SwissProt
Match: sp|Q63372|NRX1A_RAT (Neurexin-1 OS=Rattus norvegicus OX=10116 GN=Nrxn1 PE=1 SV=3)

HSP 1 Score: 283.493 bits (724), Expect = 5.125e-77
Identity = 243/984 (24.70%), Postives = 429/984 (43.60%), Query Frame = 1
Query:  592 NFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+ L  K    +   +   F+    + +I F   K                F ++E  D  L + + +    +     +  ++    Y +    D  +G         ISV       T+    ++  L + E+ LG      +   FP+EVW A L  G+ GCI  + ++ +  D+ R +  ++            T+ + PS CS+  +K   S+PC N G C + W    C+C  T Y GR C +    + +DGS F+++ L    +TE E + +RF +    G L++    D +     E ++  + L++    + +        +      N++D +WH++ + R  ++L L +D    QQ +                   G +  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN                  G ++++   VTF T  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +   F++G+   ++  + +    L DN+WH + ISR D S N+ ++ ID  +  ++T      A+N +     Y+GG+ +  Y+   + + +  GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G CLQQ++  SCDCS T+F G  C     T  F +       I  ++    R ++R D +A G  T + +  ++ V+S     GD++ L +  GKI +++++G   + + + +  ++DG Y  VR  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    K++G+ F G +SGL +NG+K+
Sbjct:  456 NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPESFISLP-KWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGT--------ISVNTLRTPYTAPGESEILDL-DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDI-RQMAEIQ-----------STAGVKPS-CSRETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD---QQAMT------------------GQMAGDHTRLEFHNIETG--------------------IITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNA---------------RFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKP--LNDNQWHNVMISR-DTS-NLHTVKIDTKITTQITA----GARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLP-DLISDALF-----CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSK---GGGQITHKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGG---KEQGQPFQGQLSGLYYNGLKV 1330          
BLAST of neurexin-2-like vs. UniProt/SwissProt
Match: sp|A1XQY1|NR3BA_DANRE (Neurexin-3b OS=Danio rerio OX=7955 GN=nrxn3b PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.805e-76
Identity = 277/1136 (24.38%), Postives = 480/1136 (42.25%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQK-GYDLK------IVIEEDDIIIYKK-SFSTLSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQP-------ISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFN----ND-----ISVEK-----FIIFNTSDFPVDLSAL-----FNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN---------SRSELERTDLNLGR---------------------SFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                ++    G FNDN WH +K  R+L +    G+ +       + I  D I+     +    ++     F  +GG         +PV    NF+GCL +V+YK ++I L+        L   + I  P       I F   C+  +   +PISF +  SF+ L  K        +   F+    + +I F + K  D   S   R           +KV  +  E           ++L +D  +G  K+K      ND     + +++      I  N+   P   S           + LG      +    P+E+W A L  G+ GCI  + ++    D+++    +   Q+   IK         S CSK+ +K   S+ C N G C+  W    C+C  T Y  R C +    + +DGS ++++ + T  +TE E + +RF +    G L++      S  ++ ++ L +++G + LI+      +       V+D  WHS+ ++R  + + L +D  + +                      G +N + T L +  +  G                    I T          NF+G +  L+ N +  ID    + +  D ++ ++ A+    +I    V   VTF T  +YL +  L  Y +  L F  KT   DG +L  SG  NDF+ +EL+ G I   FN+G+   +L  N      L DN+WH + I+R D S N  +L +D   + +V     + AKN +     ++ G+    YQ   + +    GFQGC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G C+QQ+E  +CDCS T++ G  C    AT  F +       I   + +  R ++R D +A G  T   DG ++ ++S  +  GD+I L +E GK+ + +++G   + + +++ +V+DG Y  VR  R G +A LQ+DN           S++ER  +   +                      FN Q+ I IG +  K+    + G +SGL +NG+K+
Sbjct:  272 IQSSSDEITLSFKTWQRNGLILHTGKSADYVNLALKDGAVSLVINLGSGAFE--------------AIVEPVNGKFNDNAWHDIKVTRNLRQHSGIGHAMVNKLHCLVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDIRLE--------LSRLARIADPKMKLQGDIVFK--CEN-VPTLDPISFETAESFLGLP-KWNTKRVGSISFDFRTSEPNGLILFTQGKPQDKKDSRSQR----------SNKVDFFAVEL------LDGHLYLLLDMGSGTIKVKATQNKVNDGVWHHVDIQRDGRSGIISVNSRRTPFTASGENEILDLEGNLYLGGLPDNRADLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQ----IAEAQNVGGIK---------SSCSKVTAKQCDSNSCKNNGICKEGWNRFICDCTGTGYWDRTCEREASILSYDGSMYMKVVMPTIIHTEAEDVSLRFMSQRAFGLLMAAT----SRESADTLRLELDSGRVKLIVNLGKGPETLYAGQKVNDNDWHSVRVTRRGKNIKLMVDDDVAE----------------------GQMNGDHTRLEFSNVETG--------------------ILTERRFASTAPSNFIGHLQGLKFNGLLYID----MCKNGDIEFCELNARFGMRSI----VADPVTFKTKGSYLGLATLQAYSTMHLFFQFKTTSGDGFILFNSGDGNDFIAVELVKGYIHYVFNLGNGPSLLKGN--SDSPLNDNQWHNVVITR-DAS-NTHTLKVDAKSVSQVV----NGAKNLDLKGDLFVAGLGPNMYQNLPKLVVPREGFQGCLASMDLNGRLP-DLINDALFR-----SGQIERGCEGPSTTCQEDSCANMGVCIQQWENFTCDCSMTSYSGTQCNDPGATYIFGK---GGGLIMYTWPNNERPSTRTDRLAVGFSTTIKDGILVRIDSAPR-LGDYIMLHIEEGKVCVTFNIGTVDISVKEMTTEVNDGKYHVVRFTRNGGNATLQVDNWPINEHFPSGNSDIERFQMANKKIPFKYTRPVEDWLHEKDRQLTIFNTQATISIGGNDRKRP---YQGQLSGLYYNGLKV 1275          

HSP 2 Score: 75.485 bits (184), Expect = 2.704e-12
Identity = 80/328 (24.39%), Postives = 134/328 (40.85%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNY--GFQGCIAGFSINGKKPINLLQYSI-VEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTK-VSATINFRRQVAS-------------NNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            L+F  KT   D ++L    G   DFLL+ +    +KL F++      +T +      + D+ WH   ISR +L R VL+L  D   ++EV                 YLGG+P+           +     F+G I       K P  L    + +E+                  C +N C+NGG C     +A CDCS T + GR+C + V+ T  F   V S             + Y           +S D+I    +T + +G I+          D+++L L++G + L  ++G+G  +  +  ++ K +D  +  ++V R
Sbjct:   47 LSFQFKTAISDALVLYFDDGGYCDFLLLSIEDAKLKLRFSVDCAETTITSDKM----VNDSHWHFATISRHNL-RTVLALDGDS-KVDEVRPQRQF----MKIVSDLYLGGVPQDIRTSALTLPAAKEMPPFKGIITDLGYGNKVPTRLGSQKVRLEMEG---------------FCTENPCENGGSCSMADGEAYCDCSKTGYTGRYCNEAVNKTPGFAHMVKSPQAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHT----GKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDIKVTR 345          
BLAST of neurexin-2-like vs. TrEMBL
Match: G0WLR9 (Neurexin OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 3.801e-91
Identity = 268/1118 (23.97%), Postives = 495/1118 (44.28%), Query Frame = 1
Query:  118 TTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVK--TRFLSIGGLSN----PVFRMK-NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQP-QTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVE----KFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSL----------NLDGKILQQEVNF----HSN----EKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY-SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEG--KQFVGLISGLIFNGIKIPYVLEHK 3372
             T M  + + +N   +  +    + + ++F+TKQ + +LFY+G+  +   V      +     LG   Y        T+              F+DN+WH++   R   +  +   +  V  E D + Y+K  S    F++  +  L + G  N    P  R++ NF GCL KV Y+AD + LD+ D  +++ H   ++   + F K CQ+ +E  +P++F S  S + + T ++P     L   F+  +    ++Y +  +++  F ++E  D  L + + +   ++     +  +   R + +  Y ++        +  DISV+     F     SD   DL   F     +G   S  +    P E+W   L   + GC++ ++L+    DL    L+    Q+   + G Y     P      +  S PC + G C   W   SC+C  T + G +C      ++FDG++F+++ +  E  T+ E + +RF +++P+G L           N + + L ++ G L L +   S  ++  + + ++D +WH++ I R  + + L           L G       N+    H N    E   +  ++  +G  ++ +   +    Q   GA   +                 + SD        F+G +     N+           +++        +++      ++VV   VTF +  A+ ++  L  +  FS++  LKT + DG++L   G  NDF  +EL  G +   +NMG   Q +  N      + DNKWH   I R++    +L +  +   ++++T     K   F+ D   Y+GG+ +  Y    + ++S +GF GC+   ++NG  P N+L+    E   +++S +   C+  ++ C ++ C N G+C+QQ+    CDC  T+F G  C   S +  F        +  L   D   +T+ D++AFG +T   D  ++ ++S+  D  DFI + L +G + L Y+MG+    L D   KV+DG Y  VR  R G +A LQID    + +        +FN Q+ + IG + ++     + F G+ISGL+ NGI +  + +H+
Sbjct:  262 ATFMGTQYFSYNLSSRGDVMVDQDRVRLDFRTKQANSLLFYTGNSKDYMTVGLMDGAVFLTINLGSGMYQAEIRPSGTR--------------FDDNRWHQLLIQREARELPRDAGVCFVTMELDGM-YRKQGSITGKFIRLSSNLLYVAGSPNTETLPGSRVRTNFKGCLRKVRYRADGVLLDLTDLARRE-HSLMQVTGDVIFDK-CQELVES-HPVTFTSPESHLTIPTWSKPGIRGSLAFQFRTVEPGGLMMYSNGGRDSKDFFALELLDGHLYLVLDMGSGILKIQASKLPVSDGRPHDV--YFEFKG------YRGDISVDGQKVPFASGRVSDR-FDLHGFF----YVGGLGSEINASLLPRELWAVMLGLSYVGCLQDLVLDGSKVDL----LAAARLQNKSDVAG-YCKQTEP------QCVSHPCNHGGKCVEGWNRFSCDCRATGFVGAVCQTAAATLQFDGTQFMKVTMSRESVTQAEDVSLRFRSLHPSGLLFLTTGG-----NDNRMQLFLQQGTLFLSVNVGSGSKVLSVGHRLNDDRWHTVFIRRRVQTVELAIDSDRPVIDQLPGSTFSLATNYIFVGHKNPPGTEVADLPGRARELGLSSVEAGHMV----QDDSGAGTGH-----------------SGSDHS-----GFIGSMQAFIFNNNHFF-------QMAKSGTGDNIEISARFSSDEYVVRDPVTFKSVDAFAILPTLQAHEEFSVSLQLKTTESDGLILYNGGNENDFFALELFQGFLYYVYNMGEGAQRVKANVQHP--INDNKWHEARIFRVEKFTQLLRVDDNTPTVDDLT---GTKNNRFDLDGFLYIGGVRKTMYPSLPKLVYSRHGFVGCLGSLNLNGYLP-NVLR----EANPIHES-VGDGCRGPMSKCVNDSCANQGRCVQQWTSYKCDCDMTSFTGPMCKDESVSYKFGPGPGLMTFAHLA--DHEPSTNFDNLAFGFKTFLSDAILLRMDSRAYD--DFIQIELADGYVYLVYNMGSFDHPLGDFYHKVNDGQYHVVRFTRAGPNATLQIDADMPQTKHPTGKQAHTFNNQAFVRIGGTKVENGSITQHFEGIISGLVLNGINVFELAKHE 1284          

HSP 2 Score: 70.8626 bits (172), Expect = 2.021e-8
Identity = 70/308 (22.73%), Postives = 132/308 (42.86%), Query Frame = 1
Query: 2227 LYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP-RYEYQKWTEYIFSNY----GFQGCIAGF---SINGK--KPINLLQYSIVEIPDVYKSQIAHNCQSNLTIC-KDNHCKNGGQCLQQFEQASCDCSYTTFEGRFC--TKVSATINFRRQVASNNYIQLQFQDRTR-NTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK 3108
            L GSFS  F  +T++   +LL ++  S  +  ++L+ GGI+L  N+G    I+        +L DNKWH +E+ +      ++   I+        +H  +   N  F    YLGG+P  YE +K+      +      F+G +  F   S  G+  +P  L    ++               +++ +C + N C NGG+CL       CDC+ T + G  C   K+ +   F        Y       R      +D +    +T++ +  + +  + +    D++ + L +G + L  ++G+G+ +
Sbjct:   55 LNGSFSFEF--RTSEPLSLLLYLNRGSYSYFEVKLLKGGIRLRMNLGERTMII----RAGQNLNDNKWHSVEVVQDGDLTTLIVDGIEHSKTSSGLLHTYNGLANETF---LYLGGLPMEYESKKFNSLALPSVIFEPKFRGSVRNFFYRSCGGEAVRPQPLSSAGLL--------------TTDVDLCERGNPCLNGGRCLTTDNGVLCDCTATEYRGDRCDIQKIPSDATF----MGTQYFSYNLSSRGDVMVDQDRVRLDFRTKQANSLLFYTGNSK----DYMTVGLMDGAVFLTINLGSGMYQ 331          
BLAST of neurexin-2-like vs. TrEMBL
Match: A0A2T7PG26 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07803 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 4.316e-90
Identity = 270/1089 (24.79%), Postives = 485/1089 (44.54%), Query Frame = 1
Query:  199 IEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSN----PVFRM-KNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFH--RSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSY----SIHL-YVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIG---------------FGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSING-----KKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRN---TSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKE--GKQFVGLISGLIFNGIKI 3351
            ++F+TK  D +LFY+G++ +   +A     +I    LG  +                + +   G  F+DN WH+V   R   +        I +E D I   K S +     + ++ L + G  +    P  R+  NF GC+ KV Y+AD++ LD+ +  + + H   ++   + F K CQ+ + D  PI+F +  S++ +   +   E   L   FQ      ++ +    +  N    ++E  D  L       H V+    E   +   R      S H+ Y +Y   +  +    D   E F  F+  D   DL   F    I G   +   +   P+E+W  TL  G+ GC++ ++++    DL R+      +   +     Y   + P  C+     S PC +QG C   W   +C+C  T +   +C      + FDG +F+++ +  E +T+ E I +RF T++P G L        SE     + L +++G + L +   S  ++  + ++++D +WH+  I R  + + L +D   +Q+ V    +     V++S+++                   I+     L +++++IG  L+                     D K      F+G + +   N           N+  D     + +V      + HV++  VTF +  AY ++ +L ++  FS++F LKT + DG+L+   G   DF  ME+  G +   +NMG+  Q +  N +    L+DNKWH +++ R +  + +L +      +++++      A +F+     Y+GG+ +  Y    + + + +GF GCI    +NG      +  N +  S+V+            CQ+  + C+++ C NGG+C+QQ+   SCDC  T+F G  C  V +T  +R       Y  ++F     N   T+R+++A G +TR  D  ++ ++S   D  D+I L L  G I+  Y+MG     + ++  KV+DG Y  VR  R G ++ +Q+DN   + +        +FN Q+ +YIG    K +   + F G ISGL+ NGIKI
Sbjct:  283 LDFRTKHPDGLLFYTGNVKDYLNIAIRDGAIILAINLGSGSLE--------------REIRPSGPRFDDNLWHQVVVRREARE--------ISLEVDGIYQEKGSTTGNFKLLSSKALYVAGSPDTANLPGSRVNANFRGCMRKVRYRADSVELDLTELARAE-HALLKVIGGVIFDK-CQELV-DSRPITFTTPESYLTIPVWSAGPERGSLAFQFQTVEQHGVLLYSTGAASGNPDVFALELLDGYL-------HLVINMGSEPIRLKASRQPVTDGSPHMVYFEYAANRGYISV--DGQKETFSTFSHLD-RFDLQGSF---FIGGISKTAEEIP-LPTEMWAGTLGYGYVGCLQDMVVDGGRVDLVRAA-----QIQGVAGVAEYCQAMEP-HCT-----SRPCMHQGQCTEGWNRFTCDCRATGFIDSVCQTAAATLRFDGKQFVKVTVPEESHTQAEDISLRFRTMHPNGLLFMTT----SERAEDKMELYLKSGSIFLGVDVGSGHKVLSVGHSLNDDRWHTAYIKRRAQTVELKID---VQRPVTGRHSPCDSFVFQSLHLTKTFLCNRAPPCDLAFLTEISRRAAELEFRRVNIGDVLQ--------------------DDNKSNAFSGFIGSMQQFIFNR----------NQFFDMARSEKIEVTAKLSTNGHVMHDPVTFKSTDAYAVLPRLQIHDKFSISFQLKTTETDGLLMYNPGRGQDFFAMEMTGGFLYYVYNMGAGTQRIRANVNE--KLSDNKWHEVQLLRTETYKQLLRVDDKTPTVDDLS---GSSAIHFDLQGHLYIGGVRKTMYHTLPKKVEARFGFMGCIDSLYLNGYMANIHRDANPIHESVVD-----------GCQAPASQCQNDSCANGGRCVQQWNSFSCDCDMTSFSGPTCQAVEST-TYR---FGPGYGLIKFAHPAENLPSTNRENLALGFKTRSSDAVLVRIDSATYD--DYIELELNKGNIVAVYNMGTMDYPIGEMFDKVNDGKYHVVRFTRSGPNSTIQVDNLMMQTKMPRGQQAHTFNNQAFVYIGGKQEKNKTVSRPFQGTISGLVLNGIKI 1262          

