intraflagellar transport protein 81 homolog

Overview
Nameintraflagellar transport protein 81 homolog
Smed IDSMED30024215
Length (bp)2175
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of intraflagellar transport protein 81 homolog (SMED30024215) t-SNE clustered cells

Violin plots show distribution of expression levels for intraflagellar transport protein 81 homolog (SMED30024215) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of intraflagellar transport protein 81 homolog (SMED30024215) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for intraflagellar transport protein 81 homolog (SMED30024215) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024215

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024215h1SMcG0018683 SmedASXL_010932SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30024215h1SMcG0018683 dd_Smed_v4_8803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024215h1SMcG0018683 dd_Smed_v4_8803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024215h1SMcG0018683 dd_Smed_v4_8803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024215h1SMcG0018683 dd_Smed_v4_8803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024215h1SMcG0018683 dd_Smed_v6_8803_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30024215h1SMcG0018683 dd_Smed_v4_8803_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30024215h1SMcG0018683 dd_Smed_v4_8803_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Human
Match: IFT81 (intraflagellar transport 81 [Source:HGNC Symbol;Acc:HGNC:14313])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 331/687 (48.18%), Postives = 468/687 (68.12%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MS+ +KFI+  LNK+PF KN+N+I+FDS+E +QLLQV++DV+A ID K  +DIREE  EQT  R++ +L I +YKP+ +  ++++  QG VIG K  IYP+L WLL   ++LKKRAYL+RF++ ++VP+EFLQDE +A    QYEE++ +FK  HKE E +K SG +TA+++KDI+ M+ EK+QLIKRV+  +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MRQ  A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  KI E+N EIN++ E +MM     E KL ++RQQASI++RKK+   E+L+E +E L+  E E   KRN+     G +        +L+G+EFK+YV +LRSKS ++K   Q ++ELKAE G+L RT ELL Q+ +  + +L  +E K+G SGY   Q+ LE+VS   S+++  KG TL+DMS M+ KL + ++ KK+ L  ++K+++ LRQK QEL    D+KK  YDS  A  E NRSKL+ EV+ L+EE    ESRYHY  CM   L+    R  +EMK Y+S D  EK+K+ RE YTK   EQE L K LRE+QK IRESHGPN+KQ +MW DL+ L++CK +C  +Q  + S G +   +Q+  E+RLIL
Sbjct:    1 MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLGILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIARQLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTE--------VLKGDEFKRYVNKLRSKSTVFKKKHQIIAELKAEFGLLQRTEELLKQRHENIQQQLQTMEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMVKKLYSLVSEKKSALASVIKELRQLRQKYQELTQECDEKKSQYDSCAAGLESNRSKLEQEVRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQV---IQEGGEDRLIL 676          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Human
Match: IFT81 (intraflagellar transport 81 [Source:HGNC Symbol;Acc:HGNC:14313])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 331/687 (48.18%), Postives = 468/687 (68.12%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MS+ +KFI+  LNK+PF KN+N+I+FDS+E +QLLQV++DV+A ID K  +DIREE  EQT  R++ +L I +YKP+ +  ++++  QG VIG K  IYP+L WLL   ++LKKRAYL+RF++ ++VP+EFLQDE +A    QYEE++ +FK  HKE E +K SG +TA+++KDI+ M+ EK+QLIKRV+  +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MRQ  A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  KI E+N EIN++ E +MM     E KL ++RQQASI++RKK+   E+L+E +E L+  E E   KRN+     G +        +L+G+EFK+YV +LRSKS ++K   Q ++ELKAE G+L RT ELL Q+ +  + +L  +E K+G SGY   Q+ LE+VS   S+++  KG TL+DMS M+ KL + ++ KK+ L  ++K+++ LRQK QEL    D+KK  YDS  A  E NRSKL+ EV+ L+EE    ESRYHY  CM   L+    R  +EMK Y+S D  EK+K+ RE YTK   EQE L K LRE+QK IRESHGPN+KQ +MW DL+ L++CK +C  +Q  + S G +   +Q+  E+RLIL
Sbjct:    1 MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLGILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIARQLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTE--------VLKGDEFKRYVNKLRSKSTVFKKKHQIIAELKAEFGLLQRTEELLKQRHENIQQQLQTMEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMVKKLYSLVSEKKSALASVIKELRQLRQKYQELTQECDEKKSQYDSCAAGLESNRSKLEQEVRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQV---IQEGGEDRLIL 676          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Human
Match: IFT81 (intraflagellar transport 81 [Source:HGNC Symbol;Acc:HGNC:14313])

HSP 1 Score: 521.546 bits (1342), Expect = 4.700e-177
Identity = 281/593 (47.39%), Postives = 397/593 (66.95%), Query Frame = 1
Query:  151 LQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAK 1929
            +QLLQV++DV+A ID K  +DIREE  EQT  R++ +L I +YKP+ +  ++++  QG VIG K  IYP+L WLL   ++LKKRAYL+RF++ ++VP+EFLQDE +A    QYEE++ +FK  HKE E +K SG +TA+++KDI+ M+ EK+QLIKRV+  +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MRQ  A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  KI E+N EIN++ E +MM     E KL ++RQQASI++RKK+   E+L+E +E L+  E E   KRN+     G +        +L+G+EFK+YV +LRSKS ++K   Q ++ELKAE G+L RT ELL Q+ +  + +L  +E K+G SGY   Q+ LE+VS   S+++  KG TL+DMS M+ KL + ++ KK+ L  ++K+++ LRQK QEL    D+KK  YDS  A  E NRSKL+ EV+ L+EE    ESRYHY  CM   L+    R  +EMK Y+S D  EK+K+ RE YTK   EQE L K
Sbjct:    2 MQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLGILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIARQLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTE--------VLKGDEFKRYVNKLRSKSTVFKKKHQIIAELKAEFGLLQRTEELLKQRHENIQQQLQTMEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMVKKLYSLVSEKKSALASVIKELRQLRQKYQELTQECDEKKSQYDSCAAGLESNRSKLEQEVRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGK 586          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Human
Match: IFT81 (intraflagellar transport 81 [Source:HGNC Symbol;Acc:HGNC:14313])

HSP 1 Score: 381.333 bits (978), Expect = 3.520e-125
Identity = 194/404 (48.02%), Postives = 280/404 (69.31%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEE 1269
            MS+ +KFI+  LNK+PF KN+N+I+FDS+E +QLLQV++DV+A ID K  +DIREE  EQT  R++ +L I +YKP+ +  ++++  QG VIG K  IYP+L WLL   ++LKKRAYL+RF++ ++VP+EFLQDE +A    QYEE++ +FK  HKE E +K SG +TA+++KDI+ M+ EK+QLIKRV+  +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MRQ  A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  KI E+N EIN++ E +MM     E KL ++RQQASI++RKK+   E+L+E +E L+  E E   KRN+     G +        +L+G+E
Sbjct:    1 MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLGILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIARQLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTE--------VLKGDE 396          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Human
Match: IFT81 (intraflagellar transport 81 [Source:HGNC Symbol;Acc:HGNC:14313])

HSP 1 Score: 335.109 bits (858), Expect = 3.023e-108
Identity = 181/405 (44.69%), Postives = 259/405 (63.95%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADV-KKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEE 1269
            MS+ +KFI+  LNK+PF KN+N+I+FDS+E +QLLQV++DV+A ID K  +DIREE  EQT  R++ +L I +YKP+ +  ++++  QG VIG K  IYP+L WLL   ++LKKRAYL+RF++ ++VP+EFLQDE                               T AD  K+DI+ M+ EK+QLIKRV+  +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MRQ  A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  KI E+N EIN++ E +MM     E KL ++RQQASI++RKK+   E+L+E +E L+  E E   KRN+     G +        +L+G+E
Sbjct:    1 MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLGILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDE-------------------------------TVADTNKQDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIARQLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTE--------VLKGDE 366          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Celegans
Match: ift-81 (IFT (Chlamydomonas IntraFlagellar Transport) homolog [Source:UniProtKB/TrEMBL;Acc:A8DYR7])

