BRO1 domain-containing protein BROX

Overview
NameBRO1 domain-containing protein BROX
Smed IDSMED30024210
Length (bp)1856
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BRO1 domain-containing protein BROX (SMED30024210) t-SNE clustered cells

Violin plots show distribution of expression levels for BRO1 domain-containing protein BROX (SMED30024210) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BRO1 domain-containing protein BROX (SMED30024210) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BRO1 domain-containing protein BROX (SMED30024210) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024210

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024210SMESG000055804.1 PL030001A20E08ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024210SMESG000055804.1 PL05001A1G02ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30024210SMESG000055804.1 dd_Smed_v4_1658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024210SMESG000055804.1 dd_Smed_v4_1658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024210SMESG000055804.1 dd_Smed_v4_1658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024210SMESG000055804.1 dd_Smed_v4_1658_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Human
Match: BROX (BRO1 domain and CAAX motif containing [Source:HGNC Symbol;Acc:HGNC:26512])

HSP 1 Score: 357.836 bits (917), Expect = 8.567e-118
Identity = 181/431 (42.00%), Postives = 262/431 (60.79%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   V T   A +I ND+ + R +LL++  + + + E+M  A + Y S+L GFI  +D  + +SKLR+  NF+W+ +L  +G +P    DA+FE ++M  NVALWYTK+A++++ KE++  ++AKE H+ L+ AAGIF  +K +++ +L   I    K  D++ +++EAY+ QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++ A   LS        KW++YL  K   Y AYAY YHGE  L  DK GEAI +L+E  KLY ++E   KEY +  GPG T +P  HLFFRKLG  ++ T EKC RENG IY QK+P   P LELKA YGL  P   + P  +  W     + FD+TK                 K     P P  + +P+ + D  P   +GC +S
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTL--QGQVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHLPKL---ITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTK---------------RPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS 411          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Human
Match: BROX (BRO1 domain and CAAX motif containing [Source:HGNC Symbol;Acc:HGNC:26512])

HSP 1 Score: 315.079 bits (806), Expect = 4.181e-102
Identity = 152/335 (45.37%), Postives = 222/335 (66.27%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLI 1160
            M+HWFHRNP+KAT  + F+   V T   A +I ND+ + R +LL++  + + + E+M  A + Y S+L GFI  +D  + +SKLR+  NF+W+ +L  +G +P    DA+FE ++M  NVALWYTK+A++++ KE++  ++AKE H+ L+ AAGIF  +K +++ +L   I    K  D++ +++EAY+ QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++ A   LS        KW++YL  K   Y AYAY YHGE  L  DK GEAI +L+E  KLY ++E   KEY +  GPG T +P  HLFFRKLG  ++ T EKC RENG I
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTL--QGQVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHLPKL---ITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGFI 330          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Human
Match: BROX (BRO1 domain and CAAX motif containing [Source:HGNC Symbol;Acc:HGNC:26512])

HSP 1 Score: 307.76 bits (787), Expect = 9.610e-99
Identity = 166/431 (38.52%), Postives = 238/431 (55.22%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   V T   A +I ND+ + R +LL++  + + + E+M  A + Y S+L GFI  +D  + +SKLR+  NF+W+ +L  +G +P                                S+  ++AKE H+ L+ AAGIF  +K +++ +L   I    K  D++ +++EAY+ QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++ A   LS        KW++YL  K   Y AYAY YHGE  L  DK GEAI +L+E  KLY ++E   KEY +  GPG T +P  HLFFRKLG  ++ T EKC RENG IY QK+P   P LELKA YGL  P   + P  +  W     + FD+TK                 K     P P  + +P+ + D  P   +GC +S
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTL--QGQVP--------------------------------SITEDEAKEVHRSLKIAAGIFKHLKESHLPKL---ITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTK---------------RPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS 379          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Human
Match: BROX (BRO1 domain and CAAX motif containing [Source:HGNC Symbol;Acc:HGNC:26512])