HSP 2 Score: 139.043 bits (349), Expect = 3.025e-29
Identity = 147/640 (22.97%), Postives = 273/640 (42.66%), Query Frame = 1
Query: 1360 KLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICN--KGTRAIEFDGSEFIRLDL---GTEFYTEVESILIRFSTIYPTGYLL-SLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGS-FSLAFYLKTNQKDGVLLMISGTSN---DFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELER 3222
            +L  + +PC N G C      + C+C  T +KG  C+  K      F G+++   +L   G    +  +SI + F T +P G L  + N  D+       + ++I +G +IL I   S   ER+I        D  WH +++ R  R +SL +DG I Q++                    G+   N  +LS + L++  S          P +  +   + N+        NF G + K+R  +  +  D   L R      K+   V  +          +TF TP++YL +          SLAF  +T ++ GVLL  +G ++   D   +EL+ G + L  NMGS    L  +      + D   H++     + + N   +S+D    ++ T         F+     ++GG+ +         + W   +   YG+ GC+    ++G + ++L++ + ++      + +A  CQ+    C    C + GQC + + + +CDC  T F    C   +AT+ F        ++++   + + +T  +DI+   +T   +G +    S+R +  D + L+L++G I L  D+G+G  K+  +   ++D  +    ++R   +  L+ID  R    R
Sbjct:  211 ELCERGNPCLNGGVCLTTNSGLVCDCARTEFKGERCDLEKIPSDATFFGAQYFTYNLSGQGDGLVSNRDSISLDFRTKHPDGLLFYTGNVKDY-------LNIAIRDGAIILAINLGSGSLEREIRPSGPRFDDNLWHQVVVRREAREISLEVDG-IYQEK--------------------GSTTGNFKLLSSKALYVAGS----------PDTANLPGSRVNA--------NFRGCMRKVRYRADSVELDLTELARAEHALLKVIGGVIFDKCQELVDSRPITFTTPESYLTIPVWSAGPERGSLAFQFQTVEQHGVLLYSTGAASGNPDVFALELLDGYLHLVINMGSEPIRLKASRQ---PVTDGSPHMV---YFEYAANRGYISVDG---QKETFSTFSHLDRFDLQGSFFIGGISKTAEEIPLPTEMWAGTL--GYGYVGCLQDMVVDGGR-VDLVRAAQIQ----GVAGVAEYCQAMEPHCTSRPCMHQGQCTEGWNRFTCDCRATGFIDSVCQTAAATLRFD----GKQFVKVTVPEES-HTQAEDISLRFRTMHPNGLLFMTTSERAE--DKMELYLKSGSIFLGVDVGSG-HKVLSVGHSLNDDRWHTAYIKRRAQTVELKIDVQRPVTGR 780          
BLAST of neurexin-2-like vs. TrEMBL
Match: A0A2C9K884 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075983 PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.080e-87
Identity = 260/1071 (24.28%), Postives = 478/1071 (44.63%), Query Frame = 1
Query:  187 EILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLG--QLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVK--TRFLSIGGLSNPVF----RMK-NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQP-QTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEG-----KQFVGLISGLIFNGIKI 3351
            ++++++F+TKQ   +LFY+G+  +          +     LG  Q   N   +D +                F+DN+WH++   R   +  +   +  +  E D + Y+++ ST  ++V+  +  L + G  +       R+K NF GCL KV Y+AD+I +D+ +  +K+ HG  ++   + F K CQ+ +E   P++F +  +++ + T  +      L   F+  +    ++Y +  +++  F ++E  D  L +   +   +      +  +     + I  Y ++   K        ISV+       S    D   L     + G    +N V   P E+W   L   + GC++ +++N    DL   + + KL+     +  C      P++C+     S PC +QG C   W   +C+C  T Y G +C      + FDG++++++ L TE  T+ E I +RF +++P+G L           N   + L +++G L+L I+ +   +     + ++D +WH++ I R    + L +D +  +   +        +    I +G          L  Q   I               S +   +  N +   G    F+G +     N   +        +++    K   +++      + VV   VTF +  A+ ++ +L ++  FS++F  KT + DG++    GT  DF  MEL  G +   +NMG   + +  N +    L DNKWH + + R + ++ +L +  +   I+++T     K   F+   P ++GG+ + ++    + I S +GF GC+    +NG  P NLLQ +           +   C+  +T C ++ C N G+C+QQ+    CDC  T++ G  C + S +  F        +   + Q  + N   + +AFG QT + +  ++ V+S+    GD+I L L+ G + L Y+MG     L +   KV+DG Y  VR  R G +A LQID    +++        +FN Q+ I IG    KKE      + F G+ISGL+ NG+ I
Sbjct:  279 DMIMLDFRTKQPSSLLFYTGNAKDYITAGLIDGGVFLTVNLGSGQFEVNIRPADAR----------------FDDNRWHQLVIRRDAKELTRDKGVCYISVELDGM-YRETGSTSGIYVRLSSNVLYVAGSPHTSTLAGSRVKTNFKGCLRKVRYQADSIRIDLTELARKE-HGLLDVVGEVIFDK-CQELVES-QPVTFATPDAYLTVPTWDRSSMRGSLAFQFRTVEPGGLLMYSNGDRDSKDFFALELLDSHLYLIWDMGSGIQKIQASKVAVSDGNPHDI--YFEFYENKGY------ISVDGIKELFESKKYSDRFDLHGHLYVGGLDPEIN-VSSLPRELWAVMLGLNYIGCLQDLVVNGNQVDL---MAAAKLQNKTSVMGYCRKM---PAQCT-----SHPCNHQGKCIEGWNRFTCDCRATGYTGSVCQTADLTLRFDGTQYLKVTLATESITQAEDISLRFRSMHPSGLLFFTTGK-----NEDGMELYLDSGTLVLSIRVEGGVKTLTAGHTLNDDRWHTVFIKRRVHTVELTIDQE--RPVTDKIPGSTFSLATSRIYVGHVTPAVPNADLPSQAKDIALR------------SVEAGHMVQNDEGTSGRHSGFIGSMQSFIFNGNHLF-------QMAQSGSKDSIEISARFSSDEQVVREPVTFKSEDAFAILPRLQVHEKFSISFQFKTTESDGLIFYNDGTGQDFFAMELSQGYMYYVYNMGEGPEKIKANVNQP--LNDNKWHEVRLLRTETTKQLLRVDDNTPTIDDLT---GAKNNKFDLSGPLHVGGVHKVKFPSLPKLISSQHGFVGCLGSLDLNGYLP-NLLQQA-----SYIHEGVGDGCRGPMTKCVNDSCANQGRCVQQWTSYRCDCDMTSYTGPMCKEESVSYKFGPGPGLMTFTHPEGQQPSTNF--ETLAFGFQTFQDNAILLRVDSQNF-VGDYIQLELDKGYVFLIYNMGTIDHPLGNFYQKVNDGRYHVVRFTRHGPNATLQIDLEMPQVKNPTGQQSHTFNNQAYIRIGG---KKESNGSITRHFEGIISGLVLNGVHI 1266          
BLAST of neurexin-2-like vs. TrEMBL
Match: A0A2C9K885 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075983 PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 1.012e-86
Identity = 259/1071 (24.18%), Postives = 477/1071 (44.54%), Query Frame = 1
Query:  187 EILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLG--QLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVK--TRFLSIGGLSNPVF----RMK-NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQP-QTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEG-----KQFVGLISGLIFNGIKI 3351
            ++++++F+TKQ   +LFY+G+  +          +     LG  Q   N   +D +                F+DN+WH++   R   +  +   +  +  E D + Y+++ ST  ++V+  +  L + G  +       R+K NF GCL KV Y+AD+I +D+ +  +K+ HG  ++   + F K CQ+ +E   P++F +  +++ + T  +      L   F+  +    ++Y +  +++  F ++E  D  L +   +   +      +  +     + I  Y ++   K        ISV+       S    D   L     + G    +N V   P E+W   L   + GC++ +++N    DL   + + KL+     +  C      P++C+     S PC +QG C   W   +C+C  T Y G +C      + FDG++++++ L TE  T+ E I +RF +++P+G L           N   + L +++G L+L I+ +   +     + ++D +WH++ I R    + L +D +  +   +        +    I +G          L  Q   I               S +   +  N +   G    F+G +     N   +        +++    K   +++      + VV   VTF +  A+ ++ +L ++  FS++F  KT + DG++    GT  DF  MEL  G +   +NMG   + +  N +    L DNKWH + + R + ++ +L +  +   I+++T     K   F+   P ++GG+ + ++    + I S +GF GC+    +NG  P  L Q S +         +   C+  +T C ++ C N G+C+QQ+    CDC  T++ G  C + S +  F        +   + Q  + N   + +AFG QT + +  ++ V+S+    GD+I L L+ G + L Y+MG     L +   KV+DG Y  VR  R G +A LQID    +++        +FN Q+ I IG    KKE      + F G+ISGL+ NG+ I
Sbjct:  279 DMIMLDFRTKQPSSLLFYTGNAKDYITAGLIDGGVFLTVNLGSGQFEVNIRPADAR----------------FDDNRWHQLVIRRDAKELTRDKGVCYISVELDGM-YRETGSTSGIYVRLSSNVLYVAGSPHTSTLAGSRVKTNFKGCLRKVRYQADSIRIDLTELARKE-HGLLDVVGEVIFDK-CQELVES-QPVTFATPDAYLTVPTWDRSSMRGSLAFQFRTVEPGGLLMYSNGDRDSKDFFALELLDSHLYLIWDMGSGIQKIQASKVAVSDGNPHDI--YFEFYENKGY------ISVDGIKELFESKKYSDRFDLHGHLYVGGLDPEIN-VSSLPRELWAVMLGLNYIGCLQDLVVNGNQVDL---MAAAKLQNKTSVMGYCRKM---PAQCT-----SHPCNHQGKCIEGWNRFTCDCRATGYTGSVCQTADLTLRFDGTQYLKVTLATESITQAEDISLRFRSMHPSGLLFFTTGK-----NEDGMELYLDSGTLVLSIRVEGGVKTLTAGHTLNDDRWHTVFIKRRVHTVELTIDQE--RPVTDKIPGSTFSLATSRIYVGHVTPAVPNADLPSQAKDIALR------------SVEAGHMVQNDEGTSGRHSGFIGSMQSFIFNGNHLF-------QMAQSGSKDSIEISARFSSDEQVVREPVTFKSEDAFAILPRLQVHEKFSISFQFKTTESDGLIFYNDGTGQDFFAMELSQGYMYYVYNMGEGPEKIKANVNQP--LNDNKWHEVRLLRTETTKQLLRVDDNTPTIDDLT---GAKNNKFDLSGPLHVGGVHKVKFPSLPKLISSQHGFVGCLGSLDLNGYLPNLLQQASYIH------EGVGDGCRGPMTKCVNDSCANQGRCVQQWTSYRCDCDMTSYTGPMCKEESVSYKFGPGPGLMTFTHPEGQQPSTNF--ETLAFGFQTFQDNAILLRVDSQNF-VGDYIQLELDKGYVFLIYNMGTIDHPLGNFYQKVNDGRYHVVRFTRHGPNATLQIDLEMPQVKNPTGQQSHTFNNQAYIRIGG---KKESNGSITRHFEGIISGLVLNGVHI 1266          
BLAST of neurexin-2-like vs. TrEMBL
Match: A0A2C9K890 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075983 PE=4 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.201e-86
Identity = 263/1080 (24.35%), Postives = 483/1080 (44.72%), Query Frame = 1
Query:  187 EILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLG--QLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVK--TRFLSIGGLSNPVF----RMK-NFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQP-----YEFYDLK--LSFQPQTT---SFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEG-----KQFVGLISGLIFNGIKI 3351
            ++++++F+TKQ   +LFY+G+  +          +     LG  Q   N   +D +                F+DN+WH++   R   +  +   +  +  E D + Y+++ ST  ++V+  +  L + G  +       R+K NF GCL KV Y+AD+I +D+ +  +K+ HG  ++   + F K CQ+ +E   P++F +  +++ + T  +      Y F  ++  L+FQ +T      ++Y +  +++  F ++E  D  L +   +   +      +  +     + I  Y ++   K        ISV+       S    D   L     + G    +N V   P E+W   L   + GC++ +++N    DL   + + KL+     +  C      P++C+     S PC +QG C   W   +C+C  T Y G +C      + FDG++++++ L TE  T+ E I +RF +++P+G L           N   + L +++G L+L I+ +   +     + ++D +WH++ I R    + L +D +  +   +        +    I +G          L  Q   I               S +   +  N +   G    F+G +     N   +        +++    K   +++      + VV   VTF +  A+ ++ +L ++  FS++F  KT + DG++    GT  DF  MEL  G +   +NMG   + +  N +    L DNKWH + + R + ++ +L +  +   I+++T     K   F+   P ++GG+ + ++    + I S +GF GC+    +NG  P  L Q S +         +   C+  +T C ++ C N G+C+QQ+    CDC  T++ G  C + S +  F        +   + Q  + N   + +AFG QT + +  ++ V+S+    GD+I L L+ G + L Y+MG     L +   KV+DG Y  VR  R G +A LQID    +++        +FN Q+ I IG    KKE      + F G+ISGL+ NG+ I
Sbjct:  279 DMIMLDFRTKQPSSLLFYTGNAKDYITAGLIDGGVFLTVNLGSGQFEVNIRPADAR----------------FDDNRWHQLVIRRDAKELTRDKGVCYISVELDGM-YRETGSTSGIYVRLSSNVLYVAGSPHTSTLAGSRVKTNFKGCLRKVRYQADSIRIDLTELARKE-HGLLDVVGEVIFDK-CQELVES-QPVTFATPDAYLTVPTWDRSSGILFYIFDSMRGSLAFQFRTVEPGGLLMYSNGDRDSKDFFALELLDSHLYLIWDMGSGIQKIQASKVAVSDGNPHDI--YFEFYENKGY------ISVDGIKELFESKKYSDRFDLHGHLYVGGLDPEIN-VSSLPRELWAVMLGLNYIGCLQDLVVNGNQVDL---MAAAKLQNKTSVMGYCRKM---PAQCT-----SHPCNHQGKCIEGWNRFTCDCRATGYTGSVCQTADLTLRFDGTQYLKVTLATESITQAEDISLRFRSMHPSGLLFFTTGK-----NEDGMELYLDSGTLVLSIRVEGGVKTLTAGHTLNDDRWHTVFIKRRVHTVELTIDQE--RPVTDKIPGSTFSLATSRIYVGHVTPAVPNADLPSQAKDIALR------------SVEAGHMVQNDEGTSGRHSGFIGSMQSFIFNGNHLF-------QMAQSGSKDSIEISARFSSDEQVVREPVTFKSEDAFAILPRLQVHEKFSISFQFKTTESDGLIFYNDGTGQDFFAMELSQGYMYYVYNMGEGPEKIKANVNQP--LNDNKWHEVRLLRTETTKQLLRVDDNTPTIDDLT---GAKNNKFDLSGPLHVGGVHKVKFPSLPKLISSQHGFVGCLGSLDLNGYLPNLLQQASYIH------EGVGDGCRGPMTKCVNDSCANQGRCVQQWTSYRCDCDMTSYTGPMCKEESVSYKFGPGPGLMTFTHPEGQQPSTNF--ETLAFGFQTFQDNAILLRVDSQNF-VGDYIQLELDKGYVFLIYNMGTIDHPLGNFYQKVNDGRYHVVRFTRHGPNATLQIDLEMPQVKNPTGQQSHTFNNQAYIRIGG---KKESNGSITRHFEGIISGLVLNGVHI 1275          
BLAST of neurexin-2-like vs. Ensembl Cavefish
Match: ENSAMXT00000000309.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10525143:11115194:1 gene:ENSAMXG00000000283.2 transcript:ENSAMXT00000000309.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.975 bits (759), Expect = 1.894e-82
Identity = 289/1178 (24.53%), Postives = 489/1178 (41.51%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFT-----QKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH-------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYM-NGKAKLKFNNDISVEKFIIFNTSDFPVDLSAL-FNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSER---------QIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQ--------------IDNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKL 3444
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK +++ L++         + K+HG       ++F   C+  +   +PI+F +  +F+ L  K    +   +   F+    + ++ F   +                 F ++E  D  L + + +         +   I+ + +     +VD+  +G+A       ISV    I      P +   L  +  + LG      +   FP+EVW A L  GF GC+  + ++ +  D++R   S K             +T   S CSK   K   S+PC N G C   W    C C  T + GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++    D    ++ ++ L +E G + L I     R         +      N++D +WH++ + R  + L L++D               LQ            I  + T L +  +  G                    I T       +  NF+G +  L  N +  ID       DY  LN +               IG K ++   VTF +  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +    ++G+   ++  N +    L DN+WH + ISR   + N+ ++ ID     +VT   +  AKN +     Y+GG+ +  Y++  + + +  GFQGC+A   +NG+ P +L+  +I  +      QI   C+   T C+++ C N G CLQQ+E  SCDCS T+F G  C+    T  F R      Y      DR  +T  D +A G  T+  D  +I V+S     GD++ L +E G + + +++G   + + + +  V+DG Y  V+  R G +A LQ              IDN R  + R  +   LGR               FN Q+ I IG    +   + F G +SGL +NG+K+              +++ GD  I +   ++L
Sbjct:  258 GSEYFCYDLSQNPIQSSSDEITLSFKTMQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNDWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDVRLELSRVALQGDPKMKIHGV------VAFK--CEN-VATLDPITFETPEAFITLH-KWNAKKTGSISFDFRTTEPNGLLLFSHGRPKQQTKEAKSPLTLKVDFFAIEMLDGHLYLLLDMGSGTT----KTRAINKKVNDGEWNHVDFQRDGRA-----GTISVN--TIRTPYQAPGESEILDLDDNLYLGGLPENKAGLVFPTEVWTALLNYGFVGCVRDLFIDGQSKDVRRMAESQK-------------ATGVKSSCSKEAPKQCISNPCLNNGVCREGWNRYVCECSGTGFLGRSCERDATILSYDGSKFMKIQLPVAMHTEAEDVTLRFRSQRAYGVLMATTSRD----SADTLRLELETGRVRLTINLDCIRINCTTSKGPETLFAGQNLNDNEWHTVRVMRRGKNLQLSVD--------------DLQ-----------TITGDHTQLEFHNIETG--------------------IVTEKRYLSTVPSNFIGHLQSLVFNGMAYIDLCKNGDIDYCELNAM---------------IGFKSIIADPVTFKSRSSYISLTTLQAYYSMHLFFQFKTTSSDGLILYNSGDGNDFIVVELVKGYLHYVADLGNGAHLIKGNSNKP--LNDNQWHNVMISRD--TNNLHTVKIDT----KVTTQTTMGAKNLDLKGDLYIGGVAKEMYKELPKLVHAKEGFQGCLASMDLNGRLP-DLISDAITCV-----GQIERGCEGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTSFGGPLCSDAGTTYIFGRDGGRITYT-WPPNDRP-STRADRLALGFSTQLKDALLIRVDSS-SGLGDYLKLHIEKGNVAVIFNVGTDDINIEEKAKFVNDGKYHVVKFTRSGGNATLQVDDLPVIERYPTGNIDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWD-RDRSRSFQGQMSGLYYNGLKV------------FNMAVEGDPNIRIEGSVRL 1287          