HSP 1 Score: 227.639 bits (579), Expect = 6.659e-65
Identity = 131/451 (29.05%), Postives = 271/451 (60.09%), Query Frame = 1
Query:   76 FIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEI 1428
            FI+  LN++PFN N + + FD +   QLLQ++++V++ +   ++IDI+ E+ E+T IRI+ ML+I RY+P  DQ+       G V G K ++YP+L +L  +   LK+RAYLS++++   VP EF  D +I  L ++  E+ + FKE H E++ I +  +   D+K+D+ +M+ EK+ L++++++  +KV++ P  +  +++A +LR E+ + +    + Q+++  ++ I+ +INR+   + E + +  T   ++L+++ E+E   N  +V  KL  E+   E  +++L  +    ++ + D+ ++N +I+E++  I ++ + R       ++ + +FR Q S++ RKK+ AV++L+E+R+ L++ E +++E++  +     K GG      ++   +++KY+ Q R KS   K  R+ +  +  E  +L RTI++++++ +K +  +  I
Sbjct:    8 FILHFLNEEPFNLNLSSLQFDQLPPQQLLQILSNVLSWVSDTDRIDIKREAAEETAIRILNMLRILRYRPPQDQDEQEEWRAGIVEGRKTSLYPLLVFLFENSEGLKERAYLSKYLMKTDVPGEFF-DYDIEELQNEIGELTMEFKEIHAEMKGIMADVLLLDDIKEDLKSMEKEKQILLRKIEKTEKKVQNIPYFDKQMQLALQLRGEKTRYADFAIEKQQERQKVLNIEARINRMKINLTEAQAVADTLDEQALMEKLEDEVATNTYLVNGKLFQEIESKENKLKELTAMARSNSVREEDVSRMNSEIEEMSKRIRKLEDERDHKEVDIDENMSVFRHQTSLLERKKETAVQKLQELRQELAKIEKDVDERKTNL---KDKVGG-----EVVSNVQYRKYLEQYRVKSEEQKKKRKEIELMHTEVAVLKRTIDIVSKRYNKLETHIESI 449          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Zebrafish
Match: ift81 (intraflagellar transport 81 homolog [Source:ZFIN;Acc:ZDB-GENE-040714-3])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 306/647 (47.30%), Postives = 439/647 (67.85%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMW 1998
            MSE LKFIV++LNK+PF KNFN+I+FDS+E +QLLQ ++DV+A ID K  IDIREE  EQT  R+  +L + +YKP+   + ++S  QG V G K  ++PIL WLL  I +LKKRAYL+RF+V ++VP EFLQD+ IA  Y QYEE++  FK  HKE E +KSSG +TA++++DI  M+ EK+QLIKRV+R R++VE+  N + ML +A++LR E+++E  L HQ QEQK  L   +Q++ R   Q+K+++Q  A   PESL++R EE+ +FN  MV+EKLP EL    K +Q LQ V SEPAM Q++L ++  KI+E N EIN + E RMM  +  +DKL +FRQQA+I+ RKK+  VE+L+E RE L+  E EL    N   +   ++GG      ++RG+EFK+YVA++R KS+ YK  RQ ++ELKAE G+L RT E+L ++    + +L  +E++RG SGY D Q+ LE+VS   S+++  KG TL+DMS M+ KL + I  KK+ L P++KD++ LRQ+  EL   Y++KK  Y++  A  E NRS L+ EV+ L+EE    ESRYH+I C   +++S   R  E+ KI  S D   ++ + RE Y     EQE+L K LR++ K +RE+  PN++Q +MW
Sbjct:    1 MSEQLKFIVEQLNKEPFKKNFNLITFDSLEPMQLLQTLSDVLAEIDPKQAIDIREELPEQTAKRMFTLLGMLKYKPSGGMSEVSSFRQGLVSGSKPVVHPILHWLLQRIPELKKRAYLARFLVKLEVPAEFLQDDVIAETYHQYEELVEGFKNIHKECEQLKSSGFSTAEIRRDIVAMEEEKDQLIKRVERLRKRVEAVANHQRMLDLARQLRVEKEREESLAHQKQEQKNQLFQAEQRLQRCQIQLKDLQQAAADEKPESLMKRLEEDIKFNSYMVSEKLPRELENMRKVVQYLQKVASEPAMGQAELRELEDKIRETNTEINHLIEKRMMRNDPMDDKLSLFRQQAAIIVRKKETKVEELQEAREELAAVEREL----NMKTSQAQERGGE-----LIRGDEFKRYVAKMRGKSSTYKKKRQEIAELKAEYGVLQRTEEILRERHTAGQQQLQSLEAQRGISGYSDTQEELERVSAIKSELDEMKGRTLDDMSEMVKKLNSVIAEKKSALSPLIKDLRALRQEHAELAPEYEEKKAQYETCAAGLESNRSTLEQEVRTLREETAQEESRYHHINCEREIIESQIQRAAEQSKISQSMDVQVRRTALREKYIANTAEQESLGKVLRQQVKQVRENQEPNMRQMKMW 638          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Xenopus
Match: tnpo1 (transportin 1 [Source:Xenbase;Acc:XB-GENE-493792])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 317/687 (46.14%), Postives = 469/687 (68.27%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MS+ LKFIV++LNK+PF KN+N+I+FDS+E +QLLQV+NDV+A ID K+ +DIREE  +QT  R++ +L I +YKP  +  +++   QG V+G K  I+P+L WLL   +DLKKRAYLSRF+V ++VP EFLQD+ ++    QYEE++ +FK  HKE E +KSSG +TA++++DI+ M+ EK+QLIKRV+R +++VE+  N + ML++A++LR E+++E  L  Q QEQK  L   +Q++ R   Q+K MR   A A PE L++R EEE +F+  MV+EKLP EL    + +   Q V+SEPAMSQ+DL ++ +KI EVN +IN++ E RM + +  +DKL +FRQQA+I+ARKK+   E+L+E +E ++  E E+ +K ++     G +        +LRG+EFK YV++LR KS++YK  RQ L+EL AE G+L RT E+L Q+ +  + +L  IE K+G  GY D Q+ LE+VS   S+++  KG TL+D+S M+ KL + I  KK+ L P++K+++PLRQ+ QEL   +DDKK  YDS  A  E NRSK + EV+ L+EE   LES+YH I  M+  ++    R  +EMK Y+S D  +++K+ RE Y++ I EQE L K+LRE+QK +RESHGPN+KQ +MW       +   +C++  +QK+    I   +Q   E+ LIL
Sbjct:    1 MSDQLKFIVEKLNKEPFKKNYNLITFDSLEPMQLLQVLNDVLAEIDPKHSVDIREEMPDQTAKRMLSVLGILKYKPPGNIGDMSVFRQGLVVGSKPIIHPVLYWLLQRTNDLKKRAYLSRFLVRLEVPEEFLQDDIVSETNKQYEELMENFKMIHKECEQLKSSGFSTAEIRRDISAMEEEKDQLIKRVERLKKRVETVQNHQRMLEIARQLRVEKEREESLAQQKQEQKNQLFHAEQRLQRAQLQLKNMRNAAADAKPEGLMKRLEEEMKFHSYMVSEKLPKELESKRQTLHFQQKVVSEPAMSQADLTELEEKIHEVNLQINQLIENRMRN-DPMDDKLSLFRQQAAIIARKKETKAEELQEAKEEIANLEREIAQKSSQARDIDGSE--------VLRGDEFKHYVSKLRFKSSVYKKKRQELAELSAENGVLQRTEEILKQRHENIQQQLQAIEQKKGILGYSDTQEELERVSALKSEVDEMKGRTLDDISDMVKKLNSRIAEKKSGLAPVIKELRPLRQRCQELTQEHDDKKAQYDSCAAGLESNRSKSEQEVRGLREECSQLESQYHLINLMKKSVEVQIQRAADEMKAYVSPDPQDRRKAIREQYSRNILEQENLGKALREKQKLVRESHGPNMKQVKMW----RDFEKLMECKKSCFQKQQQASIGQVIQGGGEDLLIL 674          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Xenopus
Match: tnpo1 (transportin 1 [Source:Xenbase;Acc:XB-GENE-493792])

HSP 1 Score: 523.857 bits (1348), Expect = 7.801e-178
Identity = 293/687 (42.65%), Postives = 440/687 (64.05%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MS+ LKFIV++LNK+PF KN+N+I+FDS+E +QLLQV+NDV+A ID K+ +DIREE  +QT  R++ +L I +YKP  +  +++   QG V+G K  I+P+L WLL   +DLKKRAYLSRF+V ++VP EFLQD+ ++    QYEE++ +FK  HKE E +KSSG +TA++++DI+ M+ EK+QLIKRV+R +++VE+  N + ML++A++LR E+++E  L  Q QEQK  L   +Q++ R   Q+K MR   A A PE L++R EEE +F+  MV+EKLP EL    + +   Q V+SEPAMSQ+DL ++ +KI EVN +IN++ E RM + +  +DKL +FRQQA+I+ARKK+   E+L+E +E ++  E E+ +K ++     G +        +LRG+EFK YV++LR KS++YK  RQ L+EL AE G+L RT E+L Q+ +  + +L  IE K+G  GY D Q+ LE+VS   S+++  KG TL+D+S M++    +I    N ++ +V              H                         EV+ L+EE   LES+YH I  M+  ++    R  +EMK Y+S D  +++K+ RE Y++ I EQE L K+LRE+QK +RESHGPN+KQ +MW       +   +C++  +QK+    I   +Q   E+ LIL
Sbjct:    1 MSDQLKFIVEKLNKEPFKKNYNLITFDSLEPMQLLQVLNDVLAEIDPKHSVDIREEMPDQTAKRMLSVLGILKYKPPGNIGDMSVFRQGLVVGSKPIIHPVLYWLLQRTNDLKKRAYLSRFLVRLEVPEEFLQDDIVSETNKQYEELMENFKMIHKECEQLKSSGFSTAEIRRDISAMEEEKDQLIKRVERLKKRVETVQNHQRMLEIARQLRVEKEREESLAQQKQEQKNQLFHAEQRLQRAQLQLKNMRNAAADAKPEGLMKRLEEEMKFHSYMVSEKLPKELESKRQTLHFQQKVVSEPAMSQADLTELEEKIHEVNLQINQLIENRMRN-DPMDDKLSLFRQQAAIIARKKETKAEELQEAKEEIANLEREIAQKSSQARDIDGSE--------VLRGDEFKHYVSKLRFKSSVYKKKRQELAELSAENGVLQRTEEILKQRHENIQQQLQAIEQKKGILGYSDTQEELERVSALKSEVDEMKGRTLDDISDMVILQYMNIC---NRMLWVV--------------HF-----------------------QEVRGLREECSQLESQYHLINLMKKSVEVQIQRAADEMKAYVSPDPQDRRKAIREQYSRNILEQENLGKALREKQKLVRESHGPNMKQVKMW----RDFEKLMECKKSCFQKQQQASIGQVIQGGGEDLLIL 634          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Xenopus
Match: tnpo1 (transportin 1 [Source:Xenbase;Acc:XB-GENE-493792])