HSP 1 Score: 307.76 bits (787), Expect = 9.610e-99
Identity = 166/431 (38.52%), Postives = 238/431 (55.22%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   V T   A +I ND+ + R +LL++  + + + E+M  A + Y S+L GFI  +D  + +SKLR+  NF+W+ +L  +G +P                                S+  ++AKE H+ L+ AAGIF  +K +++ +L   I    K  D++ +++EAY+ QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++ A   LS        KW++YL  K   Y AYAY YHGE  L  DK GEAI +L+E  KLY ++E   KEY +  GPG T +P  HLFFRKLG  ++ T EKC RENG IY QK+P   P LELKA YGL  P   + P  +  W     + FD+TK                 K     P P  + +P+ + D  P   +GC +S
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTL--QGQVP--------------------------------SITEDEAKEVHRSLKIAAGIFKHLKESHLPKL---ITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTK---------------RPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS 379          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Human
Match: BROX (BRO1 domain and CAAX motif containing [Source:HGNC Symbol;Acc:HGNC:26512])

HSP 1 Score: 204.912 bits (520), Expect = 1.434e-61
Identity = 96/220 (43.64%), Postives = 153/220 (69.55%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFE 815
            M+HWFHRNP+KAT  + F+   V T   A +I ND+ + R +LL++  + + + E+M  A + Y S+L GFI  +D  + +SKLR+  NF+W+ +L  +G +P    DA+FE ++M  NVALWYTK+A++++ KE++  ++AKE H+ L+ AAGIF  +K +++ +L   I    K  D++ +++EAY+ QC AEAQE+T+ARAIEL+H+P +IA+LA+E
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTL--QGQVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHLPKL---ITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYE 215          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Celegans
Match: B0507.2 (BRO1 domain-containing protein BROX homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22885])