HSP 2 Score: 132.494 bits (332), Expect = 1.086e-30
Identity = 167/786 (21.25%), Postives = 316/786 (40.20%), Query Frame = 1
Query: 1180 FPSEVWMATLRKGFQGCIEKVILNDEVFDLK-RSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAI------------EFDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN--------------DFLLMELIHGGIKLSFNMGS-TVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKN----FNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTI-----CKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTD--------LSIKVSDGFYRRVRVRRLGSSAWLQIDN------SRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGI 3345
             P E+    LR       E+V  N  + DLK  + +   L    +    C + T+              C N G C     + +C+C  T Y+G+ C++G   +             F GSE+   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   +    D + K+   V   A   ++V     +TF TP+A++ +HK +   + S++F  +T + +G+LL   G                 DF  +E++ G + L  +MGS T +    N      + D +W+ ++  R D     +S++         TI   ++A       + D   YLGG+P       +  + WT  +  NYGF GC+    I+G+           ++  + +SQ A   +S+ +      C  N C N G C + + +  C+CS T F GR C + +  +++      + ++++Q      +T  +D+    ++++  G ++   S  +D  D + L LE G++ L  ++    +  T             ++D  +  VRV R G +  L +D+        ++LE  ++  G    ++   Y+   P       F+G +  L+FNG+
Sbjct:  153 IPPELRTVALRLTSDAAKEQVPFNGWITDLKVNNSVPAILTSGGVDNNACGSETM--------------CLNGGVCSVVNDKPTCDCSETGYQGKDCSEGLAHMMMGDQGKEEYVATFKGSEYFCYDLSQNPIQSSSDEITLSFKTMQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNDWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRVALQGDPKMKIHGVV---AFKCENVATLDPITFETPEAFITLHKWNAKKTGSISFDFRTTEPNGLLLFSHGRPKQQTKEAKSPLTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAINKK----VNDGEWNHVDFQR-DGRAGTISVN---------TIRTPYQAPGESEILDLDDNLYLGGLPENKAGLVFPTEVWTALL--NYGFVGCVRDLFIDGQSK---------DVRRMAESQKATGVKSSCSKEAPKQCISNPCLNNGVCREGWNRYVCECSGTGFLGRSCERDATILSYD----GSKFMKIQLP-VAMHTEAEDVTLRFRSQRAYGVLMATTS--RDSADTLRLELETGRVRLTINLDCIRINCTTSKGPETLFAGQNLNDNEWHTVRVMRRGKNLQLSVDDLQTITGDHTQLEFHNIETGIVTEKR---YLSTVP-----SNFIGHLQSLVFNGM 836          

HSP 3 Score: 56.6102 bits (135), Expect = 1.755e-7
Identity = 78/368 (21.20%), Postives = 149/368 (40.49%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGGIKLSFNM--GSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDK-VMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYG-----FQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQ-----VAS---NNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLNLGRSFNEQSIIYIGASP 3285
            ++F +KT    G+L+        DFL + + +G + L F++     V + +D       + D++WH + I R   +    +L +D+ V   EV      K ++       +LGG+P  E +     + S+       F G I    +N   P  L    +                 N     +  C NGG C    ++ +CDCS T ++G+ C++  A +    Q     VA+   + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R      + +D   + +   + D  +          Y+G SP
Sbjct:   51 MSFNMKTKASQGLLVYFDDEGFCDFLELLMNNGKLNLRFSIFCAEPVTVFSD-----VVVNDSQWHGVTIKR---NFKNTTLVVDREVKWAEV----KSKRRDMTVFSRLFLGGIPP-ELRTVALRLTSDAAKEQVPFNGWITDLKVNNSVPAILTSGGV----------------DNNACGSETMCLNGGVCSVVNDKPTCDCSETGYQGKDCSEGLAHMMMGDQGKEEYVATFKGSEYFCYDLSQNPIQSSSDEITLSFKTMQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNDWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTM---LGSDDFFYVGGSP 382          
BLAST of neurexin-2-like vs. Ensembl Cavefish
Match: ENSAMXT00000011949.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20986441:21378525:-1 gene:ENSAMXG00000011628.2 transcript:ENSAMXT00000011949.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 287.73 bits (735), Expect = 1.766e-79
Identity = 271/1106 (24.50%), Postives = 470/1106 (42.50%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH--------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSAL-FNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ----------PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRS---FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L+ L    K+     ++   ++F   C+  +   +P++F +  SFV L +K    +   +   F+    + ++ F   K                  F ++E  D  L + + +             ++    Y +    D  +G         ISV    +    + P +   L  +  + LG      +   FP+EVW A L  G+ G I ++       + +R++ S  L                      L  KS+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++      S  ++ ++ L ++ G + L +            +    IF    N++D +WH++ + R  ++L L +D        +   +E             G I  + T L +  +  G              + K++M    S        NF+G +  L  N +  ID       DY  LN +               IG K +V   VTF +  +Y+ +  L  Y S  L    KT   DG++L   G  NDF+++EL+ G +    ++G+   ++  N +    L DN WH + ISR   + N+ ++ ID     ++T   +  AKN +     ++GG+ +  Y+   + + S  GFQGC+A   +NG+ P +LL  ++  +      Q+   C+   T C+++ C N G CLQQ+E  +CDCS T+F G  C     T  F R       I   +    R ++R D +A G  T++ D  ++ V+S     GD++ L +E G I + +++G   + + + S  V+DG Y  VR  R G +A LQ+D+    +ER     GR    FN Q+ I IG    ++  + F G +SGL +NG+K+
Sbjct:  273 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNAWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLE-LSRLAKQGDAKMKVSGIVAFK--CEN-VATLDPVTFETPESFVTL-SKWTAKKAGSISFDFRTTEPNGLLLFSHGKPKQQQQKDPKGPKTMKVDFFAIEMLDGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGT--------ISVNS--VRTPYNAPGESEILDLDDVLYLGGLPEDRAGLVFPTEVWTALLNYGYVGYIRRIA------EAQRAVGSSFL--------------------VALGKKSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIKLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SRNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFA-GQNLNDNEWHTVRVVRRGKSLKLMVD--------DLQPSE-------------GQITGDHTQLEFHNIETGI------------ITEKLYMPAVPS--------NFIGHLQGLGFNGMSYIDLCKNGDIDYCELNAM---------------IGYKSIVADPVTFKSRSSYVTLPTLQAYYSMHLFLQFKTTSPDGLILYNRGDGNDFIVVELVKGYMHYVSDLGNGAHLIKGNSN--TPLNDNHWHNVMISRD--TNNLHTVKIDT----KITTQTTMGAKNLDLKGDLFVGGVSKEMYKDLPKLVHSKEGFQGCLASVDLNGRLP-DLLSDALTTM-----GQVERGCEGPSTTCQEDSCSNQGVCLQQWEGFTCDCSMTSFGGPLCNDAGTTYIFGRD---GGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSS-SGLGDYLQLQIEKGNIRVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDD-LPVIER--YPTGRQLTIFNSQTTIKIGG--WERGSRPFQGQLSGLYYNGLKV 1236          

HSP 2 Score: 67.781 bits (164), Expect = 6.383e-11
Identity = 73/328 (22.26%), Postives = 139/328 (42.38%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMISGTS-NDFLLMELIHGGIKLSFNM--GSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP----RYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNH-CKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQ-------VAS---NNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRR 3168
            ++F +KT    G+L+        DFL + + +G I L F++       +L+D      ++ D++WH + + R    +N   +  D++   EV      K ++     P +LGG+P        +  +  I     ++G I    +N  +P  +    I                    +C+ +H C NGG C    +Q  CDCS T F+G+ C++  A +    Q       VA+   + Y           +S D+I    +T + +G ++          D+++L L+NG + L  ++G+G  +  +  ++ K +D  +  V+V R
Sbjct:   51 MSFNMKTKSSHGLLVYFDDEGFCDFLELLIHNGRISLRFSIFCAEPATVLSDT-----AVNDSRWHAVTVRRN--FKNTTLVVDDEIKWVEV----KSKRRDMTVFSPMFLGGIPPELRSVALRLTSASIKDQVPYKGWITNLKVNDSEPAIVSSDGITS-----------------NVCEADHVCLNGGVCSIVNDQPICDCSETGFQGKDCSEGLAHLMMADQGMVREEYVATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHT----GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTR 346          
BLAST of neurexin-2-like vs. Ensembl Cavefish
Match: nrxn3a (neurexin 3 [Source:NCBI gene;Acc:103035103])

HSP 1 Score: 271.166 bits (692), Expect = 5.504e-74
Identity = 268/1112 (24.10%), Postives = 467/1112 (42.00%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQ-QEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNC---------QSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRS---FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                ++    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK ++I L+ L    + +    +I   + F   C+  +   +PISF +  +++ L  K        +   F+    + +I F   K  D             F +VE  D  L + + +    +     +  ++    Y + +  D  +G   +          F     S+  +DL      ++ LG      +    P+E+W A L  G+ GCI  + ++    D+++    +   Q+   IK        PS C+K+  K   S PC N+G C+  W    C+C  T Y  R C +    + +DGS ++++ + T  +TE E + +RF +    G L++    D +     E + S + L++    + +        +       ++D +WH++ + R  ++  L +D  + + Q V  H+  +        NI  G +     +      HI +S                                F+G +  L+ N +  ID    L +  D  + ++ A+    +I    +   VTF    +YL +  L  Y S  L F  KT   DG++L  SG  NDF+ +EL+ G I   F++G+   ++  N      L DN+WH + I+R +   N+ +L ID   + +V     + AKN +     Y+ G+    Y    + + S  GF+GC+A   +NG+ P +L+  ++         QI   C         Q   T C+++ C N G C+QQ+E  +CDCS T++ G  C     T  F +       I   +    R ++R D +  G  T   DG ++ ++S     GD++ L +E GKI + +++G   + + + SI V+DG Y  VR  R G +A LQ+DN            GR    FN Q+ I IG +  K+    F G +SGL +NG+K+
Sbjct:  263 GSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKSADYVNLALKDGAVSLVINLGSGAFE--------------AIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDIRLE-LSRLARIVDPKMKIQGDVVFK--CEN-VATLDPISFETPEAYISLP-KWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRR----TPFTASGESEI-LDLEG----DMYLGGLPDNRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQ----IAEAQNGAGIK--------PS-CNKVSGKQCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSMYMKVVMPTVMHTEAEDVSLRFMSQRAYGLLMATTSRDSADTLRLELDGSRVKLTVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAEGQMVGDHTRLEFH------NIETGVMTERRFVS-----HIPSS--------------------------------FIGHLQSLKFNGLLYID----LCKNGDIDYCELNARFGMRSI----IADPVTFKAKSSYLSLATLQAYTSMHLFFQFKTTSADGIILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNLIKGNSDR--PLNDNQWHNVVITRDN--SNLHTLKIDAKAVSQVV----NGAKNLDLKGDLYIAGLGPNMYNSLPKLVASREGFKGCLASVDLNGRLP-DLINDALFR-----SGQIERGCEVGFIKADLQGPSTTCQEDSCANMGICIQQWENYTCDCSMTSYTGTQCNDPGTTYIFGK---GGGTITFNWPANERPSTRTDRLTVGFSTSLKDGILVRIDSA-PGLGDYLMLHIEQGKISVTFNIGTVDIIVQENSIPVNDGKYHVVRFTRNGGNATLQVDNWAIN---EHFPAGRQLTIFNTQATITIGGNDRKRP---FQGQLSGLYYNGLKV 1252          

HSP 2 Score: 108.227 bits (269), Expect = 3.399e-23
Identity = 156/724 (21.55%), Postives = 292/724 (40.33%), Query Frame = 1
Query: 1381 PCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE----------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISG-------------TSNDFLLMELIHGGIKLSFNMGS-TVQI-LTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYK-SQIAHNC-QSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTD--------LSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSE---------LERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGI 3345
            PC N G C     E  C+C  T Y GR C++   +I                       F GSE+   DL      +  + I + F T    G +L    S      +  + L++++G + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + DI  +   L R+ D + K+Q  V       ++V     ++F TP+AY+ + K +     S++F  +T++ +G++L   G             T  DF  +EL+ G + L  +MGS T+++  T N      + D  W+ ++I R   S  +       V         S +++  + +   YLGG+P          + WT  +  NYG+ GCI    I+G+         I +I +    + I  +C + +   C+   CKN G C + + +  CDC+ T +  R C + ++ +++   +    Y+++       +T  +D++    +++  G ++   S  +D  D + L L+  ++ L  ++    +               K++D  +  VRV R G S  L +D+  +E         LE  ++  G     + + +I +S        F+G +  L FNG+
Sbjct:  202 PCENGGICSLVDGEPLCDCSKTEYIGRFCSEEANSIPGLAHMMMADQAKSKAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKS------ADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDIRLELSRLARIVDPKMKIQGDV---VFKCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQN-----KVNDGAWYHVDIQRDGRSGTI------SVNSRRTPFTASGESEILDLEGDMYLGGLPDNRAGLILPTELWTAML--NYGYVGCIRDLFIDGR------SKDIRQIAEAQNGAGIKPSCNKVSGKQCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSM----YMKV-VMPTVMHTEAEDVSLRFMSQRAYGLLMATTS--RDSADTLRLELDGSRVKLTVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAEGQMVGDHTRLEFHNIETGVMTERRFVSHIPSS--------FIGHLQSLKFNGL 843          