HSP 1 Score: 513.842 bits (1322), Expect = 1.835e-174
Identity = 265/563 (47.07%), Postives = 394/563 (69.98%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKE 1746
            MS+ LKFIV++LNK+PF KN+N+I+FDS+E +QLLQV+NDV+A ID K+ +DIREE  +QT  R++ +L I +YKP  +  +++   QG V+G K  I+P+L WLL   +DLKKRAYLSRF+V ++VP EFLQD+ ++    QYEE++ +FK  HKE E +KSSG +TA++++DI+ M+ EK+QLIKRV+R +++VE+  N + ML++A++LR E+++E  L  Q QEQK  L   +Q++ R   Q+K MR   A A PE L++R EEE +F+  MV+EKLP EL    + +   Q V+SEPAMSQ+DL ++ +KI EVN +IN++ E RM + +  +DKL +FRQQA+I+ARKK+   E+L+E +E ++  E E+ +K ++     G +        +LRG+EFK YV++LR KS++YK  RQ L+EL AE G+L RT E+L Q+ +  + +L  IE K+G  GY D Q+ LE+VS   S+++  KG TL+D+S M+ KL + I  KK+ L P++K+++PLRQ+ QEL   +DDKK  YDS  A  E NRSK + + K+++E
Sbjct:    1 MSDQLKFIVEKLNKEPFKKNYNLITFDSLEPMQLLQVLNDVLAEIDPKHSVDIREEMPDQTAKRMLSVLGILKYKPPGNIGDMSVFRQGLVVGSKPIIHPVLYWLLQRTNDLKKRAYLSRFLVRLEVPEEFLQDDIVSETNKQYEELMENFKMIHKECEQLKSSGFSTAEIRRDISAMEEEKDQLIKRVERLKKRVETVQNHQRMLEIARQLRVEKEREESLAQQKQEQKNQLFHAEQRLQRAQLQLKNMRNAAADAKPEGLMKRLEEEMKFHSYMVSEKLPKELESKRQTLHFQQKVVSEPAMSQADLTELEEKIHEVNLQINQLIENRMRN-DPMDDKLSLFRQQAAIIARKKETKAEELQEAKEEIANLEREIAQKSSQARDIDGSE--------VLRGDEFKHYVSKLRFKSSVYKKKRQELAELSAENGVLQRTEEILKQRHENIQQQLQAIEQKKGILGYSDTQEELERVSALKSEVDEMKGRTLDDISDMVKKLNSRIAEKKSGLAPVIKELRPLRQRCQELTQEHDDKKAQYDSCAAGLESNRSKSEEKQKLVRE 554          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Mouse
Match: Ift81 (intraflagellar transport 81 [Source:MGI Symbol;Acc:MGI:1098597])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 324/687 (47.16%), Postives = 464/687 (67.54%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MS+ +KFIV  LNK+PF KN+N+I+FDS+  +QLLQV+NDV+A ID K  +DIREE  EQT  R++ +L I +YKP  +  ++++  QG VIG K  IYP+L WLL   ++LKKRAYL+RF++ ++VP+EFLQDE +A    QYEE++ +FK  HKE E +K+SG +TA++++DI+ M+ EK+QL+KRV+R +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MR   A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  K+ EVN EIN++ E +MM     E KL ++RQQASI++RKK+   E+L+E +E L+  E E+  K N+     G +        +L+G+EFK+YV++LRSKS ++K   Q ++E KAE G+L RT ELL Q+ +  +++L  IE K+G SGY   Q+ LE+VS   S+++  KG TL+DMS M+ KL + ++ KK+ L P++K+++ LRQK QEL    D+KK  YDS  A  E NRSKL+ EV+ L+EE    ES+YHY  CM   L+    R  +EMK Y+S D  EK+K+ RE YTK I EQE L K LRE+QKA+RESHGPN+KQ +MW     L +     +Q   +++S   I   +Q+  E+RL+L
Sbjct:    1 MSDQIKFIVDSLNKEPFKKNYNLITFDSLGPMQLLQVLNDVLAEIDPKQDVDIREEMPEQTAKRMLNLLGILKYKPPGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRSNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKECEQLKTSGFSTAEIRRDISAMEEEKDQLMKRVERLKKRVETVQNHQRMLKIARQLRVEKEREEFLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRHAAADAKPESLMKRLEEEIKFNSYMVTEKFPKELESKKKELHFLQKVVSEPAMGHSDLLELETKVNEVNTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQETKEKLASLEREVLVKTNQTREFDGTE--------VLKGDEFKRYVSKLRSKSTVFKKKHQIIAEFKAEFGLLQRTEELLKQRQETIQHQLRTIEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMVKKLNSLVSEKKSALAPVIKELRQLRQKCQELTQECDEKKAQYDSCAAGLESNRSKLEQEVRGLREECLQEESKYHYTNCMIKNLEVELRRATDEMKAYVSSDQQEKRKAIREQYTKNITEQENLGKKLREKQKAVRESHGPNMKQAKMW---RDLEQLMECKKQCFLKQQSPASIGQVIQEGGEDRLVL 676          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Mouse
Match: Ift81 (intraflagellar transport 81 [Source:MGI Symbol;Acc:MGI:1098597])

HSP 1 Score: 242.662 bits (618), Expect = 3.462e-75
Identity = 111/217 (51.15%), Postives = 166/217 (76.50%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERD 708
            MS+ +KFIV  LNK+PF KN+N+I+FDS+  +QLLQV+NDV+A ID K  +DIREE  EQT  R++ +L I +YKP  +  ++++  QG VIG K  IYP+L WLL   ++LKKRAYL+RF++ ++VP+EFLQDE +A    QYEE++ +FK  HKE E +K+SG +TA++++DI+ M+ EK+QL+KRV+R +++VE+  N + MLK+A++LR E++
Sbjct:    1 MSDQIKFIVDSLNKEPFKKNYNLITFDSLGPMQLLQVLNDVLAEIDPKQDVDIREEMPEQTAKRMLNLLGILKYKPPGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRSNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKECEQLKTSGFSTAEIRRDISAMEEEKDQLMKRVERLKKRVETVQNHQRMLKIARQLRVEKE 217          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Mouse
Match: Ift81 (intraflagellar transport 81 [Source:MGI Symbol;Acc:MGI:1098597])

HSP 1 Score: 165.622 bits (418), Expect = 9.588e-47
Identity = 89/183 (48.63%), Postives = 125/183 (68.31%), Query Frame = 1
Query:  568 VKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVAR 1116
            V KDI+ M+ EK+QL+KRV+R +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MR   A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  K+ EVN EIN++ E +MM     E KL ++RQQASI++R
Sbjct:   16 VYKDISAMEEEKDQLMKRVERLKKRVETVQNHQRMLKIARQLRVEKEREEFLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRHAAADAKPESLMKRLEEEIKFNSYMVTEKFPKELESKKKELHFLQKVVSEPAMGHSDLLELETKVNEVNTEINQLIEKKMMRNEPIEGKLSLYRQQASIISR 198          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Mouse
Match: Ift81 (intraflagellar transport 81 [Source:MGI Symbol;Acc:MGI:1098597])

HSP 1 Score: 67.0106 bits (162), Expect = 1.314e-13
Identity = 30/48 (62.50%), Postives = 40/48 (83.33%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVK 201
            MS+ +KFIV  LNK+PF KN+N+I+FDS+  +QLLQV+NDV+A ID K
Sbjct:    1 MSDQIKFIVDSLNKEPFKKNYNLITFDSLGPMQLLQVLNDVLAEIDPK 48          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Mouse
Match: Ift81 (intraflagellar transport 81 [Source:MGI Symbol;Acc:MGI:1098597])