HSP 3 Score: 62.003 bits (149), Expect = 4.468e-9
Identity = 81/380 (21.32%), Postives = 151/380 (39.74%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMG-STVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDR-------PAYLGGMPRYEYQKWTEYIFSN--YGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINF---------------RRQVAS---NNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLNLGRSFNEQSIIYIGASP 3285
            L+F  KT+    ++L    G   DFL + ++ G ++L F++  +   +++D       + D+ WH + + R +L R VL             +  ++KA      R         +LGG+P+           +     F+G I      G+K           +P +  SQ          IC +N C+NGG C     +  CDCS T + GRFC++ + +I                    VA+   + Y           +S D+I    +T + +G I+          D+++L L++G + L  ++G+G  +  +  ++ K +D  +  V+V R      + +D   + +   + D  +          Y+G SP
Sbjct:   47 LSFQFKTDASTALVLYFDDGGYCDFLQLMVVEGKLQLQFSIDCAETTVVSDK-----RVNDSSWHFVSLGRYNL-RTVLG------------VDGANKADEVRPQRQYMKIVSDLFLGGLPQDIRTSVLTLPTAKDLPPFKGIIRDLKY-GRK-----------VPTLLSSQKVRMDMEG--ICTENPCENGGICSLVDGEPLCDCSKTEYIGRFCSEEANSIPGLAHMMMADQAKSKAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHT----GKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTM---LGSDDFFYVGGSP 387          
BLAST of neurexin-2-like vs. Ensembl Cavefish
Match: nrxn3a (neurexin 3 [Source:NCBI gene;Acc:103035103])

HSP 1 Score: 270.781 bits (691), Expect = 6.279e-74
Identity = 266/1129 (23.56%), Postives = 471/1129 (41.72%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN---------SRSELERTDL------------------NLGRS---FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                ++    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK ++I L+ L    + +    +I   + F   C+  +   +PISF +  +++ L  K        +   F+    + +I F   K  D             F +VE  D  L + + +    +     +  ++    Y + +  D  +G   +          F     S+  +DL      ++ LG      +    P+E+W A L  G+ GCI  + ++    D+++    +   Q+   IK        PS C+K+  K   S PC N+G C+  W    C+C  T Y  R C +    + +DGS ++++ + T  +TE E + +RF +    G L++    D +     E + S + L++    + +        +       ++D +WH++ + R  ++  L +D  + +                      G +  + T L +  +  G   +       R F   +               +F+G +  L+ N +  ID    L +  D  + ++ A+    +I    +   VTF    +YL +  L  Y S  L F  KT   DG++L  SG  NDF+ +EL+ G I   F++G+   ++  N      L DN+WH + I+R +   N+ +L ID   + +V     + AKN +     Y+ G+    Y    + + S  GF+GC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G C+QQ+E  +CDCS T++ G  C     T  F +       I   +    R ++R D +  G  T   DG ++ ++S     GD++ L +E GKI + +++G   + + + SI V+DG Y  VR  R G +A LQ+DN           ++ ER  +                    GR    FN Q+ I IG +  K+    F G +SGL +NG+K+
Sbjct:  257 GSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKSADYVNLALKDGAVSLVINLGSGAFE--------------AIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDIRLE-LSRLARIVDPKMKIQGDVVFK--CEN-VATLDPISFETPEAYISLP-KWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRR----TPFTASGESEI-LDLEG----DMYLGGLPDNRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQ----IAEAQNGAGIK--------PS-CNKVSGKQCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSMYMKVVMPTVMHTEAEDVSLRFMSQRAYGLLMATTSRDSADTLRLELDGSRVKLTVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAE----------------------GQMVGDHTRLEFHNIETGVMTE-------RRFVSHI-------------PSSFIGHLQSLKFNGLLYID----LCKNGDIDYCELNARFGMRSI----IADPVTFKAKSSYLSLATLQAYTSMHLFFQFKTTSADGIILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNLIKGNSDRP--LNDNQWHNVVITRDN--SNLHTLKIDAKAVSQVV----NGAKNLDLKGDLYIAGLGPNMYNSLPKLVASREGFKGCLASVDLNGRLP-DLINDALFR-----SGQIERGCEGPSTTCQEDSCANMGICIQQWENYTCDCSMTSYTGTQCNDPGTTYIFGK---GGGTITFNWPANERPSTRTDRLTVGFSTSLKDGILVRIDSA-PGLGDYLMLHIEQGKISVTFNIGTVDIIVQENSIPVNDGKYHVVRFTRNGGNATLQVDNWAINEHFPAGNNDNERLQMANKKIPFKYARPVEEWLQEKGRQLTIFNTQATITIGGNDRKRP---FQGQLSGLYYNGLKV 1267          

HSP 2 Score: 109.768 bits (273), Expect = 1.016e-23
Identity = 156/719 (21.70%), Postives = 292/719 (40.61%), Query Frame = 1
Query: 1378 SPCANQGYCENYWPEISCNCDFTNYKGRICNKG----------------TRAIEFDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISG-------------TSNDFLLMELIHGGIKLSFNMGS-TVQI-LTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYK-SQIAHNC-QSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTD--------LSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSE---------LERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGI 3345
            +PC N G C     E  C+C  T Y GR C++G                     F GSE+   DL      +  + I + F T    G +L    S      +  + L++++G + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + DI  +   L R+ D + K+Q  V       ++V     ++F TP+AY+ + K +     S++F  +T++ +G++L   G             T  DF  +EL+ G + L  +MGS T+++  T N      + D  W+ ++I R   S  +       V         S +++  + +   YLGG+P          + WT  +  NYG+ GCI    I+G+         I +I +    + I  +C + +   C+   CKN G C + + +  CDC+ T +  R C + ++ +++   +    Y+++       +T  +D++    +++  G ++   S  +D  D + L L+  ++ L  ++    +               K++D  +  VRV R G S  L +D+  +E         LE  ++  G     + + +I +S        F+G +  L FNG+
Sbjct:  201 NPCENGGICSLVDGEPLCDCSKTEYIGRFCSEGLAHMMMADQGMPLSREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKS------ADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDIRLELSRLARIVDPKMKIQGDV---VFKCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQN-----KVNDGAWYHVDIQRDGRSGTI------SVNSRRTPFTASGESEILDLEGDMYLGGLPDNRAGLILPTELWTAML--NYGYVGCIRDLFIDGRSK------DIRQIAEAQNGAGIKPSCNKVSGKQCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSM----YMKV-VMPTVMHTEAEDVSLRFMSQRAYGLLMATTS--RDSADTLRLELDGSRVKLTVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAEGQMVGDHTRLEFHNIETGVMTERRFVSHIPSS--------FIGHLQSLKFNGL 837          

HSP 3 Score: 63.5438 bits (153), Expect = 1.595e-9
Identity = 82/374 (21.93%), Postives = 151/374 (40.37%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMG-STVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDR-------PAYLGGMPRYEYQKWTEYIFSN--YGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQ---------VAS---NNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLNLGRSFNEQSIIYIGASP 3285
            L+F  KT+    ++L    G   DFL + ++ G ++L F++  +   +++D       + D+ WH + + R +L R VL             +  ++KA      R         +LGG+P+           +     F+G I      G+K           +P +  SQ          IC +N C+NGG C     +  CDCS T + GRFC++  A +    Q         VA+   + Y           +S D+I    +T + +G I+          D+++L L++G + L  ++G+G  +  +  ++ K +D  +  V+V R      + +D   + +   + D  +          Y+G SP
Sbjct:   47 LSFQFKTDASTALVLYFDDGGYCDFLQLMVVEGKLQLQFSIDCAETTVVSDK-----RVNDSSWHFVSLGRYNL-RTVLG------------VDGANKADEVRPQRQYMKIVSDLFLGGLPQDIRTSVLTLPTAKDLPPFKGIIRDLKY-GRK-----------VPTLLSSQKVRMDMEG--ICTENPCENGGICSLVDGEPLCDCSKTEYIGRFCSEGLAHMMMADQGMPLSREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHT----GKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTM---LGSDDFFYVGGSP 381          
BLAST of neurexin-2-like vs. Ensembl Cavefish
Match: nrxn3a (neurexin 3 [Source:NCBI gene;Acc:103035103])

HSP 1 Score: 271.166 bits (692), Expect = 7.085e-74
Identity = 269/1130 (23.81%), Postives = 472/1130 (41.77%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI----EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQ-QEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN---------SRSELERTDL------------------NLGRS---FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y      +  I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                ++    G FNDN WH VK  R+L +     D  +      +ED  ++    F  +     T  L    +SN      NF+GCL +V+YK ++I L+ L    + +    +I   + F   C+  +   +PISF +  +++ L  K        +   F+    + +I F   K  D             F +VE  D  L + + +    +     +  ++    Y + +  D  +G   +          F     S+  +DL      ++ LG      +    P+E+W A L  G+ GCI  + ++    D+++    +   Q+   IK        PS C+K+  K   S PC N+G C+  W    C+C  T Y  R C +    + +DGS ++++ + T  +TE E + +RF +    G L++    D +     E + S + L++    + +        +       ++D +WH++ + R  ++  L +D  + + Q V  H+  +        NI  G +     +      HI +S                                F+G +  L+ N +  ID    L +  D  + ++ A+    +I    +   VTF    +YL +  L  Y S  L F  KT   DG++L  SG  NDF+ +EL+ G I   F++G+   ++  N      L DN+WH + I+R +   N+ +L ID   + +V     + AKN +     Y+ G+    Y    + + S  GF+GC+A   +NG+ P +L+  ++         QI   C+   T C+++ C N G C+QQ+E  +CDCS T++ G  C     T  F +       I   +    R ++R D +  G  T   DG ++ ++S     GD++ L +E GKI + +++G   + + + SI V+DG Y  VR  R G +A LQ+DN           ++ ER  +                    GR    FN Q+ I IG +  K+    F G +SGL +NG+K+
Sbjct:  263 GSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKSADYVNLALKDGAVSLVINLGSGAFE--------------AIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN------NFMGCLKEVVYKNNDIRLE-LSRLARIVDPKMKIQGDVVFK--CEN-VATLDPISFETPEAYISLP-KWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRR----TPFTASGESEI-LDLEG----DMYLGGLPDNRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQ----IAEAQNGAGIK--------PS-CNKVSGKQCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSMYMKVVMPTVMHTEAEDVSLRFMSQRAYGLLMATTSRDSADTLRLELDGSRVKLTVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAEGQMVGDHTRLEFH------NIETGVMTERRFVS-----HIPSS--------------------------------FIGHLQSLKFNGLLYID----LCKNGDIDYCELNARFGMRSI----IADPVTFKAKSSYLSLATLQAYTSMHLFFQFKTTSADGIILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNLIKGNSDRP--LNDNQWHNVVITRDN--SNLHTLKIDAKAVSQVV----NGAKNLDLKGDLYIAGLGPNMYNSLPKLVASREGFKGCLASVDLNGRLP-DLINDALFR-----SGQIERGCEGPSTTCQEDSCANMGICIQQWENYTCDCSMTSYTGTQCNDPGTTYIFGK---GGGTITFNWPANERPSTRTDRLTVGFSTSLKDGILVRIDSA-PGLGDYLMLHIEQGKISVTFNIGTVDIIVQENSIPVNDGKYHVVRFTRNGGNATLQVDNWAINEHFPAGNNDNERLQMANKKIPFKYARPVEEWLQEKGRQLTIFNTQATITIGGNDRKRP---FQGQLSGLYYNGLKV 1273          

HSP 2 Score: 108.227 bits (269), Expect = 3.503e-23
Identity = 156/724 (21.55%), Postives = 292/724 (40.33%), Query Frame = 1
Query: 1381 PCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE----------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISG-------------TSNDFLLMELIHGGIKLSFNMGS-TVQI-LTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYK-SQIAHNC-QSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTD--------LSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSE---------LERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGI 3345
            PC N G C     E  C+C  T Y GR C++   +I                       F GSE+   DL      +  + I + F T    G +L    S      +  + L++++G + L+I   S   E  +  +    +D  WH + ++RN R +++++DG +                        G    + T+L      ++G S    D     P SP              +  NF+G + ++   + DI  +   L R+ D + K+Q  V       ++V     ++F TP+AY+ + K +     S++F  +T++ +G++L   G             T  DF  +EL+ G + L  +MGS T+++  T N      + D  W+ ++I R   S  +       V         S +++  + +   YLGG+P          + WT  +  NYG+ GCI    I+G+         I +I +    + I  +C + +   C+   CKN G C + + +  CDC+ T +  R C + ++ +++   +    Y+++       +T  +D++    +++  G ++   S  +D  D + L L+  ++ L  ++    +               K++D  +  VRV R G S  L +D+  +E         LE  ++  G     + + +I +S        F+G +  L FNG+
Sbjct:  202 PCENGGICSLVDGEPLCDCSKTEYIGRFCSEEANSIPGLAHMMMADQAKSKAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKS------ADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTT---------------------GYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDIRLELSRLARIVDPKMKIQGDV---VFKCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQN-----KVNDGAWYHVDIQRDGRSGTI------SVNSRRTPFTASGESEILDLEGDMYLGGLPDNRAGLILPTELWTAML--NYGYVGCIRDLFIDGR------SKDIRQIAEAQNGAGIKPSCNKVSGKQCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSM----YMKV-VMPTVMHTEAEDVSLRFMSQRAYGLLMATTS--RDSADTLRLELDGSRVKLTVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAEGQMVGDHTRLEFHNIETGVMTERRFVSHIPSS--------FIGHLQSLKFNGL 843          