HSP 1 Score: 66.6254 bits (161), Expect = 1.638e-13
Identity = 30/48 (62.50%), Postives = 40/48 (83.33%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVK 201
            MS+ +KFIV  LNK+PF KN+N+I+FDS+  +QLLQV+NDV+A ID K
Sbjct:    1 MSDQIKFIVDSLNKEPFKKNYNLITFDSLGPMQLLQVLNDVLAEIDPK 48          
BLAST of intraflagellar transport protein 81 homolog vs. UniProt/SwissProt
Match: sp|P83829|IFT81_RAT (Intraflagellar transport protein 81 homolog OS=Rattus norvegicus OX=10116 GN=Ift81 PE=2 SV=1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 324/687 (47.16%), Postives = 465/687 (67.69%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MS+ +KFIV  LNK+PF KN+N+I+FDS+  +QLLQV+NDV+A ID K  +DIREE+ EQT  R++ +L I +YKP  +  ++++  QG VIG K  IYP+L WLL   S+LKKRAYL+RF++ ++VP+EFLQDE +A    QYEE++ +FK  HKE E +K+SG +TA++++DI+ M+ EK+QL+KRV+R +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MR   A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  K+ EVNAEIN++ E +MM     E KL ++RQQASI++RKK+   E+L+E +E L+  E E+  K N+     G +        +L+G+EFK+YV++LRSKS ++K   Q ++E KAE G+L RT ELL Q+ +  +++L  IE K+G SGY   Q+ LE+VS   S+++  KG TL+DMS M+ KL + ++ KK+ L P++K+++ LRQK Q  Q   D+K+  YDS  A  E NRSKL+ EV+ L+EE    ES+YHY  CM   L+    R  +EMK Y+S D  EK+K+ RE YTK I EQE L K LRE+QKA+RESHGPN+KQ +MW     L +     +Q   +++S   I   +Q+  E+RL+L
Sbjct:    1 MSDQIKFIVDSLNKEPFKKNYNLITFDSLGPMQLLQVLNDVLAEIDPKQDVDIREETPEQTAKRMLSLLGILKYKPPGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRSSELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFKALHKECEQLKTSGFSTAEIRRDISAMEEEKDQLMKRVERLKKRVETVQNHQRMLKIARQLRVEKEREEFLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRHAAADAKPESLMKRLEEEIKFNSYMVTEKFPKELESKKKELHFLQKVVSEPAMGHSDLLELESKVNEVNAEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQETKEKLASLEREVSVKTNQTREFDGTE--------VLKGDEFKRYVSKLRSKSTVFKKKHQIIAEFKAEFGLLQRTEELLKQRQETIQHQLRTIEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMVKKLNSLVSEKKSALAPVIKELRQLRQKCQLTQEC-DEKRTQYDSCAAGLESNRSKLEQEVRGLREECLQEESKYHYTNCMIKNLEVQLRRATDEMKAYVSSDQQEKRKAIREQYTKNITEQENLGKKLREKQKAVRESHGPNMKQAKMW---RDLEQLMECKKQCFLKQQSPASIGQVIQEGGEDRLVL 675          
BLAST of intraflagellar transport protein 81 homolog vs. UniProt/SwissProt
Match: sp|O35594|IFT81_MOUSE (Intraflagellar transport protein 81 homolog OS=Mus musculus OX=10090 GN=Ift81 PE=1 SV=4)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 324/687 (47.16%), Postives = 464/687 (67.54%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MS+ +KFIV  LNK+PF KN+N+I+FDS+  +QLLQV+NDV+A ID K  +DIREE  EQT  R++ +L I +YKP  +  ++++  QG VIG K  IYP+L WLL   ++LKKRAYL+RF++ ++VP+EFLQDE +A    QYEE++ +FK  HKE E +K+SG +TA++++DI+ M+ EK+QL+KRV+R +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MR   A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  K+ EVN EIN++ E +MM     E KL ++RQQASI++RKK+   E+L+E +E L+  E E+  K N+     G +        +L+G+EFK+YV++LRSKS ++K   Q ++E KAE G+L RT ELL Q+ +  +++L  IE K+G SGY   Q+ LE+VS   S+++  KG TL+DMS M+ KL + ++ KK+ L P++K+++ LRQK QEL    D+KK  YDS  A  E NRSKL+ EV+ L+EE    ES+YHY  CM   L+    R  +EMK Y+S D  EK+K+ RE YTK I EQE L K LRE+QKA+RESHGPN+KQ +MW     L +     +Q   +++S   I   +Q+  E+RL+L
Sbjct:    1 MSDQIKFIVDSLNKEPFKKNYNLITFDSLGPMQLLQVLNDVLAEIDPKQDVDIREEMPEQTAKRMLNLLGILKYKPPGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRSNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKECEQLKTSGFSTAEIRRDISAMEEEKDQLMKRVERLKKRVETVQNHQRMLKIARQLRVEKEREEFLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRHAAADAKPESLMKRLEEEIKFNSYMVTEKFPKELESKKKELHFLQKVVSEPAMGHSDLLELETKVNEVNTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQETKEKLASLEREVLVKTNQTREFDGTE--------VLKGDEFKRYVSKLRSKSTVFKKKHQIIAEFKAEFGLLQRTEELLKQRQETIQHQLRTIEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMVKKLNSLVSEKKSALAPVIKELRQLRQKCQELTQECDEKKAQYDSCAAGLESNRSKLEQEVRGLREECLQEESKYHYTNCMIKNLEVELRRATDEMKAYVSSDQQEKRKAIREQYTKNITEQENLGKKLREKQKAVRESHGPNMKQAKMW---RDLEQLMECKKQCFLKQQSPASIGQVIQEGGEDRLVL 676          
BLAST of intraflagellar transport protein 81 homolog vs. UniProt/SwissProt
Match: sp|Q8WYA0|IFT81_HUMAN (Intraflagellar transport protein 81 homolog OS=Homo sapiens OX=9606 GN=IFT81 PE=1 SV=1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 331/687 (48.18%), Postives = 468/687 (68.12%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MS+ +KFI+  LNK+PF KN+N+I+FDS+E +QLLQV++DV+A ID K  +DIREE  EQT  R++ +L I +YKP+ +  ++++  QG VIG K  IYP+L WLL   ++LKKRAYL+RF++ ++VP+EFLQDE +A    QYEE++ +FK  HKE E +K SG +TA+++KDI+ M+ EK+QLIKRV+  +++VE+  N + MLK+A++LR E+++E  L  Q QEQK  L    Q++ R+  Q+K MRQ  A A PESL++R EEE +FN  MVTEK P EL   +K +  LQ V+SEPAM  SDL ++  KI E+N EIN++ E +MM     E KL ++RQQASI++RKK+   E+L+E +E L+  E E   KRN+     G +        +L+G+EFK+YV +LRSKS ++K   Q ++ELKAE G+L RT ELL Q+ +  + +L  +E K+G SGY   Q+ LE+VS   S+++  KG TL+DMS M+ KL + ++ KK+ L  ++K+++ LRQK QEL    D+KK  YDS  A  E NRSKL+ EV+ L+EE    ESRYHY  CM   L+    R  +EMK Y+S D  EK+K+ RE YTK   EQE L K LRE+QK IRESHGPN+KQ +MW DL+ L++CK +C  +Q  + S G +   +Q+  E+RLIL
Sbjct:    1 MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLGILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIARQLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTE--------VLKGDEFKRYVNKLRSKSTVFKKKHQIIAELKAEFGLLQRTEELLKQRHENIQQQLQTMEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMVKKLYSLVSEKKSALASVIKELRQLRQKYQELTQECDEKKSQYDSCAAGLESNRSKLEQEVRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQV---IQEGGEDRLIL 676          
BLAST of intraflagellar transport protein 81 homolog vs. UniProt/SwissProt
Match: sp|Q68RJ5|IFT81_CHLRE (Intraflagellar transport protein 81 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT81 PE=1 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 2.113e-75
Identity = 183/649 (28.20%), Postives = 335/649 (51.62%), Query Frame = 1
Query:   70 LKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKN-KIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKED-----KLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGK----QGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQ 1986
            + +IV  L   PF+   +++SF      +LLQ+++DV + I  K+ K+D+ +E  +QT  R++  L+I +Y+P V    L    Q    GD+ T+Y IL W++     L+KRA++  ++    +P EF  D +I  L ++ + +   F E HK  + IK+    T  +K  I +++ EKE+L ++V+R +  V+  P+    +++   LR ++D+E  L   IQ Q+A     +   +R   +++E++      +   L++   E+ +  +  V E+ P E+ K +K    L   ++    ++ DL ++  +   ++ +I  I E ++     ++      +L   +Q A++ ARKK           E L   +  L+EK+  + A   K     GG+G    +   EE++     ++SK  IYK +++ L +L+AE  +LA T ELL  Q+     ++  +E ++G SG+ +   +LEKVSE  S ++  KG TL ++S  + ++ N+IN +K  L P +K ++ +RQ   E +  Y +KK AYD+++AT+E   S L+ EV  LK E+   E++YH + C  ++   N  ++           S    +  R+ Y  K+ E E   K+LR+RQ+ I+++H   L Q
Sbjct:    4 VSYIVDSLGLPPFSYQMSLLSFTEKGPQELLQLLSDVFSTISPKHQKVDVAKEVPDQTADRLIGFLKIIKYRPNVQDPLL--FRQLVAAGDRETLYQILRWVVPQAQLLEKRAFVGYYLSFPDMPEEFNFDPDIMELKEEIKAMQQEFIELHKSSDAIKTLSKDTQALKNKIKSLEEEKERLGEKVERAKGAVDKLPDRSSYMEVCTNLRKQQDEEVNLSTAIQTQRALQEKAEASYHRAAARLRELQTSYQEGSAGKLLETLNEDVKNLRAQVNERYPKEVEKRQKRQAALSEALASGISTEMDLQRLQHQATALHNQITEIQERKVAQDKARQGDKAYLQLRQAQQMATVSARKK-----------EELGAKQERLQEKKTALTAQLDKLNAEGGGSGA---VFSEEEWRTKYESMKSKLPIYKKMKKELGDLEAEVFVLAHTEELLASQEGGLLEKVKRLEKQQGISGFTETAQHLEKVSEAKSQMDEEKGMTLIEISRTVEEINNAINQRKQQLAPQIKKLRSVRQDFAEFEAKYLEKKTAYDNVVATFEARTSALEGEVSGLKAEVSENETKYHMLHCQLHITDQNIKKV----------TSGPAAERLRDKYEAKVKEAEDSTKALRDRQREIKDTHSTGLSQ 626          
BLAST of intraflagellar transport protein 81 homolog vs. TrEMBL
Match: A0A210QUC2 (Intraflagellar transport protein 81-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT20193 PE=4 SV=1)