HSP 3 Score: 62.003 bits (149), Expect = 4.751e-9
Identity = 81/380 (21.32%), Postives = 151/380 (39.74%), Query Frame = 1
Query: 2245 LAFYLKTNQKDGVLLMIS-GTSNDFLLMELIHGGIKLSFNMG-STVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDR-------PAYLGGMPRYEYQKWTEYIFSN--YGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINF---------------RRQVAS---NNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMK--LTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN--SRSELERTDLNLGRSFNEQSIIYIGASP 3285
            L+F  KT+    ++L    G   DFL + ++ G ++L F++  +   +++D       + D+ WH + + R +L R VL             +  ++KA      R         +LGG+P+           +     F+G I      G+K           +P +  SQ          IC +N C+NGG C     +  CDCS T + GRFC++ + +I                    VA+   + Y           +S D+I    +T + +G I+          D+++L L++G + L  ++G+G  +  +  ++ K +D  +  V+V R      + +D   + +   + D  +          Y+G SP
Sbjct:   47 LSFQFKTDASTALVLYFDDGGYCDFLQLMVVEGKLQLQFSIDCAETTVVSDK-----RVNDSSWHFVSLGRYNL-RTVLG------------VDGANKADEVRPQRQYMKIVSDLFLGGLPQDIRTSVLTLPTAKDLPPFKGIIRDLKY-GRK-----------VPTLLSSQKVRMDMEG--ICTENPCENGGICSLVDGEPLCDCSKTEYIGRFCSEEANSIPGLAHMMMADQAKSKAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHT----GKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTM---LGSDDFFYVGGSP 387          
BLAST of neurexin-2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002142.1 (pep scaffold:Pmarinus_7.0:GL476386:209124:506099:1 gene:ENSPMAG00000001935.1 transcript:ENSPMAT00000002142.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 301.212 bits (770), Expect = 1.331e-84
Identity = 277/1143 (24.23%), Postives = 493/1143 (43.13%), Query Frame = 1
Query:  133 GKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQK-GY----DLKIVIE-EDDIIIYKKSFST--LSLFVKTRFLSIGGLSN-------PVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVL---KTKTQPYEFYDLKLSFQPQTTSFIIYFH------------RSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIENGLLILIIQPQSER---QIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQW-KMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQ--------------IDNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            G  Y+        I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +    G+     L+IV+    D I+    ++    ++     F  +GG  N       P+    NF+GCL +VIYK  +  L++    ++       +G+ ISF  TC+  +   +PI+F +  +F+ L   KTK      +D + +   + +  II+              RS+  D F ++E  D  L + + +    +     E  ++    Y +    D   G   +  N+  S   F     ++  +DL    +SE+ LG      +    P+E+W A L  G+ GC+  + ++ +  D+++       +Q N      + +  SP +CS     S+PC N G C   W    C+C  T Y GR C +    + +DGS F+++ +    +TE E + +RF +    G LL+    D +     E +S+ + L+I    + +     S R   +I     +++D  WH++ + R  + L L +DG                          G ++ + T L +  +  G                    I T       +  NF+G +  +  N +  ID    L R  D ++ ++ A+     I    +   + F T  +YL +  L  Y S  L F  K+   DG++L  SG +ND++ +EL+ G I   F++G+   ++ DN      L DN+WH + ISR +   N+ +L +D   + +    N + A+N +     ++GG+ +  Y K  + + S  G+QGC+A   +NG+ P +LL+ +  ++     ++I   C+   T C++  C N G C+Q +   +CDC+ T+F G +C     T  F +       I   ++   R ++R D +A G  T   D  ++ V+S     GDFI L+++ GK+ + +++G   + + + ++ V+DG Y   R  R G +  LQ              IDN R  L R  +   LGR               FN Q+ I IG    +   + F G ++GL +NG+++
Sbjct:   11 GSEYLCYDLAAHPIQSSSDEITLSFKTLQRNGLILHTGKAADYVNLALKDGAVSLVINLGSGAFE--------------ALVEPVTGKFNDNNWHDVKVTRNLRQLSSIGHAMVNKLQIVVTISVDGILTSTGYTQEDYTMLGSDDFFYVGGSPNTADLPGSPI--SNNFMGCLKEVIYKNSDQKLELSKLAKEGEPKMKVVGE-ISF--TCEN-VAALDPITFEAPEAFITLPKWKTKRTGSISFDFRTT---EPSGLIIFTQGKVSEVKDSKGLRSRKGD-FFAIELFDGHLFLLLDMGSGTIKLKATESNVNDGEWYHVDFQRDGRTGS--ISVNSQRS--PFTAGGDNEI-LDL----DSEVFLGGLPEDKADLLLPTELWSALLNIGYVGCVRDLFIDGQSKDVRQ-----LAEQQNAAGVKPFCAKDSPKQCS-----SNPCRNHGVCREGWNRYVCDCTATGYTGRSCEREASILSYDGSMFMKVVMPVVIHTEAEDVTLRFVSQRAYGLLLATTSRDSADTLRLELDSARVKLTINLDCVRIKCNSTSARKGPEILYAGKHLNDNVWHTVQVIRRGKTLKLTVDGTSAD----------------------GLMDGDHTRLEFHNIETG--------------------IMTERRYTSVMPSNFMGHLQNVVFNGMAYID----LCRNGDIRYCELNARFGMRTI----IADPIIFKTRGSYLTLATLQAYTSMYLFFQFKSTSSDGLILYNSGDANDYIAVELVKGHIHYIFDLGNGQDLIRDNSKR--VLNDNRWHNVIISRDN--NNIHTLKVDTQTVSQ----NVNGARNLDLKGDLFIGGLEKSMYAKLPKLVASREGYQGCLASLDLNGRLP-DLLKEASYKV-----NEIERGCEGPSTTCQEYSCGNQGMCVQHWATFTCDCTMTSFSGAYCNDPGTTYIFSK---GGGLITYTWRPNDRPSTRADRLAVGFSTHLKDALLVRVDSA-ATLGDFIELYIKQGKVGVTFNVGTEDISVNETNVAVNDGNYHVARFSRNGGNCTLQLDNHPINERYPSGNIDNERLALARQRIPYRLGRVVDDWLLDKGRQLTIFNSQATITIGG---QDRERPFQGQLAGLYYNGLQV 1039          
BLAST of neurexin-2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004299.1 (pep scaffold:Pmarinus_7.0:GL477235:143017:163597:1 gene:ENSPMAG00000003933.1 transcript:ENSPMAT00000004299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 2.145e-38
Identity = 99/386 (25.65%), Postives = 172/386 (44.56%), Query Frame = 1
Query: 1702 QIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFC 2859
            ++      ++D +WH++ +SR  +       GK+L+  V+  S E               +  + T L +  +  G                    I T       +  NF+G +  L  N +  +D       L  +      ++N        +   VTF T  +YL +  L  Y +  L F  KT   DG+LL   G   DF+ +EL+ G +  +F++G    ++     G   L DN+WH + + R   + N+ +L +D+ M  +    N ++A+N +     ++GG+PR  Y    + + S  GFQGC+A   +NG+ P +LL  ++         QI   C+   T+C+D+ C N G C+QQ+E+ +CDC+ T++ G FC
Sbjct:    6 EVLHAGQKLNDNEWHTVRVSRRGKRR-----GKLLKLSVDEVSKED-------------EMAGDHTRLEFHNIETG--------------------IMTERRYTSVVPSNFIGHLQSLVFNGLPYLD-------LCKNGDVALCEINARFGLRTIIADPVTFRTRSSYLTLATLQAYAAMHLFFQFKTMSPDGLLLYNGGDGTDFIALELVQGYLHYAFDLGKGPSVIKGKSEGQ--LNDNQWHSVIVMRD--ANNLHTLKVDRDMATQ----NGNEARNLDLKGDLFVGGLPREHYSGLHKLVVSRDGFQGCLASVDLNGRLP-DLLDDALRR-----SGQIERGCEGPSTVCQDDSCSNQGLCVQQWEEFTCDCTMTSYTGAFC 332          

HSP 2 Score: 62.003 bits (149), Expect = 2.496e-10
Identity = 61/248 (24.60%), Postives = 101/248 (40.73%), Query Frame = 1
Query:  745 NPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHH-KVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVW-----MATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICN 1470
            +P++F +++S++ L T  Q Y    L   F+  +   ++ ++     D FI++E     L     +     V+    E  ++  + +S+ +  D  N    LK + D++ +        D   DL                  V   P E +     +   R GFQGC+  V LN  + DL    L   L++S    +GC      PS   +  S    C+NQG C   W E +C+C  T+Y G  CN
Sbjct:  118 DPVTFRTRSSYLTLAT-LQAYAAMHLFFQFKTMSPDGLLLYNGGDGTD-FIALELVQGYLHYAFDLGKGPSVIKGKSEGQLNDNQWHSVIVMRD-ANNLHTLKVDRDMATQNGNEARNLDLKGDLF-----------------VGGLPREHYSGLHKLVVSRDGFQGCLASVDLNGRLPDL----LDDALRRSGQIERGCE----GPSTVCQDDS----CSNQGLCVQQWEEFTCDCTMTSYTGAFCN 333          
BLAST of neurexin-2-like vs. Ensembl Sea Lamprey
Match: cntnap2b (contactin associated protein like 2b [Source:ZFIN;Acc:ZDB-GENE-070912-26])

HSP 1 Score: 79.337 bits (194), Expect = 3.813e-15
Identity = 65/238 (27.31%), Postives = 112/238 (47.06%), Query Frame = 1
Query: 2155 GSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGG-IKLSFNMG-STVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCT 2862
            G +H   SV F TP +YL    +    S  +AF+ KT    GV+L   G S DF+ ++L     +  SF++G   V++   +      L D +WH++ + R   S    SL +D ++  E+    +    +       Y+G             +  + GF GC+    ING   ++L + + V  P V K   + +C+S  ++C+     NGG+C++++   SCDCS +++ G  CT
Sbjct:  723 GDRHFWNSVLFTTPSSYLHFPPIRAETSLDIAFFFKTTTDSGVILENMGAS-DFIRVQLKSPHEVSFSFDVGNGPVEMAVRS---EQPLNDEEWHVVSVER---SLKEASLRVD-LLPRELVPAPAQGHTSLQLSSQLYVG-----------SSVSGHSGFLGCVRSLRINGAT-LDLEERARV-TPGV-KPGCSGHCRSYGSLCR-----NGGRCIERYNGYSCDCSTSSYNGPSCT 933          
BLAST of neurexin-2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000532.1 (pep scaffold:Pmarinus_7.0:GL482851:1933:10168:1 gene:ENSPMAG00000000481.1 transcript:ENSPMAT00000000532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 9.902e-15
Identity = 86/373 (23.06%), Postives = 156/373 (41.82%), Query Frame = 1
Query: 2164 HVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHG-GIKLSFNMG-STVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQD-----RTRNTSRDDIAF-----------------GLQTRKLDGTIIFVESKRKDKGDFIHLFLE-NGKIILEYDMGAG--IMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDN 3201
            H   + +F T ++YL    +H   S  + F  KT+ + GV L   GT +DF+ ++L     +   F++G   V+++  +      L D +WH + + R   S    S+ +D+ +  EV    S    +   +   Y+G             +  + GF GC+    +N    ++L + + V  P V      H C+S   +C+     NGG+C++     SCDCS + ++G FCT       F R      +++ +FQD      +  + +D + F                 G  TR     ++ V SK    G  + + L+ NG + + Y    G  I  +      ++DG    + + R  S  ++Q+D+
Sbjct:    1 HFWNAASFSTHRSYLHFPPVHAETSLDITFLFKTSAESGVFLENMGT-HDFIRVQLKSPYEVSFGFDVGNGPVEMVVRSGQ---PLNDEEWHAVSVER---SLKEASVRVDR-LPREVAWVPSRGHAHLQLNSQLYIG-----------SSVSGDSGFLGCVRSLRVNSVM-LDLEEQARV-TPGVNPGCSGH-CRSYGALCR-----NGGRCVEHSVGYSCDCSSSPYDGPFCTTEVGGF-FER----GTWVKYEFQDPHKLLASTRSDKDTLPFERASDMPVSESGEMALLGFSTRTAPAMLLHVSSK---SGSCLTVTLQSNGSLQIRYSRKGGQRIKVIHPDPRSMADGQPHSLNITRQDSFVYIQLDH 338          
BLAST of neurexin-2-like vs. Ensembl Sea Lamprey
Match: nrxn2a (neurexin 2a [Source:ZFIN;Acc:ZDB-GENE-070206-5])

HSP 1 Score: 69.707 bits (169), Expect = 2.068e-12
Identity = 54/166 (32.53%), Postives = 79/166 (47.59%), Query Frame = 1
Query: 2944 NTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQ--------------IDNSRSEL--ERTDLNLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            +T  D +A G  TR  D  ++ V+S     GDFI L +E+GKI +++++G   + + + +  V+DG Y  VR  R G +A LQ              IDN R  L  +R    LGR               FN Q+ I IG    K   K F G +SG+ +NG+K+
Sbjct:   25 STRADRLAVGFSTRTWDAVLVRVDSAAT-LGDFIQLHIEHGKIGVKFNVGTDDIAVEEANSLVNDGKYHVVRFSRSGGNATLQLDNLPVNERFPSGNIDNERLALARQRIPYRLGRVVDDWLLDKGRQLTIFNSQATIKIGG---KDNNKPFQGQLSGIYYNGLKV 186          
BLAST of neurexin-2-like vs. Ensembl Nematostella
Match: EDO46873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNK6])

HSP 1 Score: 82.4185 bits (202), Expect = 6.455e-16
Identity = 96/433 (22.17%), Postives = 188/433 (43.42%), Query Frame = 1
Query: 2098 NRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN---DFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNH-CKNGGQCLQQFEQASCDCS--YTTFEGRFCTKVSATINFRRQVASNNYIQLQFQD-RTRNTSRD-DIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPI--KKEGKQFVGLISGLIFNGIKIPYVLE 3366
             RL +H +K+   V P+  G  ++ Y  +F   Q+ L         +F+++  LK     G++L  S   +   DF+ + L  G ++  F+ GS   ++      S  +  + WH + ISR D     LSL     ++      +  +    + ++  YLGGM   +Y++    +   +GF GCI    +N ++         + +P         NC     IC  +  C NGG C  + +   C C+  YT        +VSA        A + +++ +  +  +R + ++ ++ F  +T++  G ++ V+ +    GD I + L +G + + YD+G G   +   +  + DG++  V+  R   +A+L++D+       +D    R  N   +++IG +P   ++     VG +  LI   + +    E
Sbjct:  277 GRLCEHDFKL---VMPSFSGQSYLTYP-SFG--QSTLR--------TFTISLVLKPRSDTGLILFNSQKKDGKTDFISLSLREGIVEFIFDCGSGPAVI----RSSTPIMADIWHTIVISR-DGRTGGLSLDGGPPVVGT----SPGRMSLISLEQEVYLGGMA--DYKQQPAIVDMPHGFNGCIQEVKVNSRE---------LHLPSARSGLNVLNCDH---ICVTHLLCFNGGTCQAKMDHYKCHCAVGYTGMMCERARRVSAPT-----FAGDGFMKFKGSEILSRLSGKNTELEFLFRTQESSGLLLSVQKESVSHGDHITIGLIDGILEVRYDLGVGRETVIRSTATLDDGYWHSVKFVRKSLAAYLKVDDEIKAGIASDSQY-RQLNSD-VLFIGGAPTVDRRFMSGLVGCLKDLIVGDVPVDLASE 665          

HSP 2 Score: 50.447 bits (119), Expect = 3.887e-6
Identity = 56/234 (23.93%), Postives = 95/234 (40.60%), Query Frame = 1
Query: 1132 SEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTR--AIEFDGSEFIRLDLGTEFY-------TEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQ-IFKLTNNVSDGQWHSLIISRNNRALSLNLDGKI 1803
            S I L  +  L  +  +  +  +  +  GF GCI++V +N     L  +       +S L +  C    ++             C N G C+       C+C    Y G +C +  R  A  F G  F++   G+E         TE+E +   F T   +G LLS+     S  +   I + + +G+L +       R+ + + T  + DG WHS+   R + A  L +D +I
Sbjct:  403 SLISLEQEVYLGGMADYKQQPAIVDMPHGFNGCIQEVKVNSRELHLPSA-------RSGLNVLNCDHICVT----------HLLCFNGGTCQAKMDHYKCHCA-VGYTGMMCERARRVSAPTFAGDGFMKFK-GSEILSRLSGKNTELEFL---FRTQESSGLLLSVQKESVS--HGDHITIGLIDGILEVRYDLGVGRETVIRSTATLDDGYWHSVKFVRKSLAAYLKVDDEI 612          
BLAST of neurexin-2-like vs. Ensembl Nematostella
Match: EDO39871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8R4])

HSP 1 Score: 77.0258 bits (188), Expect = 4.852e-15
Identity = 68/234 (29.06%), Postives = 102/234 (43.59%), Query Frame = 1
Query: 2194 PQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLL-MISGTSNDFLLMELIHGGIKLSFNMG---STVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIE--EVTIHNSHKAKNFNFDRPAYLGGMPRYEYQ-KWT-EYIFSN---YGFQGCIAGFSI-NGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFC 2859
            P A      L   GSF L  Y +T +K+ +LL    G   D++ + L+ G  ++   +G   S+ +I+        S AD KWHLL++ R   +  + + S+D    E  E  I      K  +     YLGG+P    +  W+  YIF     Y F GCIA     +GK  ++   Y               +C      C D+ CKNGG+C+    +A CDC  T + G+ C
Sbjct:   30 PFAEFKPWDLSTNGSFEL--YFQTKRKNALLLYQDDGEGQDWIDVFLVEGRARIRITLGMCRSSTRIING------SFADEKWHLLKVKR---NFTITTFSVDGFESELIECEITEDSPVKPKSSKTSLYLGGIPVLNGRGSWSNPYIFQENIRYVFSGCIARVKYSDGKSVMHSAHYKT-------SKGTTADCDG---ACTDDQCKNGGKCVDMLVRAECDCRGTGYVGQHC 242          
BLAST of neurexin-2-like vs. Ensembl Nematostella
Match: EDO36109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ6])

HSP 1 Score: 77.7962 bits (190), Expect = 1.541e-14
Identity = 86/408 (21.08%), Postives = 171/408 (41.91%), Query Frame = 1
Query: 2233 GSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTD-NCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPA-----YLGGMPRYEYQ-KWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQ------IAHNCQ-SNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRD------DIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLE--NGKIILEYDMGAGIMKL-TDLSIKVSDGFYRRVRVRRLG-----SSAWLQID-NSRSELERTDLNLGRSFNEQSIIYIGA------SPIKKEGKQFVGLISGLIFNGIKI 3351
            G+FS  F  +TN   G LL       +  L   + GGI L F +   +  +T  +  G+    D++WH + +    L  N ++L++DK++            K    +R       YLGG+P    + K+    F+ + F GCI           NL+    +E    ++++      + H C+ + ++  + + C+N G+C+   +   CDC  T +EG++C + S+ +        N    + +     N   D       ++F +  +  +G ++++  +  D     H  +E  N  I L  ++G G + L +++++ +S  ++ +V  R+       +  W+Q+   +   L   DL       +  + YIG       SP+    + F G +   +F  I +
Sbjct:   49 GTFSFMF--RTNTSKGALLYGEVKKGNHYLFITLDGGIALQFYLTFCLSYVTQLDIPGN--FYDDQWHEVAVF---LGLNEVTLTVDKILSASTECKPDIIEKEIAKERGKRWHLMYLGGIPIPSKEWKFPSLQFNYFRFYGCIG----------NLMYQKGIE--KAFRAKLKEKVLVKHGCENACISRTQSSRCRNDGKCIDHIKTFECDCEGTGYEGKYCDQESSMVFI------NGSTYITYTPNQTNPYADWSMKVNQLSFRMVAKNPNGIVLYMGDREAD-----HFLIELVNAAIRLSVNLGGGSLILQSNVTLNMSAYYWVQVTRRQRKVLLDINYGWVQMQAETPGSLSSLDLK-----GDSRVAYIGGGPGNIVSPLSLSKRNFSGFLQQFVFEEINV 421          

HSP 2 Score: 53.5286 bits (127), Expect = 4.968e-7
Identity = 49/209 (23.44%), Postives = 95/209 (45.45%), Query Frame = 1
Query: 1219 FQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFI-----RLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEF----NSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEV 1818
            F GCI  ++    +    R+    KLK+  L   GC  + IS       +++SS C N G C ++     C+C+ T Y+G+ C++ +  +  +GS +I     + +   ++  +V  +  R     P G +L +   +   F     +++I LS+  G   LI+Q         +T N+S   W  + ++R  R + L+++   +Q + 
Sbjct:  181 FYGCIGNLMYQKGIEKAFRA----KLKEKVLVKHGCENACIS-------RTQSSRCRNDGKCIDHIKTFECDCEGTGYEGKYCDQESSMVFINGSTYITYTPNQTNPYADWSMKVNQLSFRMVAKNPNGIVLYMGDREADHFLIELVNAAIRLSVNLGGGSLILQSN-------VTLNMSAYYW--VQVTRRQRKVLLDINYGWVQMQA 369          
BLAST of neurexin-2-like vs. Ensembl Nematostella
Match: EDO36419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIM8])

HSP 1 Score: 63.5438 bits (153), Expect = 4.408e-11
Identity = 62/234 (26.50%), Postives = 98/234 (41.88%), Query Frame = 1
Query: 2179 VTFHTPQAYLLVHK-LHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMG-STVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR---YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTK 2865
            V+F  P++    H+   +  + +L F  KT  KD +L+       D+  +EL  G + L+   G  T Q+   N      L D  WH + I    +    + L++D      V I   + A   N  R  Y GG+PR        +   +F+   F GCI    I     +        E+  V        C++    C+ N C+NGG+C+ +   ++CDCS T F G  CT+
Sbjct:    1 VSFVDPKSSFAQHQQWRVSSNGTLTFSFKTFLKDALLIYQDDGVMDYFNLELKVGRLLLNIRTGRKTSQVTLGN-----QLNDLSWHQVSI---HVEHVKIGLTLDD-HTRVVKIPRKNLALKNNPSRYLYFGGLPRSLSISTLSFPAVVFAKR-FTGCIKDVEIQTGNGVQ------EELRLVESKGRVRGCRN---ACRSNPCQNGGRCINKIWSSACDCSGTGFYGNQCTE 215          
BLAST of neurexin-2-like vs. Ensembl Nematostella
Match: EDO47422 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM09])

HSP 1 Score: 66.2402 bits (160), Expect = 5.213e-11
Identity = 91/405 (22.47%), Postives = 161/405 (39.75%), Query Frame = 1
Query: 2200 AYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCH-----GSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAG--FSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYI--QLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFN------EQSIIYIGASPIKK------EGKQFVGLISGLIFNGIKI 3351
            +Y      +L+G  S  F  +TNQ +G+LL      +DF+ + L +G ++        ++I  D+C+        S  D  WH + I+R    RNV + ++D+  ++     +          R  Y+   P          +F      GC+    F+ + ++   L Q ++ +      S     C S     + N C +GG+C  +  +  C+C  T +EG  C   S++  F      ++Y+   +      R+T  + IAF   T   DG I  V S   D  D + + L  G + + +D+G G + +T     + DG +  V + R      L +D      ER  + +   F+       Q  +Y    P           K F G+I  L F+  ++
Sbjct:   33 SYTTFEPWNLHGEVSFVF--RTNQSNGLLLYQDDGMHDFVELFLDNGNVR--------IKIGIDDCYIQEKLVQGSFNDFHWHRVRITRE--PRNV-TFAVDRAWLKLPCSPSKGDKFARATGRFLYVASFPPTLGLNLNWLVFP-----GCLGDLWFTTSEQR---LDQATLRD-----SSGTTSGCNSPCRTPQLNKCLHGGRCSAEIGRVECECQGTGYEGDDCGIESSSAWFN----GSSYVLYDVGIHQPGRSTLTNTIAFRFATGNPDGVI--VHSSMFD--DHVVVELSKGFVRVSFDLGQGRLNITSREGCLHDGTWHSVTIHRKRRRVTLDLDKQ----ERVTVVIPGQFSFLDFKGGQEKLYFCGGPDSDTLAYSYSRKNFTGIIQQLRFDEYQV 399          

HSP 2 Score: 59.3066 bits (142), Expect = 7.831e-9
Identity = 48/196 (24.49%), Postives = 79/196 (40.31%), Query Frame = 1
Query: 1219 FQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTE---FYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQ-PQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLD 1794
            F GC+  +         ++ L    L+ S+ T  GC     SP    +L      C + G C      + C C  T Y+G  C   + +  F+GS ++  D+G       T   +I  RF+T  P G ++       S      +++ +  G + +     Q    I      + DG WHS+ I R  R ++L+LD
Sbjct:  163 FPGCLGDLWFTTS----EQRLDQATLRDSSGTTSGCN----SPCRTPQLNK----CLHGGRCSAEIGRVECECQGTGYEGDDCGIESSSAWFNGSSYVLYDVGIHQPGRSTLTNTIAFRFATGNPDGVIV------HSSMFDDHVVVELSKGFVRVSFDLGQGRLNITSREGCLHDGTWHSVTIHRKRRRVTLDLD 340          
BLAST of neurexin-2-like vs. Ensembl Medaka
Match: ENSORLT00000030454.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 292.738 bits (748), Expect = 5.343e-81
Identity = 279/1135 (24.58%), Postives = 482/1135 (42.47%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH-------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIE-NGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+VL  K    +   +   F+    + ++ F   K                 F ++E  +  L + + +             ++    Y +    D  +G         IS+       T+    ++  L +  + LG          FP+EVW A L  G+ GCI  + ++ +  D++R L  ++             + + PS CSK  SK   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++    D +     E +S  + L++  + + I     +    IF    N++D +WH++ + R  ++L L +D                      ++   G +  + T L +  +  G              + K +M    S        NF+G +  L  N +  ID       DY  LN +               IG K+++   VTF +  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +    ++G+   ++  N +    L+DN+WH + ISR   + N+ ++ ID  +    T   +  AKN +     Y+GG+ +  Y    + + +  GFQGC+A   +NG+ P +L+  ++  +      QI   C+   T C+++ C N G CLQQ+E  SCDCS TTF G  C     T  F R       I   +    R ++R D +A G  T   D  ++ V+S     GDF+ L ++ GK+ + +++G   + + + +  V+DG Y  V+  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    +   + F G +SGL +NG+K+
Sbjct:  297 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNDWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHG------TVAFK--CEN-VATLDPITFETPESFIVLN-KWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGT--------ISINTLRTAYTAPGESEILDL-DDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRR-LAEIQ-----------KATGVKPS-CSKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFA-GQNLNDNEWHTVRVFRRGKSLKLTVD---------------------DLSPIEGQMAGDHTQLEFHNIETGI------------VTEKRFMSTVPS--------NFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAM---------------IGFKNIIADPVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKP--LSDNQWHNVIISRD--TNNLHTVKIDTKI----TTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKLVHAKEGFQGCLASVDLNGRLP-DLMSDALDCV-----GQIERGCEGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRD---GGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSS-SGLGDFLKLHIDKGKVAVVFNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWE-RDRSQSFQGQLSGLYYNGLKV 1306          
BLAST of neurexin-2-like vs. Ensembl Medaka
Match: ENSORLT00000033187.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 292.738 bits (748), Expect = 5.343e-81
Identity = 279/1135 (24.58%), Postives = 482/1135 (42.47%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH-------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIE-NGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+VL  K    +   +   F+    + ++ F   K                 F ++E  +  L + + +             ++    Y +    D  +G         IS+       T+    ++  L +  + LG          FP+EVW A L  G+ GCI  + ++ +  D++R L  ++             + + PS CSK  SK   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++    D +     E +S  + L++  + + I     +    IF    N++D +WH++ + R  ++L L +D                      ++   G +  + T L +  +  G              + K +M    S        NF+G +  L  N +  ID       DY  LN +               IG K+++   VTF +  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +    ++G+   ++  N +    L+DN+WH + ISR   + N+ ++ ID  +    T   +  AKN +     Y+GG+ +  Y    + + +  GFQGC+A   +NG+ P +L+  ++  +      QI   C+   T C+++ C N G CLQQ+E  SCDCS TTF G  C     T  F R       I   +    R ++R D +A G  T   D  ++ V+S     GDF+ L ++ GK+ + +++G   + + + +  V+DG Y  V+  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    +   + F G +SGL +NG+K+
Sbjct:  297 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNDWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHG------TVAFK--CEN-VATLDPITFETPESFIVLN-KWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGT--------ISINTLRTAYTAPGESEILDL-DDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRR-LAEIQ-----------KATGVKPS-CSKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFA-GQNLNDNEWHTVRVFRRGKSLKLTVD---------------------DLSPIEGQMAGDHTQLEFHNIETGI------------VTEKRFMSTVPS--------NFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAM---------------IGFKNIIADPVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKP--LSDNQWHNVIISRD--TNNLHTVKIDTKI----TTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKLVHAKEGFQGCLASVDLNGRLP-DLMSDALDCV-----GQIERGCEGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRD---GGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSS-SGLGDFLKLHIDKGKVAVVFNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWE-RDRSQSFQGQLSGLYYNGLKV 1306          
BLAST of neurexin-2-like vs. Ensembl Medaka
Match: ENSORLT00000027034.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 292.352 bits (747), Expect = 6.108e-81
Identity = 279/1135 (24.58%), Postives = 482/1135 (42.47%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH-------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIE-NGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+VL  K    +   +   F+    + ++ F   K                 F ++E  +  L + + +             ++    Y +    D  +G         IS+       T+    ++  L +  + LG          FP+EVW A L  G+ GCI  + ++ +  D++R L  ++             + + PS CSK  SK   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++    D +     E +S  + L++  + + I     +    IF    N++D +WH++ + R  ++L L +D                      ++   G +  + T L +  +  G              + K +M    S        NF+G +  L  N +  ID       DY  LN +               IG K+++   VTF +  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +    ++G+   ++  N +    L+DN+WH + ISR   + N+ ++ ID  +    T   +  AKN +     Y+GG+ +  Y    + + +  GFQGC+A   +NG+ P +L+  ++  +      QI   C+   T C+++ C N G CLQQ+E  SCDCS TTF G  C     T  F R       I   +    R ++R D +A G  T   D  ++ V+S     GDF+ L ++ GK+ + +++G   + + + +  V+DG Y  V+  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    +   + F G +SGL +NG+K+
Sbjct:  293 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNDWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHG------TVAFK--CEN-VATLDPITFETPESFIVLN-KWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGT--------ISINTLRTAYTAPGESEILDL-DDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRR-LAEIQ-----------KATGVKPS-CSKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFA-GQNLNDNEWHTVRVFRRGKSLKLTVD---------------------DLSPIEGQMAGDHTQLEFHNIETGI------------VTEKRFMSTVPS--------NFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAM---------------IGFKNIIADPVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKP--LSDNQWHNVIISRD--TNNLHTVKIDTKI----TTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKLVHAKEGFQGCLASVDLNGRLP-DLMSDALDCV-----GQIERGCEGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRD---GGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSS-SGLGDFLKLHIDKGKVAVVFNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWE-RDRSQSFQGQLSGLYYNGLKV 1302          

HSP 2 Score: 113.62 bits (283), Expect = 6.532e-25
Identity = 154/742 (20.75%), Postives = 300/742 (40.43%), Query Frame = 1
Query: 1258 VFDLKRSLLSVKLKQSNLTIK------GCYTS-TISPSECSKLKSK---------SSPCANQGYCENYWPEISCNCDFTNYKGRIC----------------NKGTRA------------------IEFDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSIN---IGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN--------------DFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKN----FNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQ-IAHNCQSNLTI-CKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTD--------LSIKVSDGFYRRVRVRRLGSSAWLQIDN 3201
            V  +   L SV L+ ++  +K      G  T  T++ +EC+ + S+         ++ C N G C     E +C+C  T ++G+ C                ++G R                     F GSEF   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R                 HS     +V  S++      G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   L +  D + K+   V   A   ++V     +TF TP+++++++K +   + S++F  +T + +G+LL   G                 DF  +E++ G + L  +MGS     T     +  + D +W+ ++  R D     +S++         T+  ++ A       + D   YLGG+P       +  + WT  +  NYG+ GCI    I+G+         +  + ++ K+  +  +C    +  C  N C+N G C + + +  CDCS T + GR C + +  +++      + ++++Q      +T  +D++   ++++  G  I + +  +D  D + L L++G++ L  ++    +  T             ++D  +  VRV R G S  L +D+
Sbjct:  150 VGGIPPELRSVALRLTSAAVKDEPPFAGWITDVTVNNTECAIINSEGVLMDICGTANMCQNGGICSLIDNEPTCDCSHTGFQGKDCSEEDNYTEGLAHLMMGDQGQRGEAWLLRSLLSTPGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNDWHDVKVTRNLRQ----------------HSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTV---AFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGT---TKTKAVNKKVNDGEWYHVDFQR-DGRSGTISIN---------TLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALL--NYGYVGCIRDLFIDGQSK------DVRRLAEIQKATGVKPSCSKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYD----GSKFMKVQLP-VVMHTEAEDVSLRFRSQRAYG--ILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDD 820          
BLAST of neurexin-2-like vs. Ensembl Medaka
Match: ENSORLT00000046931.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 291.967 bits (746), Expect = 7.832e-81
Identity = 279/1135 (24.58%), Postives = 482/1135 (42.47%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH-------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIE-NGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+VL  K    +   +   F+    + ++ F   K                 F ++E  +  L + + +             ++    Y +    D  +G         IS+       T+    ++  L +  + LG          FP+EVW A L  G+ GCI  + ++ +  D++R L  ++             + + PS CSK  SK   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++    D +     E +S  + L++  + + I     +    IF    N++D +WH++ + R  ++L L +D                      ++   G +  + T L +  +  G              + K +M    S        NF+G +  L  N +  ID       DY  LN +               IG K+++   VTF +  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +    ++G+   ++  N +    L+DN+WH + ISR   + N+ ++ ID  +    T   +  AKN +     Y+GG+ +  Y    + + +  GFQGC+A   +NG+ P +L+  ++  +      QI   C+   T C+++ C N G CLQQ+E  SCDCS TTF G  C     T  F R       I   +    R ++R D +A G  T   D  ++ V+S     GDF+ L ++ GK+ + +++G   + + + +  V+DG Y  V+  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    +   + F G +SGL +NG+K+
Sbjct:  291 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNDWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHG------TVAFK--CEN-VATLDPITFETPESFIVLN-KWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGT--------ISINTLRTAYTAPGESEILDL-DDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRR-LAEIQ-----------KATGVKPS-CSKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFA-GQNLNDNEWHTVRVFRRGKSLKLTVD---------------------DLSPIEGQMAGDHTQLEFHNIETGI------------VTEKRFMSTVPS--------NFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAM---------------IGFKNIIADPVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKP--LSDNQWHNVIISRD--TNNLHTVKIDTKI----TTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKLVHAKEGFQGCLASVDLNGRLP-DLMSDALDCV-----GQIERGCEGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRD---GGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSS-SGLGDFLKLHIDKGKVAVVFNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWE-RDRSQSFQGQLSGLYYNGLKV 1300          
BLAST of neurexin-2-like vs. Ensembl Medaka
Match: ENSORLT00000034989.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 291.967 bits (746), Expect = 8.175e-81
Identity = 279/1135 (24.58%), Postives = 482/1135 (42.47%), Query Frame = 1
Query:  172 ISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFST--LSLFVKTRFLSIGG-------LSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQK-----KLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDH-------------FISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSK---SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFS-----EFNSSSILLSIE-NGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIID-------DYILLNRLSDHQWKMQAQVNPNAIGSKHVVYS-VTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDD-IAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQI--------------DNSRSELERTDL--NLGRS--------------FNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKI 3351
            I  S++ + + FKT Q + ++ ++G   +   +A     +  +  LG  A+                L+    G FNDN WH VK  R+L +   G    +V    D I+    ++    ++     F  +GG         +PV    NF+GCL +V+YK +++ L++    ++     K+HG       ++F   C+  +   +PI+F +  SF+VL  K    +   +   F+    + ++ F   K                 F ++E  +  L + + +             ++    Y +    D  +G         IS+       T+    ++  L +  + LG          FP+EVW A L  G+ GCI  + ++ +  D++R L  ++             + + PS CSK  SK   S+PC N G C   W    C+C  T Y GR C +    + +DGS+F+++ L    +TE E + +RF +    G L++    D +     E +S  + L++  + + I     +    IF    N++D +WH++ + R  ++L L +D                      ++   G +  + T L +  +  G              + K +M    S        NF+G +  L  N +  ID       DY  LN +               IG K+++   VTF +  +Y+ +  L  Y S  L F  KT   DG++L  SG  NDF+++EL+ G +    ++G+   ++  N +    L+DN+WH + ISR   + N+ ++ ID  +    T   +  AKN +     Y+GG+ +  Y    + + +  GFQGC+A   +NG+ P +L+  ++  +      QI   C+   T C+++ C N G CLQQ+E  SCDCS TTF G  C     T  F R       I   +    R ++R D +A G  T   D  ++ V+S     GDF+ L ++ GK+ + +++G   + + + +  V+DG Y  V+  R G +A LQ+              DN R  + R  +   LGR               FN Q+ I IG    +   + F G +SGL +NG+K+
Sbjct:  281 IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFE--------------ALVEPVNGKFNDNDWHDVKVTRNL-RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV--SNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHG------TVAFK--CEN-VATLDPITFETPESFIVLN-KWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGT--------ISINTLRTAYTAPGESEILDL-DDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRR-LAEIQ-----------KATGVKPS-CSKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFA-GQNLNDNEWHTVRVFRRGKSLKLTVD---------------------DLSPIEGQMAGDHTQLEFHNIETGI------------VTEKRFMSTVPS--------NFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAM---------------IGFKNIIADPVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKP--LSDNQWHNVIISRD--TNNLHTVKIDTKI----TTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKLVHAKEGFQGCLASVDLNGRLP-DLMSDALDCV-----GQIERGCEGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRD---GGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSS-SGLGDFLKLHIDKGKVAVVFNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWE-RDRSQSFQGQLSGLYYNGLKV 1290          