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 330/651 (50.69%), Postives = 467/651 (71.74%), Query Frame = 1
Query:   46 FIFKMSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMW 1998
             I KMSE LKF+VQEL K+PFNK +N+ISFDS+E +QLLQV+NDV+AV+D K +IDIREES +QT IRI  ML++ +YKP  +    ++   G V GDK  IYPIL+WL   I +LKKRAYL+ F+  I VP E +Q+++I  LY QYEE++  FK+ HK+ + +K+SG  TA+++KDI+ M++EKEQL KR++R +RKVES+PNS+ M+ +A+ LR ERD+E KL  Q QEQ   +   +QKI R+ QQ+ + RQ G  ATP+SL+QR EEE+R NK +VTE+LP +L   +K +QDLQ V++EPAM QSDLD++  +I+E+N+EIN++ E RM + +  +DK  +F+QQA+I+A KK+ AV   RE+RE  SR   E+++KR  V     K+ G G    +L+GE+FK+YV +LRSKS IYK  RQ ++EL+AE G+L+RT E+L  +D+    +L  +E+K+G +GY   QD LEKVS   S ++ RKG TLED+S M+ +LT  I  KK  L P++K+++P+RQKSQEL   +++KKQAYD+  A  E N SKL+ EV+  +EE+   E RYHY+ CM NML+  Q ++ EEMK Y S D   +KK++R+I+ +KI EQE L K LRE+QK++RES  P+++Q +MW
Sbjct:   11 LIGKMSEQLKFVVQELAKEPFNKKYNLISFDSLEQIQLLQVLNDVLAVVDPKQQIDIREESSDQTAIRIFHMLRVLKYKPPTE----SAFRSGIVQGDKFVIYPILEWLFRRIPELKKRAYLAHFLFKIDVPAEIMQEDQIPELYSQYEELMEQFKDLHKQSDNLKNSGYNTAEIRKDISNMEDEKEQLNKRIERLKRKVESHPNSQTMMNVARNLRMERDREKKLAEQRQEQSTLIQHEEQKIRRLQQQLHDTRQAGVGATPQSLLQRLEEETRTNKYIVTERLPKDLLARKKTLQDLQKVVAEPAMGQSDLDRLLGQIQELNSEINQLIEKRMRTGDPTDDKSSLFKQQAAIIAHKKEAAVTMYREIREDYSRCMQEMDQKREVV-----KESGGGE---VLKGEDFKRYVNKLRSKSTIYKKKRQEIAELRAEYGVLSRTEEILRNRDENINQQLELVENKKGVAGYRQTQDELEKVSSVKSGLDDRKGKTLEDISDMVQRLTRRIAEKKTALAPIIKELRPMRQKSQELTGRHEEKKQAYDTAAAGLESNMSKLEQEVRAYREEVTQDEGRYHYLNCMINMLEIQQQKVAEEMKAYTSADPYARKKTFRDIFQRKIQEQENLGKGLREQQKSVRESQVPSMRQMKMW 649          
BLAST of intraflagellar transport protein 81 homolog vs. TrEMBL
Match: A0A4E0S1I4 (Intraflagellar transport protein 81 OS=Fasciola hepatica OX=6192 GN=D915_004506 PE=4 SV=1)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 338/729 (46.36%), Postives = 504/729 (69.14%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQ-------GGTG--------------TYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLS---------------------QDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MSE ++FI Q+LN +PFNK+FN+ISFDSIES+QLLQ+VNDVI+ ID K+K+DIREES +QT +RI E L++FRY+   + N +++  +G V GDKL +YPIL+WLL  I +LKKRAYL++F+V +QVP  F+QDEEI  LY QY  ++ +FKE HK+LE++K+ G++TA+VK+DI  MQ+EK+QL KRVDR ++K++++P S  ML++AK+LR ER++E+++  QIQEQK  +  ++Q+I R  QQVKE+R+  A +TPE+L+QR EEE++ N+ MV+EKLP EL    KYI+DL  V+S+PAM QS LD++N +++EVN++ NR+ E RM S    +DK+ +FRQQASIV+RKK  A E L   R+ L+  E  L E R+++ +            GG+G              T    L+ +EF++YVA+LRSK+ +YK  R  LSEL+AE+GIL RT+E L  ++ + K  L   E+ +G SGYW+ Q NLEKVSEQMS +N +KGATL++MS ++ +LT  IN+K+  L P++++++PLRQK QEL  ++ +KK AYD++ A  E    +L+ +V+  +E  +  ESR+HY++ +  + K  Q RLQEEM+ Y++                      + NE+++S+R++YT+KINEQEAL + L++ QK + E+    L+Q  MW DL  LL+ K +  +    ++ AGG ++DV ++EE+RL+L
Sbjct:    1 MSETIRFITQKLNSEPFNKSFNLISFDSIESIQLLQLVNDVISEIDAKHKMDIREESADQTAVRIFEALRVFRYRCPTEPNEMSTFRKGLVTGDKLVVYPILEWLLQRIPELKKRAYLAKFLVKVQVPEMFMQDEEILALYQQYGSLMENFKEAHKKLESLKTGGLSTAEVKRDIVAMQDEKDQLHKRVDRVKKKLKAFPASTSMLEVAKKLRLEREREARVAKQIQEQKMLIANLEQRIQRTEQQVKELRKAAAGSTPEALLQRMEEETKVNQYMVSEKLPRELEIARKYIEDLNRVVSQPAMGQSFLDQLNAQLREVNSQTNRLIEKRMASNEPLDDKISLFRQQASIVSRKKAAAAEALAVARDNLAALERRLAETRSQLGSTNAHSEESSTTGGGSGDAAKNTADASETRSTGSVGLKADEFQRYVAKLRSKNTVYKQKRAQLSELRAERGILIRTVERLKAEEAETKKGLASSEAAQGISGYWETQSNLEKVSEQMSALNQQKGATLDEMSKIVQQLTARINAKRTQLAPVLRELRPLRQKFQELSQLHAEKKSAYDALAAGQESQSVRLEQDVRASREAGRIEESRFHYLSAVMGIAKVQQYRLQEEMRGYVACGGAGGIVSGSITAATGDTANGNGNERRRSFRDVYTRKINEQEALTRQLKDEQKRLVENQDSGLQQVSMWKDLVQLLEAKQEVHEANEARQRAGGEFADVTRMEEDRLLL 729          
BLAST of intraflagellar transport protein 81 homolog vs. TrEMBL
Match: A0A4S2LRE1 (IFT81_CH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006877 PE=4 SV=1)

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 336/717 (46.86%), Postives = 496/717 (69.18%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVL-ANTGKQ---------GGTGTYEP------ILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLS--------------QDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            M E ++FI Q+LN +PF K+ N+ISFD++E LQLLQ++NDVIA ID K K+DIREES  QT IRI E L+++RYK   DQ  L+   +G V GDK  IYPIL+WLL  I +LK RAYL+RF+V +Q+P  F+QDEEI+ LY QY+ ++ SFK+ H++LE++K  G+TT++VKKDI+ MQ+EK+QL KRVDR ++K+E++P S +ML+MAK+LR ER++E+K+  QI EQK  + ++ Q++  I QQVKE+R+    +TP  L+Q+ EEE R N+ MV++KLP EL   +K+I DL  V+ +PAM Q  LD++N++++EVN++ NR+ E RM S    +DK+ +FRQQA IV+RKK  A E L   R+ L+  E  + E + ++L AN G           G  G+ E        L+ +EF++YVA+LRSK+ +YK  R  LSEL+AE+ IL RT+E L  ++ + K  L   E+ +G SGYW+ Q+NLEKVSEQMS +N +KG TLE+MS ++ +LTN IN+K++ L P++++++PLRQK+QE+  ++ +KK AYD++ A  E    +L+ +V+  +E  K  ESR+HY++ +  + +  Q +LQEEM+ YL+                +NE++KSYREIYT+KINEQEAL ++L+E QK + E+    L+Q  +W DL  LL  K   R+E   ++ AGG Y+DV+++EE+RL+L
Sbjct:    1 MGETIRFITQKLNAEPFRKSLNLISFDALEPLQLLQLINDVIAEIDPKQKVDIREESSAQTAIRIYEALRVYRYKCPTDQTELSEFRKGLVTGDKAVIYPILEWLLQRIPELKTRAYLARFLVKLQIPAVFMQDEEISCLYQQYDSLVASFKDAHRKLESLKYGGLTTSEVKKDISAMQDEKDQLHKRVDRMKKKLEAFPTSLMMLEMAKKLRIEREREAKVAKQIHEQKTMIASLGQRVQHIQQQVKEIRKAATGSTPGILLQKLEEEVRVNQYMVSDKLPRELEAVKKHIDDLNRVVPQPAMGQGFLDQLNQQLREVNSQTNRLIEKRMASCEPLDDKISIFRQQAGIVSRKKAAAAEALAVARDNLAVIERRIGETKAQLLQANGGSDDAYVAAGDVGTKGSSEGRSIGTMGLKADEFQRYVAKLRSKNTVYKQKRSQLSELRAERSILTRTVERLRAEEAEAKRVLAATEASQGISGYWETQNNLEKVSEQMSALNEQKGVTLEEMSQIVQQLTNRINAKRSQLAPILRELRPLRQKAQEISQVHQEKKAAYDALAAGRETQTVRLEQDVRAAREAGKIEESRFHYLSSVMGIARVQQYKLQEEMRGYLAAGNPMNATTVDTSGAGTNERRKSYREIYTRKINEQEALTRTLKEEQKQLTENQASGLRQVSLWRDLVHLLDAKMVAREEDQARQKAGGEYADVKKIEEDRLLL 717          
BLAST of intraflagellar transport protein 81 homolog vs. TrEMBL
Match: A0A2C9K3X9 (IFT81_CH domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106050161 PE=4 SV=1)

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 319/647 (49.30%), Postives = 469/647 (72.49%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMW 1998
            MSE ++FIVQELNK+PF+K++N+ISFDS+E LQLLQV+NDV+A+ID K K+D+REE+ +QT +RI ++L++ +YKP  D  N++    G V G+K  I+PIL+WLL  + +L+KRAYL++F+V I +P E +QDEE+  +Y QYEE++  FKE HK+ E +K+SG  TA+++KDI  M+ EKEQLIKR++R RRKVES+PNS+ M+ +AK LR ERD+E +L  Q QEQ+  +  +DQ+I R+  Q+++MRQ    ATP +++Q+ EEESR N  +V E+LP ++A+ +K IQ+LQ V+S PAM  SDL+++N KI E+NAE+N++ E RM S +  +DKL +FRQQA+I+A KK  A E LR +R+  +  ++E+E+KR  V    G +        +L+GE+FK+YV +LRSKS IYK  R  L+EL+AE G+L RT E+L Q+ D    +L+ +E K+G +GY + Q+ LEKVS   S+ +  KG TL+DMS M+ +L   I  ++N L P++++++PLR+K +EL   YD+KKQ Y+   A Y+ N SKL+ EVK  +EE +  ESRYHY+ CM  +L+  Q R+  EMK Y+S D+ EKKK++REIY+KKI EQE L++ LRE+QK ++++H PN+KQ ++W
Sbjct:    3 MSEQMRFIVQELNKEPFSKSYNLISFDSLEPLQLLQVLNDVLAIIDPKQKMDLREEAPDQTAVRIFQILRVLKYKPP-DHVNMSQFRAGIVQGEKPIIFPILEWLLQKVPELQKRAYLAKFLVKIDIPAEIMQDEEVNAIYVQYEELMEQFKEMHKQSEQLKNSGFNTAEIRKDITNMEEEKEQLIKRIERLRRKVESHPNSQKMMAVAKNLRVERDREKRLAAQKQEQQTNITHLDQRIKRLEAQLRDMRQASVGATPSTMIQKLEEESRTNSFIVKEQLPKDIAQRKKMIQNLQKVVSVPAMGHSDLEELNAKITELNAEVNQLIEKRMKSGDPADDKLSLFRQQAAIIAHKKQAAAETLRAIRDEFNHVQTEVEQKREVVNTAEGAE--------VLKGEDFKRYVNKLRSKSTIYKKKRAELAELRAESGVLTRTEEILKQRCDLINRQLSVLEKKKGVAGYRETQEELEKVSSIKSEFDEMKGRTLDDMSEMVRRLHAEIADRRNTLAPILREIRPLREKVRELTPDYDNKKQVYERQQAGYDSNMSKLEQEVKGYREECRAEESRYHYLNCMMKVLQVQQARVANEMKAYVSSDAQEKKKTFREIYSKKIQEQENLSRGLREKQKMVKDNHEPNMKQMKLW 640          
BLAST of intraflagellar transport protein 81 homolog vs. TrEMBL
Match: A0A267H7T7 (IFT81_CH domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015875g1 PE=4 SV=1)

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 337/688 (48.98%), Postives = 497/688 (72.24%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKK-SYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            M+++LK+IVQELNK+PFNKN N+I+ DS+E +QLLQ++NDVIA ID ++++DIR ES +QT  RI++ L+IFR+KP  D N+  +   G V G+K T+YPIL+WLL    +LKKRAYL+RF+V I +P E  QDEE+  LY QYEE I  FK+ HK +E  KS+ + T D+KKDI  MQ+EKEQL++RVDR +++V+S+PNS  ML++A+RLR E+++E+K+  QI +Q+  + +   +  R+NQQVK+MRQ  A +T + L+ R EEE + N+ MVTEKLP E+A  ++ + DLQ + SEPAM Q+DL++   K++EVNAEIN++ E +MM+ + ++DK  +FRQQASIV+RKK  A E LRE RE L+R E EL+ +R  + AN G+QGG    E +L+  +F++YVA+LR+KS +YK  ++ ++EL AE GIL RT+E+L Q+++  K ++++ E + G SGY D Q+ LEKVS+ M+ +N +KG TLEDMS +I +L   +N KKN L P++++++PLR+++++LQ  YD+KK  Y+   A  E  R KL+ EVK L+EE +  ESRY Y+  M ++L +   R+Q+E++ Y SQD N+KKK + R+++ KKI EQE + KSLRE+QKA+R++  P +KQ +MWSDL  L+ CK  C Q + +  +  G Y+ V  L+ENRL+L
Sbjct:    3 MTDNLKYIVQELNKEPFNKNLNLITCDSLEPIQLLQILNDVIAEIDERHQMDIRNESADQTFARIIDALRIFRFKPPSDPNHFETFKLGLVQGNKTTVYPILEWLLQKRPELKKRAYLARFLVKINIPAEIAQDEEVENLYIQYEEHIEEFKQVHKNVEAAKSASLPTGDIKKDIKAMQDEKEQLVRRVDRTKKRVQSFPNSASMLQLAQRLRLEKEREAKISRQISDQRTVIQSCQSRAQRLNQQVKDMRQAAAGSTADGLIARLEEEKKINRYMVTEKLPAEIATEKRQVADLQKIASEPAMGQADLEQYRAKMREVNAEINQLIEKKMMAGDVRDDKASLFRQQASIVSRKKAAAAEALREAREELNRAEEELQARRETLEANRGQQGGG---EEVLKEAQFREYVAKLRTKSTVYKEKKRLMNELIAENGILTRTLEILRQKEEAVKRQISQAEKRAGVSGYSDTQEQLEKVSKMMTQLNQKKGDTLEDMSRIIGELNKRVNEKKNELAPLIRELRPLREEAKKLQLEYDEKKANYERQSAGVEEKRMKLEQEVKALREECQGEESRYAYMKGMLDILNTQHQRVQDELRAYKSQDPNDKKKPTLRDVFKKKIAEQENIGKSLREKQKAVRDAQQPAMKQVKMWSDLLRLMDCKIAC-QAKAEVAAEAGEYAGVTSLQENRLVL 686          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Cavefish
Match: ift81 (intraflagellar transport 81 homolog [Source:ZFIN;Acc:ZDB-GENE-040714-3])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 303/647 (46.83%), Postives = 445/647 (68.78%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMW 1998
            MSE LKFIV++LN++PF KNFN+I+FDS+E +QLLQ +NDV+A ID K  IDIREE  +QT  R+  +L + +YKP+    + +S  QG V G K  I+PIL WLL  + +LKKRAYL+RF+V + VP EFL D+ I+  Y QYEE++  FK  HKE E +++SG +TA++++DI  M+ EK+QLIKRV+R R++VES  N + ML++A++LR E+++E  L HQ QEQK  L   +Q++ R   Q+K++RQ  A A PESLV+R EEE +FN  MV++KLP EL +  + ++ LQ V SEPAM  ++L ++ +KIK++ ++ N+  E +M   +  +D L ++RQQASI+ARKK+   E+++E RE L+    E+  K ++       QGG      I+R +EFK+YV+++R K+  YK  RQ ++ELK+E GIL RT E+L Q+    + +L  +E+++G SG+ + Q+ LE+VS   S+++  KG TL+DMS M+ KL ++I  KK  L P++K+++PLRQ+ QEL   Y++KK  YD+  A  E NRSKL+ EV+VL+EE    E+RYHYI  M+ +      R  +EMK+Y+S D   +KKS RE Y K I EQE+L K LRE+QK ++ESHGPN++Q +MW
Sbjct:    1 MSEQLKFIVEQLNREPFKKNFNLITFDSLEPIQLLQTLNDVLAEIDSKQAIDIREEMPDQTAKRMFTLLGLLKYKPSGGLTDASSFRQGLVTGSKPVIHPILHWLLQRVPELKKRAYLARFLVKLDVPGEFLTDDVISDTYHQYEELVEGFKTYHKECEQLRNSGFSTAEIRRDIAAMEEEKDQLIKRVERLRKRVESVSNHQRMLELARQLRVEKEREESLAHQKQEQKNQLFQAEQRLQRCQIQLKDLRQAAADAKPESLVKRLEEEIKFNSYMVSDKLPKELERMRRKVRYLQKVASEPAMGHAELAELEEKIKQL-SQANQEMEKKMTRTDPMDDNLTLYRQQASIIARKKEAKAEEVQESREELAAVSREVSSKSSQARG----QGGV----EIIRTDEFKRYVSKMRGKNITYKKKRQEIAELKSEFGILQRTEEILRQRHTAEQQQLQSLEAQKGISGFSETQEELERVSAIKSELDELKGRTLDDMSEMVKKLNSAIADKKTALSPLIKELRPLRQQCQELAQEYEEKKAQYDTCAAGLESNRSKLEQEVRVLREETAQEENRYHYINSMKEV-----RRAADEMKVYVSSDPQTRKKSIREQYMKNIAEQESLGKKLREQQKQVKESHGPNMRQVRMW 633          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Nematostella
Match: EDO32714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUB4])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 312/647 (48.22%), Postives = 452/647 (69.86%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMW 1998
            MSE LK+IV ELNK+PF KNFN+ISFDS++ LQLLQV+NDV AVID ++KID+R+E  E T +R+   L++ +YKP  +  +LN+  QG + GDK  IYPIL WL   + DL+KRAYL+R++V + +P E L D+E+A   + Y   I  FKE HK +E +++SG +T ++KKDI  M+ E EQL KR+DR ++KVES  N E ML  A+ LR ER+KE  L  Q  EQK  L+  DQ+  R+NQQ+K++R  G   T   L++R EEE++ N  +  +KLP E+   +KY+QDLQ V +EPAM  SDLD++N KIK V++EIN + E RM+  +  +DKL +FRQQASI+ARKKD A E+ +E  + L+  E EL++K++ +  + G +        +L+G+EFK+YV +LR KS +YK  RQ L+EL+AE G+L+R++E+L  +D+    +L  IE+K+G +GY + Q+ LEKVS   S+++ +KG TLE++S ++  +  +I  KK+ L P++K+++P+RQK QEL   Y++KK  Y+++    + N SKLD EV+ L+EE+   ESRYHY+  M  +L+  Q R+ +EMK Y +QD  ++KKS+RE YT+KI EQE L KSLRE+QKA+RESHGPN+KQ +MW
Sbjct:    1 MSEQLKYIVDELNKEPFKKNFNLISFDSLQPLQLLQVMNDVFAVIDQQHKIDLRDEEPEATAMRMFTFLRVLKYKPKTESGSLNAFRQGLIQGDKPVIYPILQWLFERLPDLRKRAYLARYLVHMNIPAELLLDQELADANEAYVGKIEEFKEVHKAVEQLRTSGFSTGEIKKDIANMEEEHEQLKKRIDRMQKKVESVRNYEQMLLAARNLRVEREKEQSLAQQKLEQKNQLLHADQRFQRMNQQLKDLRAQGIGTTGADLIRRLEEENKVNMYLCQDKLPKEIESKQKYVQDLQKVANEPAMGHSDLDELNLKIKSVSSEINSLIEKRMVRNDPIDDKLSLFRQQASIIARKKDAAAEKFKEAMDELASVEQELQKKKDLLKESEGAE--------VLKGDEFKRYVNKLRGKSTVYKKKRQELAELRAEYGVLSRSVEILKTKDENLNQQLAGIEAKQGVTGYHETQEELEKVSTVKSELDEQKGKTLEEISQLVATMNATIAEKKSALAPVIKELRPMRQKCQELSEDYEEKKAQYENLATGLDSNLSKLDQEVRGLREEISQEESRYHYLHAMMKVLEIQQKRIDDEMKAYTAQDQADRKKSWREQYTRKIQEQENLGKSLREKQKAVRESHGPNMKQMKMW 639          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Medaka
Match: ift81 (intraflagellar transport 81 [Source:NCBI gene;Acc:101160565])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 300/647 (46.37%), Postives = 444/647 (68.62%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMW 1998
            MSE LKFIV++LNK+PF KNFN++ FDS+E +QLLQ++NDV+A ID K  IDIREE  EQT  R+  +L + +YK   + +++ S  QG V G K  I+PIL WLL  + DLKKRAYL+RF+V ++VP EFL D+ ++  Y QYEE++  FK  HKE E ++SSG +TA++++DI+ M+ EK+QLIKRV+R +++VES  N + MLK A++LR E+++E  L  Q Q+QK  L   +Q++ R  QQ+K+MRQ    A PESL +R EEE + N  MVTEKLP EL    + +Q LQ V SEPAM Q+++ ++  +IK+V+++IN + E +M+  +  +DKL ++RQQASI++RKK++  E+L+E RE L+  E E++++ ++          +   E ++RG+E K+ VA+LRSK   YK  RQ LSEL AE G+L RT E+L Q+ +  + +L  +E ++G SGY + Q+ LE+VS   ++++ +KG TL+DMS M+ +L   I  KK+ L P++K+++ LRQ+ +EL   Y +KK  Y+S  A  E NRS+L+ EVK L+EE+   E++YHYI  M  +++    +  EEMK Y+S D  EKKK+ RE+Y K I EQE L K LRE QK ++E+HG N++Q +MW
Sbjct:    1 MSEQLKFIVEQLNKEPFKKNFNLVMFDSLEPIQLLQILNDVLAEIDPKQSIDIREEMPEQTVKRMTSLLGMLKYKLQDNMSDVKSFQQGLVTGSKSVIHPILYWLLQRVPDLKKRAYLARFLVKLEVPAEFLHDDIVSDTYHQYEELVEGFKMYHKECEQLRSSGFSTAEIRRDISAMEEEKDQLIKRVERLKKRVESVSNHQWMLKQARQLRMEKEREESLAQQKQQQKNQLFQAEQRVLRSQQQLKDMRQSATDANPESLTRRLEEEIKINTYMVTEKLPKELESLRRTVQYLQKVASEPAMGQANIRELEDRIKDVDSQINLLIEKKMLRNDPIDDKLTLYRQQASIISRKKESKAEELQEAREALATAEKEMKQRHSQ----------SSPEEEVIRGDELKRLVAKLRSKGTAYKKKRQELSELNAEYGVLQRTEEILRQKHEAVQEKLEAVEDEKGISGYSNTQEELERVSAIKTELDEKKGRTLDDMSEMVKRLNALIVEKKSALAPIIKELRSLRQRREELSQEYGEKKTQYESCAAGLESNRSQLEQEVKALREEMAQKENQYHYINSMSEIIEMQMQQAAEEMKAYISPDPQEKKKTIRELYMKSIAEQELLGKKLREEQKMVKENHGANMEQMKMW 637          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Medaka
Match: ift81 (intraflagellar transport 81 [Source:NCBI gene;Acc:101160565])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 294/648 (45.37%), Postives = 436/648 (67.28%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQ-DSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMW 1998
            MSE LKFIV++LNK+PF KNFN++ FDS+E +QLLQ++NDV+A ID K  IDIREE  EQT  R+  +L + +YK  +  N  +S  QG V G K  I+PIL WLL  + DLKKRAYL+RF+V ++VP EFL D+ ++  Y QYEE++  FK  HKE E ++SSG +TA++++DI+ M+ EK+QLIKRV+R +++VES  N + MLK A++LR E+++E  L  Q Q+QK  L   +Q++ R  QQ+K+MRQ    A PESL +R EEE + N  MVTEKLP EL    + +Q LQ V SEPAM Q+++ ++  +IK+V+++IN + E +M+  +  +DKL ++RQQASI++RKK++  E+L+E RE L+  E E++++ ++          +   E ++RG+E K+ VA+LRSK   YK  RQ LSEL AE G+L RT E+L Q+ +  + +L  +E ++G SGY + Q+ LE+VS   ++++ +KG TL+DMS M+ +L   I  KK+ L P++K+++ LRQ+ +EL   Y +KK  Y+S  A  E NRS+L+ EVK L+EE+   E++YHYI  M   +K  + R  +   + L +  +      YRE+Y K I EQE L K LRE QK ++E+HG N++Q +MW
Sbjct:    1 MSEQLKFIVEQLNKEPFKKNFNLVMFDSLEPIQLLQILNDVLAEIDPKQSIDIREEMPEQTVKRMTSLLGMLKYK--LQDNMSDSFQQGLVTGSKSVIHPILYWLLQRVPDLKKRAYLARFLVKLEVPAEFLHDDIVSDTYHQYEELVEGFKMYHKECEQLRSSGFSTAEIRRDISAMEEEKDQLIKRVERLKKRVESVSNHQWMLKQARQLRMEKEREESLAQQKQQQKNQLFQAEQRVLRSQQQLKDMRQSATDANPESLTRRLEEEIKINTYMVTEKLPKELESLRRTVQYLQKVASEPAMGQANIRELEDRIKDVDSQINLLIEKKMLRNDPIDDKLTLYRQQASIISRKKESKAEELQEAREALATAEKEMKQRHSQ----------SSPEEEVIRGDELKRLVAKLRSKGTAYKKKRQELSELNAEYGVLQRTEEILRQKHEAVQEKLEAVEDEKGISGYSNTQEELERVSAIKTELDEKKGRTLDDMSEMVKRLNALIVEKKSALAPIIKELRSLRQRREELSQEYGEKKTQYESCAAGLESNRSQLEQEVKALREEMAQKENQYHYINSMSE-VKILRKRFADLPHLDLKEWPALSVLLLYRELYMKSIAEQELLGKKLREEQKMVKENHGANMEQMKMW 635          
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Medaka
Match: ift81 (intraflagellar transport 81 [Source:NCBI gene;Acc:101160565])