HSP 2 Score: 117.087 bits (292), Expect = 6.038e-26
Identity = 145/697 (20.80%), Postives = 286/697 (41.03%), Query Frame = 1
Query: 1336 TISPSECSKLKSK---------SSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIE----------------------FDGSEFIRLDLG-TEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQS---ERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSIN---IGFGAINSNETILSWQQ-LHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVY--SVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSN--------------DFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKN----FNFDRPAYLGGMPR------YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQ-IAHNCQSNLTI-CKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTD--------LSIKVSDGFYRRVRVRRLGSSAWLQIDN 3201
            T++ +EC+ + S+         ++ C N G C     E +C+C  T ++G+ C++     E                      F GSEF   DL      +  + I + F T+   G +L    S      +  + L+++NG + L+I   S   E  +  +    +D  WH + ++RN R                 HS     +V  S++      G    + T+L      ++G S    D     P SP              +  NF+G + ++   + D+  +   L +  D + K+   V   A   ++V     +TF TP+++++++K +   + S++F  +T + +G+LL   G                 DF  +E++ G + L  +MGS     T     +  + D +W+ ++  R D     +S++         T+  ++ A       + D   YLGG+P       +  + WT  +  NYG+ GCI    I+G+         +  + ++ K+  +  +C    +  C  N C+N G C + + +  CDCS T + GR C + +  +++      + ++++Q      +T  +D++   ++++  G  I + +  +D  D + L L++G++ L  ++    +  T             ++D  +  VRV R G S  L +D+
Sbjct:  183 TVNNTECAIINSEGVLMDICGTANMCQNGGICSLIDNEPTCDCSHTGFQGKDCSEEDNYTEGLAHLMMGDQDRIKGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGKS------ADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNDWHDVKVTRNLRQ----------------HSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADL----PGSP--------------VSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTV---AFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGT---TKTKAVNKKVNDGEWYHVDFQR-DGRSGTISIN---------TLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALL--NYGYVGCIRDLFIDGQSK------DVRRLAEIQKATGVKPSCSKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYD----GSKFMKVQLP-VVMHTEAEDVSLRFRSQRAYG--ILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDD 808          
BLAST of neurexin-2-like vs. Planmine SMEST
Match: SMESG000054585.1 (SMESG000054585.1)

HSP 1 Score: 2394 bits (6203), Expect = 0.000e+0
Identity = 1166/1171 (99.57%), Postives = 1167/1171 (99.66%), Query Frame = 1
Query:   31 MRLYLLAVSWWILYNKFSLAILENRHGGLTTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTYRYLESSISPTNLCKNR 3543
            MRLYLLAVS WILYNKFSLAILENRHGG+TTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQL YNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTS ISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTY YLESSISPTNLCKNR
Sbjct:    1 MRLYLLAVSLWILYNKFSLAILENRHGGITTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLVYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSIISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTYHYLESSISPTNLCKNR 1171          
BLAST of neurexin-2-like vs. Planmine SMEST
Match: SMESG000054585.1 (SMESG000054585.1)

HSP 1 Score: 2338.15 bits (6058), Expect = 0.000e+0
Identity = 1144/1171 (97.69%), Postives = 1145/1171 (97.78%), Query Frame = 1
Query:   31 MRLYLLAVSWWILYNKFSLAILENRHGGLTTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTYRYLESSISPTNLCKNR 3543
            MRLYLLAVS WILYNKFSLAILENRHGG+TTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQL YNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTS ISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQ                      AINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTY YLESSISPTNLCKNR
Sbjct:    1 MRLYLLAVSLWILYNKFSLAILENRHGGITTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLVYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSIISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQ----------------------AINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTYHYLESSISPTNLCKNR 1149          
BLAST of neurexin-2-like vs. Planmine SMEST
Match: SMESG000054585.1 (SMESG000054585.1)

HSP 1 Score: 2326.21 bits (6027), Expect = 0.000e+0
Identity = 1144/1192 (95.97%), Postives = 1145/1192 (96.06%), Query Frame = 1
Query:   31 MRLYLLAVSWWILYNKFSLAILENRHGGLTTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQ---------------------GCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTYRYLESSISPTNLCKNR 3543
            MRLYLLAVS WILYNKFSLAILENRHGG+TTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQL YNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTS ISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQ                      AINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQ                     GCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTY YLESSISPTNLCKNR
Sbjct:    1 MRLYLLAVSLWILYNKFSLAILENRHGGITTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLVYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSIISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQ----------------------AINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQKTVHPTSIRSSDILGKSFDVMGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTYHYLESSISPTNLCKNR 1170          
BLAST of neurexin-2-like vs. Planmine SMEST
Match: SMESG000054585.1 (SMESG000054585.1)

HSP 1 Score: 2286.92 bits (5925), Expect = 0.000e+0
Identity = 1119/1145 (97.73%), Postives = 1120/1145 (97.82%), Query Frame = 1
Query:  109 GGLTTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTYRYLESSISPTNLCKNR 3543
            GG+TTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQL YNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTS ISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQ                      AINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTY YLESSISPTNLCKNR
Sbjct:  217 GGITTVMNGKGYIHNAFPKASISWSTEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLVYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKFIIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSIISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQ----------------------AINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPRYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSGNEKTYHYLESSISPTNLCKNR 1339          
BLAST of neurexin-2-like vs. Planmine SMEST
Match: SMESG000058569.1 (SMESG000058569.1)

HSP 1 Score: 290.041 bits (741), Expect = 9.981e-81
Identity = 296/1134 (26.10%), Postives = 508/1134 (44.80%), Query Frame = 1
Query:  106 HGGLTTVMNGKGYIHNAFPKASISWST----EILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNFTRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLK------IVIEEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKADNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFVVLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSK----NNDHFISVEARDRQLIIGISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKF-IIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGCIEKVILNDEVFDLKRSLLSVKLKQSNLT--IKGCYTSTISPSECSKLKSKSSPCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGTEFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSI--ENGLLILIIQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHSNEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPKVWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQAQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFD--RPAYLGGMPRY--EYQKWTEYIFSNYGFQGCIAGFSINGKKPI-------NLLQYSIVEIPDVYKSQIAHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKL-DGTIIFVESKRKDKGDFI--HLFLENGK--IILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPI--KKEGK---------QFVGLISGLIFNGIKIPYVLEH 3369
            H G T  +    ++ +A+   SI+  T    + + +EFKTKQ    +FY G     +     +  L+Y+D   QL     + D   + T  +  ++ Y     DN+WH +   R     +   D K      + +    +I    +F  +     + F SI   ++ +  + NF GC+ K+IY  DN  LD+L   Q K+  +      I F K     I    PISF ++ S++ L       +   L+ SF+   ++ ++ + +S+    N   F + E R+  L   I+    V         +    S+ + L+  + +G  +++ + D  +E    ++ T D   DL        I G   +L  V + P  +W   LR+GF GC+  + +N + +DL     ++K +  N+T  + GC         C+     + PC + G C   +    C+C  TNY G  C +    ++F+G + + +++   F +E E + +RF T  P G  +       S  + +S  L I  ENG L +++      +I +   N  DG WH+L + R  R LS+ L    ++++ NF  + KL               SN+ I         A  KY    ++R F+                     G +     N ++  +   L    S    ++ A +  +A  +K   + ++F +  +Y+ + K+ +YG F L F +KT    G +L + G S D+L++E++HG + L FN G+              + DN WH + + R +   +  +  ID   I E   H   KA   NF+     +LG   +Y  +  +  + + S+ GF+GCI+ F +N  K +       NLL  ++     V      HN Q +   C+ N C +GG+C+QQ+ +  CDC+ TTF G  C KVS T+ F    A   Y+  +    T+NT+ D++AFG+QT  +   +II +E   K + DFI   L  + G+  +I+EY++G+GI +L + S+ ++DGFY RV  RR G+ A LQID+    +          FN+Q  IY+G  P   ++ G+          F G +SGL FN I +  ++++
Sbjct:   15 HTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTG-LQYILMYLDDR-QLGIRI-KHDRLPESTFKVTCVSIYSTC-TDNRWHTISVSRKKTSIKVVVDGKVVVDRMVGLTVTHLISQSITFGGMIPMTDSDF-SIQETASFLQNLTNFKGCMQKIIYSTDNANLDIL--AQAKIKRYFLTRGEIYFDKCSDLFI--IKPISFTTEASYITLAGWAWAQKG-KLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLW--FEDGNVEVQLDADKKIEHTNSLYKTLDTTRDL-------YIGGIPETL--VSFLPHSLWSGILRQGFVGCLLDISVNGDQYDL-----ALKAESENITGIVSGCSGDVTDKGLCA-----NRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTK----SRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKR--RQLSVILIIDDMEKKYNFSGSSKLL--------------SNDII---------AVGKYETDKFSRYFT---------------------GYMMHFTFNGINYFE---LAKEESPSNIEVTATIG-DAEPTKE--FPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYLNLLFNWGNG---FNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERA-HIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVS---CRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPA---YLIYKLSP-TKNTTLDELAFGIQTSVITSSSIILIEGDGK-QSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 1048          

HSP 2 Score: 83.9593 bits (206), Expect = 5.363e-16
Identity = 111/454 (24.45%), Postives = 186/454 (40.97%), Query Frame = 1
Query: 2167 VVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDGVLL-MISGTSN----DFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKWHLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMPR-----YEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQIAHNCQSNLT---ICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATINFR--RQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKDKGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSSAWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGLIFNGIKIPYVLEHKKEFP--YIFVSIFGDVE---------INVTSKIKLPK 3450
            ++  ++F T  +Y+ +          L F  KT + + +L    S TS     DF   E+    +  S N GS V         S  ++D   H +++   D +  V  L  DK  IE    H +   K  +  R  Y+GG+P        +  W+  +    GF GC+   S+NG +    L+     I     + I   C  ++T   +C +  C +G +C+  + +  CDCS T + G  C +V+  + F   +Q+  N  +   FQ        +D+     T + +G  I  +S+     D + +FLENGK+ +  + G G  K+        DG +  ++++R   S  L ID+     ++ + +         II +G     K  + F G +    FNGI   Y    K+E P      +  GD E          +V S I+LPK
Sbjct:  227 IIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVY---QQKVSSTPVSDGLSHYVKLWFEDGNVEV-QLDADK-KIE----HTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGIL--RQGFVGCLLDISVNGDQYDLALKAESENI-----TGIVSGCSGDVTDKGLCANRPCMDG-RCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIIN--MPNGFQSEC-----EDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG-NKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDME---KKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGIN--YFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPK 650          
The following BLAST results are available for this feature:
BLAST of neurexin-2-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NRXN16.479e-8724.84neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN17.711e-8524.35neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN18.287e-8524.36neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN18.394e-8524.36neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN18.984e-8524.36neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
back to top
BLAST of neurexin-2-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrx-11.604e-3922.70NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
nrx-11.943e-3922.89NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
nrx-12.680e-3922.80NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
nrx-13.752e-3922.61NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
unc-527.318e-1125.65Basement membrane proteoglycan [Source:UniProtKB/... [more]
back to top
BLAST of neurexin-2-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nrx-11.487e-6624.87gene:FBgn0038975 transcript:FBtr0084256[more]
Nrx-11.487e-6624.87gene:FBgn0038975 transcript:FBtr0334607[more]
Nrx-12.080e-6624.80gene:FBgn0038975 transcript:FBtr0334609[more]
Nrx-12.730e-6624.80gene:FBgn0038975 transcript:FBtr0334611[more]
Nrx-14.372e-6624.80gene:FBgn0038975 transcript:FBtr0334610[more]
back to top
BLAST of neurexin-2-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrxn1a8.974e-8524.78neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a1.749e-8324.74neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a2.319e-8324.74neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a2.818e-8324.52neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a4.626e-8324.74neurexin 1a [Source:NCBI gene;Acc:565531][more]
back to top
BLAST of neurexin-2-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gldc1.383e-7724.38glycine decarboxylase [Source:Xenbase;Acc:XB-GENE-... [more]
gldc1.435e-7724.36glycine decarboxylase [Source:Xenbase;Acc:XB-GENE-... [more]
gldc1.665e-7724.36glycine decarboxylase [Source:Xenbase;Acc:XB-GENE-... [more]
NRXN31.540e-7223.45neurexin 3 [Source:NCBI gene;Acc:100379902][more]
NRXN32.062e-7223.45neurexin 3 [Source:NCBI gene;Acc:100379902][more]
back to top
BLAST of neurexin-2-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nrxn18.975e-8824.75neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn11.014e-8524.26neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn11.367e-8524.28neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn13.220e-8524.28neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn13.510e-8524.28neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
back to top
BLAST of neurexin-2-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ULB1|NRX1A_HUMAN3.112e-8624.84Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 S... [more]
sp|Q9CS84|NRX1A_MOUSE1.957e-7724.80Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 ... [more]
sp|Q28146|NRX1A_BOVIN3.448e-7724.87Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=... [more]
sp|Q63372|NRX1A_RAT5.125e-7724.70Neurexin-1 OS=Rattus norvegicus OX=10116 GN=Nrxn1 ... [more]
sp|A1XQY1|NR3BA_DANRE1.805e-7624.38Neurexin-3b OS=Danio rerio OX=7955 GN=nrxn3b PE=2 ... [more]
back to top
BLAST of neurexin-2-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G0WLR93.801e-9123.97Neurexin OS=Aplysia californica OX=6500 PE=2 SV=1[more]
A0A2T7PG264.316e-9024.79Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9K8844.080e-8724.28Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9K8851.012e-8624.18Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9K8901.201e-8624.35Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of neurexin-2-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000000309.21.894e-8224.53pep primary_assembly:Astyanax_mexicanus-2.0:21:105... [more]
ENSAMXT00000011949.21.766e-7924.50pep primary_assembly:Astyanax_mexicanus-2.0:6:2098... [more]
nrxn3a5.504e-7424.10neurexin 3 [Source:NCBI gene;Acc:103035103][more]
nrxn3a6.279e-7423.56neurexin 3 [Source:NCBI gene;Acc:103035103][more]
nrxn3a7.085e-7423.81neurexin 3 [Source:NCBI gene;Acc:103035103][more]
back to top
BLAST of neurexin-2-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002142.11.331e-8424.23pep scaffold:Pmarinus_7.0:GL476386:209124:506099:1... [more]
ENSPMAT00000004299.12.145e-3825.65pep scaffold:Pmarinus_7.0:GL477235:143017:163597:1... [more]
cntnap2b3.813e-1527.31contactin associated protein like 2b [Source:ZFIN;... [more]
ENSPMAT00000000532.19.902e-1523.06pep scaffold:Pmarinus_7.0:GL482851:1933:10168:1 ge... [more]
nrxn2a2.068e-1232.53neurexin 2a [Source:ZFIN;Acc:ZDB-GENE-070206-5][more]
back to top
BLAST of neurexin-2-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of neurexin-2-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468736.455e-1622.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398714.852e-1529.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361091.541e-1421.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364194.408e-1126.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474225.213e-1122.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of neurexin-2-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000030454.15.343e-8124.58neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000033187.15.343e-8124.58neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000027034.16.108e-8124.58neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000046931.17.832e-8124.58neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000034989.18.175e-8124.58neurexin 1 [Source:NCBI gene;Acc:101159771][more]
back to top
BLAST of neurexin-2-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054585.10.000e+099.57SMESG000054585.1[more]
SMESG000054585.10.000e+097.69SMESG000054585.1[more]
SMESG000054585.10.000e+095.97SMESG000054585.1[more]
SMESG000054585.10.000e+097.73SMESG000054585.1[more]
SMESG000058569.19.981e-8126.10SMESG000058569.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024216 ID=SMED30024216|Name=neurexin-2-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3544bp
AAGAAATTCAAAAAATTCATTTAATGAAAAATGAGATTGTATTTATTAGC
TGTTTCTTGGTGGATTTTATATAACAAATTTTCACTAGCGATCTTGGAAA
ATAGACATGGTGGATTAACGACAGTAATGAATGGGAAAGGTTACATTCAT
AACGCCTTTCCGAAGGCTTCAATTAGCTGGTCAACCGAAATCTTAGTGAT
TGAGTTCAAAACCAAACAAGGAGATGTTGTTTTATTTTATTCAGGCGACA
TGAATGAACTGACACCAGTTGCTACATTCAGATCAACACTAATTTACATT
GACAAGCTCGGGCAACTGGCTTATAACTTTACGAGATCTGACGACAAGAC
TAAGAGAACAATTGACATTAAACTCCTGAACAAATATGGTGGAATCTTCA
ATGATAATCAATGGCACAAAGTGAAATTTATTCGATCTTTAAATAAAGCA
CAGAAAGGCTATGATTTAAAGATAGTTATTGAAGAGGATGACATTATCAT
ATACAAAAAGTCTTTTTCAACTTTATCATTGTTTGTCAAAACTCGATTCC
TCAGTATTGGAGGGCTATCGAATCCAGTGTTTAGAATGAAAAATTTTATA
GGATGTTTATTTAAAGTCATCTACAAAGCGGATAATATTTATCTTGACGT
TCTAGATTTTACCCAGAAAAAACTGCATGGTTTTTCTGAAATCGGTCAAC
CAATATCGTTTAGTAAAACTTGCCAACAAAAGATTGAAGACTTTAATCCC
ATTTCGTTTCTAAGTCAGACTTCATTCGTCGTATTAAAAACCAAAACACA
ACCTTATGAGTTTTATGACCTGAAACTTAGTTTTCAACCTCAAACAACCT
CTTTTATAATTTATTTTCATAGATCAAAGAATAATGACCATTTTATTTCC
GTTGAAGCTCGAGACAGACAGTTGATTATTGGGATAAGTGTACATCACAA
AGTCGTTATGTGGTATCCTGAAGAATGCCTCATAGACATTGAGAGATCAT
ATTCCATTCATTTATATGTTGATTATATGAATGGGAAAGCAAAGCTGAAA
TTTAATAATGATATTTCAGTAGAAAAGTTCATCATATTTAATACTTCAGA
TTTTCCAGTTGATCTTTCAGCTCTTTTTAATTCGGAAATCATTTTAGGAA
ATCAATTTTCATTAAATTCTGTAAAGTATTTTCCATCTGAAGTATGGATG
GCTACTTTGAGAAAAGGATTTCAAGGCTGTATAGAAAAAGTAATTCTCAA
TGACGAAGTATTTGATTTAAAAAGAAGCTTATTGTCTGTTAAACTTAAAC
AATCTAATTTGACAATTAAAGGGTGCTACACAAGTACCATAAGCCCATCG
GAGTGCTCAAAATTAAAATCAAAGTCATCCCCTTGTGCAAATCAAGGTTA
CTGTGAAAATTATTGGCCAGAGATTTCCTGTAACTGTGATTTTACAAATT
ACAAAGGAAGGATCTGTAATAAAGGTACTCGTGCAATTGAATTCGATGGC
AGTGAATTTATCAGATTAGATTTGGGAACAGAATTTTACACTGAGGTGGA
ATCTATTCTTATTAGATTTTCCACTATATATCCGACCGGCTATTTATTAT
CCCTAAATCCGAGTGATTTTTCTGAGTTTAACTCTTCCTCAATTCTACTA
TCAATTGAAAATGGTTTGCTCATTCTCATTATTCAGCCTCAAAGTGAACG
ACAAATTTTCAAATTGACAAACAATGTTAGCGACGGCCAGTGGCACAGTT
TAATCATTAGTAGAAATAATCGGGCACTTTCTTTGAATTTGGATGGGAAA
ATATTGCAACAAGAAGTAAACTTTCATTCTAATGAGAAACTGCAAATTGT
ATGGAAGAGTATTAATATCGGATTTGGTGCTATTAATTCAAACGAAACTA
TCTTATCATGGCAACAGTTGCATATTGGAGCCTCTCTCAAGTATAACGAT
TATCACTATAATCGCCCTTTTTCCCCGAAAGTCTGGATGATCAAGACCAA
TTCCGATCAAAAAGACGGTTTAAAACCAAATTTCGTTGGAAAAATTAATA
AATTGCGAATAAACAGCGTCGACATTATTGATGATTACATATTGTTGAAT
AGGTTATCCGATCACCAATGGAAAATGCAAGCTCAAGTCAATCCAAACGC
CATAGGATCAAAGCATGTGGTCTATTCAGTAACCTTTCACACTCCCCAGG
CCTATTTGCTGGTTCATAAGTTACATTTATACGGCTCATTCTCATTGGCA
TTTTATTTGAAAACCAACCAAAAAGATGGGGTACTTCTGATGATCAGTGG
AACGTCAAATGATTTTCTTTTAATGGAGTTGATTCATGGTGGTATTAAGC
TGTCTTTCAACATGGGTTCAACTGTTCAAATTCTGACAGATAATTGCCAT
GGATCTTGCAGCTTGGCTGATAATAAATGGCATTTGTTAGAAATTTCCCG
GTTAGATTTGAGTAGAAATGTTCTTTCACTGTCTATTGACAAAGTGATGA
TTGAAGAAGTGACAATTCACAATAGTCATAAAGCAAAGAATTTCAATTTC
GACAGGCCAGCTTACCTTGGAGGAATGCCGAGATATGAATATCAAAAATG
GACAGAATATATATTTTCAAACTATGGATTTCAGGGCTGCATAGCTGGGT
TTAGTATTAATGGGAAAAAACCAATTAATTTATTGCAATACTCAATAGTG
GAAATCCCTGATGTTTATAAATCTCAAATTGCTCATAATTGCCAATCAAA
TCTGACAATTTGCAAGGATAATCACTGCAAAAATGGGGGACAGTGTTTGC
AACAATTCGAGCAAGCGTCTTGTGACTGCAGTTATACAACATTTGAAGGG
AGATTTTGTACAAAAGTTTCTGCAACGATAAATTTCAGGCGACAGGTAGC
ATCAAATAATTATATTCAATTGCAATTTCAAGATCGCACTCGAAACACAT
CTAGAGACGACATCGCCTTCGGACTTCAAACTAGAAAATTAGACGGAACA
ATTATTTTTGTAGAGTCCAAAAGAAAAGATAAAGGAGATTTTATACATTT
GTTTTTGGAAAATGGAAAAATAATATTAGAATACGATATGGGTGCAGGCA
TTATGAAGCTCACTGATCTCAGTATTAAGGTTTCAGACGGCTTTTATCGC
AGAGTTAGAGTTAGAAGATTAGGATCATCGGCATGGCTTCAGATAGATAA
TTCAAGATCAGAATTAGAGCGAACTGACCTTAATCTTGGACGTTCGTTTA
ATGAACAATCAATCATTTATATCGGAGCATCTCCAATTAAAAAGGAAGGA
AAACAGTTTGTCGGTTTGATATCAGGTTTGATCTTTAACGGAATCAAGAT
ACCCTATGTCTTAGAACATAAAAAAGAGTTTCCTTACATATTTGTATCAA
TTTTCGGAGACGTGGAGATTAATGTAACCTCGAAAATTAAATTACCAAAA
AATTCTGTATTTGAAATCTCCGACTCAGGAAACGAAAAAACCTACCGTTA
TTTGGAATCATCAATTTCGCCAACAAATCTCTGTAAGAATCGGC
back to top

protein sequence of SMED30024216-orf-1

>SMED30024216-orf-1 ID=SMED30024216-orf-1|Name=SMED30024216-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1171bp
MRLYLLAVSWWILYNKFSLAILENRHGGLTTVMNGKGYIHNAFPKASISW
STEILVIEFKTKQGDVVLFYSGDMNELTPVATFRSTLIYIDKLGQLAYNF
TRSDDKTKRTIDIKLLNKYGGIFNDNQWHKVKFIRSLNKAQKGYDLKIVI
EEDDIIIYKKSFSTLSLFVKTRFLSIGGLSNPVFRMKNFIGCLFKVIYKA
DNIYLDVLDFTQKKLHGFSEIGQPISFSKTCQQKIEDFNPISFLSQTSFV
VLKTKTQPYEFYDLKLSFQPQTTSFIIYFHRSKNNDHFISVEARDRQLII
GISVHHKVVMWYPEECLIDIERSYSIHLYVDYMNGKAKLKFNNDISVEKF
IIFNTSDFPVDLSALFNSEIILGNQFSLNSVKYFPSEVWMATLRKGFQGC
IEKVILNDEVFDLKRSLLSVKLKQSNLTIKGCYTSTISPSECSKLKSKSS
PCANQGYCENYWPEISCNCDFTNYKGRICNKGTRAIEFDGSEFIRLDLGT
EFYTEVESILIRFSTIYPTGYLLSLNPSDFSEFNSSSILLSIENGLLILI
IQPQSERQIFKLTNNVSDGQWHSLIISRNNRALSLNLDGKILQQEVNFHS
NEKLQIVWKSINIGFGAINSNETILSWQQLHIGASLKYNDYHYNRPFSPK
VWMIKTNSDQKDGLKPNFVGKINKLRINSVDIIDDYILLNRLSDHQWKMQ
AQVNPNAIGSKHVVYSVTFHTPQAYLLVHKLHLYGSFSLAFYLKTNQKDG
VLLMISGTSNDFLLMELIHGGIKLSFNMGSTVQILTDNCHGSCSLADNKW
HLLEISRLDLSRNVLSLSIDKVMIEEVTIHNSHKAKNFNFDRPAYLGGMP
RYEYQKWTEYIFSNYGFQGCIAGFSINGKKPINLLQYSIVEIPDVYKSQI
AHNCQSNLTICKDNHCKNGGQCLQQFEQASCDCSYTTFEGRFCTKVSATI
NFRRQVASNNYIQLQFQDRTRNTSRDDIAFGLQTRKLDGTIIFVESKRKD
KGDFIHLFLENGKIILEYDMGAGIMKLTDLSIKVSDGFYRRVRVRRLGSS
AWLQIDNSRSELERTDLNLGRSFNEQSIIYIGASPIKKEGKQFVGLISGL
IFNGIKIPYVLEHKKEFPYIFVSIFGDVEINVTSKIKLPKNSVFEISDSG
NEKTYRYLESSISPTNLCKNR
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR001791Laminin_G
IPR013320ConA-like_dom_sf
IPR000742EGF-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004872receptor activity
GO:0005246calcium channel regulator activity
GO:0005509calcium ion binding
GO:0033130acetylcholine receptor binding
GO:0046872metal ion binding
GO:0050839cell adhesion molecule binding
GO:0097109neuroligin family protein binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0031965nuclear membrane
GO:0031982vesicle
GO:0042734presynaptic membrane
GO:0043025neuronal cell body
GO:0043234protein complex
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007158neuron cell-cell adhesion
GO:0007268chemical synaptic transmission
GO:0007269neurotransmitter secretion
GO:0007411axon guidance
GO:0007416synapse assembly
GO:0007612learning
GO:0030534adult behavior
GO:0035176social behavior
GO:0042297vocal learning
GO:0050885neuromuscular process controlling balance
GO:0051965positive regulation of synapse assembly
GO:0051968positive regulation of synaptic transmission, glutamatergic
GO:0060134prepulse inhibition
GO:0061178regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0065009regulation of molecular function
GO:0071625vocalization behavior
GO:0090129positive regulation of synapse maturation
GO:0097104postsynaptic membrane assembly
GO:0097116gephyrin clustering involved in postsynaptic density assembly
GO:0097118neuroligin clustering involved in postsynaptic membrane assembly
GO:0097119postsynaptic density protein 95 clustering
GO:2000463positive regulation of excitatory postsynaptic potential
GO:2000821regulation of grooming behavior
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001791Laminin G domainSMARTSM00282LamG_3coord: 478..653
e-value: 2.5E-8
score: 43.7
coord: 947..1078
e-value: 1.3E-22
score: 91.1
coord: 708..852
e-value: 3.0E-22
score: 89.9
coord: 24..174
e-value: 0.013
score: 24.7
coord: 233..382
e-value: 0.23
score: 10.6
IPR001791Laminin G domainPFAMPF02210Laminin_G_2coord: 486..652
e-value: 8.4E-12
score: 45.8
coord: 956..1077
e-value: 5.5E-17
score: 62.5
coord: 716..852
e-value: 1.2E-18
score: 67.9
coord: 32..170
e-value: 3.2E-8
score: 34.2
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 456..680
score: 14.939
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 688..877
score: 33.643
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 3..204
score: 18.664
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 212..405
score: 12.639
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 924..1105
score: 23.429
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 685..870
e-value: 1.2E-33
score: 118.3
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 417..454
e-value: 1.0E-7
score: 33.7
coord: 880..916
e-value: 3.0E-10
score: 41.8
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 917..1106
e-value: 1.7E-34
score: 121.3
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 211..394
e-value: 3.6E-13
score: 51.5
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 455..664
e-value: 8.0E-21
score: 76.4
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 2..191
e-value: 2.3E-15
score: 58.5
NoneNo IPR availablePANTHERPTHR15036:SF51NEUREXIN-1coord: 91..616
coord: 681..1080
NoneNo IPR availablePANTHERPTHR15036FAMILY NOT NAMEDcoord: 681..1080
NoneNo IPR availablePANTHERPTHR15036FAMILY NOT NAMEDcoord: 91..616
NoneNo IPR availableCDDcd00110LamGcoord: 458..562
e-value: 8.48061E-12
score: 62.0505
NoneNo IPR availableCDDcd00110LamGcoord: 937..1076
e-value: 1.93869E-19
score: 84.0068
NoneNo IPR availableCDDcd00110LamGcoord: 689..850
e-value: 1.13153E-22
score: 93.2516
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 411..453
score: 10.826
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 880..917
score: 13.778
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 897..1082
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 214..392
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 424..590
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 7..183
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 689..862