HSP 1 Score: 498.049 bits (1281), Expect = 3.127e-168
Identity = 262/589 (44.48%), Postives = 396/589 (67.23%), Query Frame = 1
Query:  232 EQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMW 1998
            EQT  R+  +L + +YK   + +++ S  QG V G K  I+PIL WLL  + DLKKRAYL+RF+V ++VP EFL D+ ++  Y QYEE++  FK  HKE E ++SSG +TA++++DI+ M+ EK+QLIKRV+R +++VES  N + MLK A++LR E+++E  L  Q Q+QK  L   +Q++ R  QQ+K+MRQ    A PESL +R EEE + N  MVTEKLP EL    + +Q LQ V SEPAM Q+++ ++  +IK+V+++IN + E +M+  +  +DKL ++RQQASI++RKK++  E+L+E RE L+  E E++++ ++          +   E ++RG+E K+ VA+LRSK   YK  RQ LSEL AE G+L RT E+L Q+ +  + +L  +E ++G SGY + Q+ LE+VS   ++++ +KG TL+DMS M+ +L   I  KK+ L P++K+++ LRQ+ +EL   Y +KK  Y+S  A  E NRS+L+ EVK L+EE+   E++YHYI  M  +++    +  EEMK Y+S D  EKKK+ RE+Y K I EQE L K LRE QK ++E+HG N++Q +MW
Sbjct:    3 EQTVKRMTSLLGMLKYKLQDNMSDVKSFQQGLVTGSKSVIHPILYWLLQRVPDLKKRAYLARFLVKLEVPAEFLHDDIVSDTYHQYEELVEGFKMYHKECEQLRSSGFSTAEIRRDISAMEEEKDQLIKRVERLKKRVESVSNHQWMLKQARQLRMEKEREESLAQQKQQQKNQLFQAEQRVLRSQQQLKDMRQSATDANPESLTRRLEEEIKINTYMVTEKLPKELESLRRTVQYLQKVASEPAMGQANIRELEDRIKDVDSQINLLIEKKMLRNDPIDDKLTLYRQQASIISRKKESKAEELQEAREALATAEKEMKQRHSQ----------SSPEEEVIRGDELKRLVAKLRSKGTAYKKKRQELSELNAEYGVLQRTEEILRQKHEAVQEKLEAVEDEKGISGYSNTQEELERVSAIKTELDEKKGRTLDDMSEMVKRLNALIVEKKSALAPIIKELRSLRQRREELSQEYGEKKTQYESCAAGLESNRSQLEQEVKALREEMAQKENQYHYINSMSEIIEMQMQQAAEEMKAYISPDPQEKKKTIRELYMKSIAEQELLGKKLREEQKMVKENHGANMEQMKMW 581          
BLAST of intraflagellar transport protein 81 homolog vs. Planmine SMEST
Match: SMESG000026141.1 (SMESG000026141.1)

HSP 1 Score: 1357.43 bits (3512), Expect = 0.000e+0
Identity = 685/687 (99.71%), Postives = 686/687 (99.85%), Query Frame = 1
Query:   58 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWXXXXXXXXXXXXXRQEQYQKESAGGIYSDVQQLEENRLIL 2118
            MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGV+TADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMI KLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWSDLDLLLKCKSKCRQEQYQKESAGGIYSDVQQLEENRLIL
Sbjct:    1 MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNKIDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYPILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILSFKETHKELETIKSSGVSTADVKKDINTMQNEKEQLIKRVDRQRRKVESYPNSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEMRQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVISEPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASIVARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPILRGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKYKNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMITKLTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVNRSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQDSNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWSDLDLLLKCKSKCRQEQYQKESAGGIYSDVQQLEENRLIL 687          
The following BLAST results are available for this feature:
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IFT810.000e+048.18intraflagellar transport 81 [Source:HGNC Symbol;Ac... [more]
IFT810.000e+048.18intraflagellar transport 81 [Source:HGNC Symbol;Ac... [more]
IFT814.700e-17747.39intraflagellar transport 81 [Source:HGNC Symbol;Ac... [more]
IFT813.520e-12548.02intraflagellar transport 81 [Source:HGNC Symbol;Ac... [more]
IFT813.023e-10844.69intraflagellar transport 81 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift-816.659e-6529.05IFT (Chlamydomonas IntraFlagellar Transport) homol... [more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift810.000e+047.30intraflagellar transport 81 homolog [Source:ZFIN;A... [more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tnpo10.000e+046.14transportin 1 [Source:Xenbase;Acc:XB-GENE-493792][more]
tnpo17.801e-17842.65transportin 1 [Source:Xenbase;Acc:XB-GENE-493792][more]
tnpo11.835e-17447.07transportin 1 [Source:Xenbase;Acc:XB-GENE-493792][more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ift810.000e+047.16intraflagellar transport 81 [Source:MGI Symbol;Acc... [more]
Ift813.462e-7551.15intraflagellar transport 81 [Source:MGI Symbol;Acc... [more]
Ift819.588e-4748.63intraflagellar transport 81 [Source:MGI Symbol;Acc... [more]
Ift811.314e-1362.50intraflagellar transport 81 [Source:MGI Symbol;Acc... [more]
Ift811.638e-1362.50intraflagellar transport 81 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P83829|IFT81_RAT0.000e+047.16Intraflagellar transport protein 81 homolog OS=Rat... [more]
sp|O35594|IFT81_MOUSE0.000e+047.16Intraflagellar transport protein 81 homolog OS=Mus... [more]
sp|Q8WYA0|IFT81_HUMAN0.000e+048.18Intraflagellar transport protein 81 homolog OS=Hom... [more]
sp|Q68RJ5|IFT81_CHLRE2.113e-7528.20Intraflagellar transport protein 81 OS=Chlamydomon... [more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QUC20.000e+050.69Intraflagellar transport protein 81-like OS=Mizuho... [more]
A0A4E0S1I40.000e+046.36Intraflagellar transport protein 81 OS=Fasciola he... [more]
A0A4S2LRE10.000e+046.86IFT81_CH domain-containing protein OS=Opisthorchis... [more]
A0A2C9K3X90.000e+049.30IFT81_CH domain-containing protein OS=Biomphalaria... [more]
A0A267H7T70.000e+048.98IFT81_CH domain-containing protein (Fragment) OS=M... [more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift810.000e+046.83intraflagellar transport 81 homolog [Source:ZFIN;A... [more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO327140.000e+048.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ift810.000e+046.37intraflagellar transport 81 [Source:NCBI gene;Acc:... [more]
ift810.000e+045.37intraflagellar transport 81 [Source:NCBI gene;Acc:... [more]
ift813.127e-16844.48intraflagellar transport 81 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of intraflagellar transport protein 81 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026141.10.000e+099.71SMESG000026141.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024215 ID=SMED30024215|Name=intraflagellar transport protein 81 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2175bp
GTATTATCAAGTTTAAAAGTTATTAATAAATTATATTAATCAAACTTTAT
CTTTAAAATGAGTGAACATTTAAAATTTATTGTTCAAGAATTAAATAAAG
ATCCATTTAATAAAAATTTTAACATAATTTCTTTTGATTCAATAGAATCA
TTGCAATTATTACAGGTGGTTAATGATGTTATCGCCGTTATTGATGTCAA
GAACAAAATAGATATTCGTGAAGAGTCAATAGAACAAACTTGTATTCGAA
TAATGGAAATGTTGCAAATTTTTCGTTACAAACCTGCAGTAGATCAAAAT
AATCTAAACAGCCTTATGCAAGGCTTTGTTATTGGAGATAAATTGACTAT
TTATCCCATTCTCGATTGGTTACTGTCCCACATTAGCGATTTGAAAAAAC
GAGCTTATCTCTCACGATTTATGGTTATGATTCAAGTACCGACAGAATTT
TTACAAGACGAAGAAATAGCTCGCTTATATGATCAGTACGAAGAAGTCAT
ACTGAGTTTTAAAGAAACTCATAAAGAATTGGAAACTATTAAATCCTCTG
GCGTGACAACAGCCGATGTTAAGAAGGATATTAATACAATGCAAAACGAA
AAGGAACAATTAATAAAACGAGTAGATAGACAGCGTCGCAAAGTCGAGTC
GTATCCTAATTCTGAACTGATGCTGAAAATGGCTAAGAGATTGAGAACTG
AACGTGATAAAGAAAGTAAACTTCAACATCAAATTCAAGAACAAAAAGCA
ACATTAATGACAATTGACCAAAAGATAAATAGGATCAACCAACAAGTAAA
AGAAATGAGACAAATAGGCGCAACAGCGACCCCTGAAAGTCTGGTTCAAA
GACAAGAAGAGGAATCTCGATTTAATAAGCTCATGGTTACTGAGAAATTA
CCGAATGAATTAGCAAAAAATGAAAAATACATTCAAGATTTACAGAATGT
TATTTCAGAACCAGCTATGAGTCAAAGTGATTTGGATAAAATTAATAAAA
AGATAAAAGAGGTCAATGCTGAGATAAATAGAATCACTGAGACTAGAATG
ATGAGTATAAATACAAAAGAAGACAAACTAATTATGTTTCGACAGCAAGC
TTCAATTGTAGCCCGTAAAAAAGATAATGCTGTTGAACAGCTTCGAGAAG
TCCGAGAGGTTTTATCACGTACTGAATCCGAGTTAGAGGAAAAAAGAAAT
AAAGTACTTGCCAATACTGGTAAGCAAGGAGGTACTGGAACTTATGAACC
TATTTTGCGAGGAGAAGAATTTAAAAAATACGTTGCTCAATTGCGATCAA
AAAGCAATATTTATAAACCTCTCCGACAGACTCTGAGTGAATTGAAAGCT
GAGCAAGGAATTCTTGCAAGAACTATTGAATTATTAACACAGCAAGATGA
TAAATACAAAAATGAGCTCAATGAAATTGAATCAAAGCGAGGCGCCTCTG
GCTATTGGGATGCTCAAGACAATTTGGAGAAAGTTTCAGAGCAAATGTCA
GACATTAATACACGCAAGGGTGCAACTTTAGAAGACATGTCTGTTATGAT
TATGAAATTGACGAACAGCATCAATTCAAAGAAAAATAATTTAATACCCA
TGGTAAAGGATGTTAAACCTCTGCGACAGAAATCCCAGGAACTTCAGCAC
ATTTACGATGACAAAAAGCAAGCTTATGACAGTATCATGGCAACCTATGA
GGTTAATCGATCTAAACTCGACCATGAAGTAAAAGTTTTGAAAGAAGAGT
TGAAGAATTTAGAATCCCGATATCATTACATAACTTGCATGGAAAATATG
CTCAAATCCAATCAAAACCGGCTGCAGGAAGAAATGAAAATCTATCTGTC
TCAAGATTCCAATGAAAAAAAGAAATCATATCGGGAGATTTATACGAAAA
AAATCAACGAACAAGAAGCTTTAGCGAAATCTTTGAGAGAACGACAAAAA
GCTATCAGGGAATCTCATGGGCCGAATTTGAAACAGCGTCAAATGTGGAG
TGATTTGGATTTGCTGTTGAAATGCAAATCTAAATGTCGACAAGAACAAT
ATCAGAAAGAGAGTGCTGGCGGTATATATTCTGACGTTCAACAATTGGAA
GAAAATCGTTTGATTTTGTAACTGTTCAAAAAAATTGTTTTTGCTAATAT
AAAATTATAGACTTTTAAAAAAAAA
back to top

protein sequence of SMED30024215-orf-1

>SMED30024215-orf-1 ID=SMED30024215-orf-1|Name=SMED30024215-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=688bp
MSEHLKFIVQELNKDPFNKNFNIISFDSIESLQLLQVVNDVIAVIDVKNK
IDIREESIEQTCIRIMEMLQIFRYKPAVDQNNLNSLMQGFVIGDKLTIYP
ILDWLLSHISDLKKRAYLSRFMVMIQVPTEFLQDEEIARLYDQYEEVILS
FKETHKELETIKSSGVTTADVKKDINTMQNEKEQLIKRVDRQRRKVESYP
NSELMLKMAKRLRTERDKESKLQHQIQEQKATLMTIDQKINRINQQVKEM
RQIGATATPESLVQRQEEESRFNKLMVTEKLPNELAKNEKYIQDLQNVIS
EPAMSQSDLDKINKKIKEVNAEINRITETRMMSINTKEDKLIMFRQQASI
VARKKDNAVEQLREVREVLSRTESELEEKRNKVLANTGKQGGTGTYEPIL
RGEEFKKYVAQLRSKSNIYKPLRQTLSELKAEQGILARTIELLTQQDDKY
KNELNEIESKRGASGYWDAQDNLEKVSEQMSDINTRKGATLEDMSVMIMK
LTNSINSKKNNLIPMVKDVKPLRQKSQELQHIYDDKKQAYDSIMATYEVN
RSKLDHEVKVLKEELKNLESRYHYITCMENMLKSNQNRLQEEMKIYLSQD
SNEKKKSYREIYTKKINEQEALAKSLRERQKAIRESHGPNLKQRQMWSDL
DLLLKCKSKCRQEQYQKESAGGIYSDVQQLEENRLIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005813centrosome
GO:0005929cilium
GO:0030992intraciliary transport particle B
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0097225sperm midpiece
GO:0097228sperm principal piece
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR041146IFT81_CH
IPR043016IFT81_N_sf
IPR029600IFT81
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0015631tubulin binding
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0007283spermatogenesis
GO:0030030cell projection organization
GO:0030154cell differentiation
GO:0035735intraciliary transport involved in cilium assembly
GO:0042073intraciliary transport
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 309..329
NoneNo IPR availableCOILSCoilCoilcoord: 609..636
NoneNo IPR availableCOILSCoilCoilcoord: 168..195
NoneNo IPR availableCOILSCoilCoilcoord: 355..382
NoneNo IPR availableCOILSCoilCoilcoord: 440..460
NoneNo IPR availableCOILSCoilCoilcoord: 226..253
NoneNo IPR availableCOILSCoilCoilcoord: 544..571
IPR041146IFT81, calponin homology domainPFAMPF18383IFT81_CHcoord: 3..125
e-value: 2.3E-44
score: 150.6
IPR043016IFT81, N-terminal domain superfamilyGENE3DG3DSA:1.10.418.70coord: 1..128
e-value: 1.3E-43
score: 149.9
IPR029600Intraflagellar transport protein 81PANTHERPTHR15614FAMILY NOT NAMEDcoord: 1..687