HSP 1 Score: 322.013 bits (824), Expect = 4.650e-104
Identity = 177/444 (39.86%), Postives = 268/444 (60.36%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPV----------DSESGDSKLRFSLNFRWSQSLSIKGDLP---LELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKGA-YSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            MSHWFHRNPIK T  +KFDL  V TT    +I  ++  +R+KL+   +N +N +E + + F +Y+ +  GF+  +          D+ + +SKL   + F+W  S+     LP    E++D  FE ++M+  +A+W TKHAA ++ K+ V   DAKE  +CLR A G+F  +K+      G    N+ + +D D +++E YI   TAEAQE+ +ARAIE++H   +I+SLA  T+ +F  A   L+   +++  +W+RYL+ K   Y AYA+++ G+++L EDK GEA+ A K+G+  Y  ++     Y+ A GPG   +P++HLFFR++ P L R  EK  RENG IYHQKVPD IP L+++ATYGLA  +S   P    +W  A YS FD++K        N    +   KSK +  + PV EE IYQ++KDP+NSSGC+++
Sbjct:    1 MSHWFHRNPIKPTEFVKFDLKGVLTTDTCSKICGELRLRRDKLVSQFKNASNDLEEVTKEFNEYLRLFAGFLIEIQSSMVELENKDAGNKNSKLIPLIRFKWGNSM-----LPQAATEVSDTWFEALSMIQCMAMWLTKHAASMAGKDEVRESDAKECLQCLRQAGGMFQYVKDESSRLSGA---NEVEGSDFDPKVMETYILTATAEAQEVIVARAIEMKHDDGLISSLAAVTASIFSKADQCLNNLPDESFARWRRYLQLKHHFYLAYAFAFLGQKQLSEDKCGEAVRACKQGIAEYGVAKEMAAMYATATGPGTRIKPEQHLFFRRIEPLLNRHLEKAERENGFIYHQKVPDEIPQLDVEATYGLAKLDSFTYPPPAESWNTAVYSAFDLSK-------ANMPDFSKIKKSKSK--LDPVHEEKIYQTEKDPSNSSGCVIA 427          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 57.7658 bits (138), Expect = 1.554e-8
Identity = 77/393 (19.59%), Postives = 167/393 (42.49%), Query Frame = 3
Query:  168 FHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPN---------------NSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDL-----PLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMED-AKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAV--TKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPD--SIPILELKATYGLASPESLKLPEINPAWKG 1271
            F   P+K+TN +  DL     T+    + N   N R+ + + V+  N               ++++++ + ++Q +++    I         S  +  + F+W  +   KG L      L L+D  FE   ++ N+    ++    + A +  + +D  K + K  + +AG+F  +++  +      ++ +  T D+    L A     TA+AQE    +  + +   + +  ++ + ++ +  A   +S    + +    W   +  K   Y+A A  +  E   +  + GE ++ L E LKL+  ++  +              P++      + P + + +    ++N  IYH+KV D  ++P L  KA   LA P  ++ P + P+++G
Sbjct:    6 FLSAPLKSTNEV--DL-VKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIII--------SATQNPVVFKWKDAFD-KGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQ----IGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLG-----MVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTAQKYL--------------PRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLP-KAV--LAKPTPMQTP-MTPSFRG 359          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 55.0694 bits (131), Expect = 1.562e-7
Identity = 74/395 (18.73%), Postives = 166/395 (42.03%), Query Frame = 3
Query:  168 FHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPN---------------NSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDL-----PLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAV--TKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPD--SIPILELKATYGLASPESLKLPEINPAWKGAYS 1280
            F   P+K+TN +         T+    + N   N R+ + + V+  N               ++++++ + ++Q +++    I         S  +  + F+W  +   KG L      L L+D  FE   ++ N+    ++  A   A++    ++ K + K  + +AG+F  +++  +      ++ +  T D+    L A     TA+AQE    +  + +   + +  ++ + ++ +  A   +S    + +    W   +  K   Y+A A  +  E   +  + GE ++ L E LKL+  ++  +              P++      + P + + +    ++N  IYH+KV D  ++P L  KA   LA P  ++ P + P+++  ++
Sbjct:    6 FLSAPLKSTNEVDL---VKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIII--------SATQNPVVFKWKDAFD-KGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGA---AQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLG-----MVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTAQKYL--------------PRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLP-KAV--LAKPTPMQTP-MTPSFRDMFA 362          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 55.0694 bits (131), Expect = 1.562e-7
Identity = 74/395 (18.73%), Postives = 166/395 (42.03%), Query Frame = 3
Query:  168 FHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPN---------------NSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDL-----PLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAV--TKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPD--SIPILELKATYGLASPESLKLPEINPAWKGAYS 1280
            F   P+K+TN +         T+    + N   N R+ + + V+  N               ++++++ + ++Q +++    I         S  +  + F+W  +   KG L      L L+D  FE   ++ N+    ++  A   A++    ++ K + K  + +AG+F  +++  +      ++ +  T D+    L A     TA+AQE    +  + +   + +  ++ + ++ +  A   +S    + +    W   +  K   Y+A A  +  E   +  + GE ++ L E LKL+  ++  +              P++      + P + + +    ++N  IYH+KV D  ++P L  KA   LA P  ++ P + P+++  ++
Sbjct:    6 FLSAPLKSTNEVDL---VKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIII--------SATQNPVVFKWKDAFD-KGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGA---AQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLG-----MVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTAQKYL--------------PRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLP-KAV--LAKPTPMQTP-MTPSFRDMFA 362          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 54.6842 bits (130), Expect = 1.660e-7
Identity = 60/295 (20.34%), Postives = 129/295 (43.73%), Query Frame = 3
Query:  423 FRWSQSLSIKGDL-----PLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAV--TKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPD--SIPILELKATYGLASPESLKLPEINPAWKGAYS 1280
            F+W  +   KG L      L L+D  FE   ++ N+    ++  A   A++    ++ K + K  + +AG+F  +++  +      ++ +  T D+    L A     TA+AQE    +  + +   + +  ++ + ++ +  A   +S    + +    W   +  K   Y+A A  +  E   +  + GE ++ L E LKL+  ++  +              P++      + P + + +    ++N  IYH+KV D  ++P L  KA   LA P  ++ P + P+++  ++
Sbjct:   95 FKWKDAFD-KGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGA---AQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLG-----MVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTAQKYL--------------PRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLP-KAV--LAKPTPMQTP-MTPSFRDMFA 362          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Fly
Match: mop (gene:FBgn0036448 transcript:FBtr0075700)

HSP 1 Score: 54.6842 bits (130), Expect = 2.874e-7
Identity = 59/249 (23.69%), Postives = 108/249 (43.37%), Query Frame = 3
Query:  468 ELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALA--LSGGNEKAVTK---------WQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPD 1181
            E+ D  FE   ++ N+A  +T+  A V+  +   M+ A  TH   + AA  + E++  Y +  G       +      Q+       C A+AQE  + +++     P I+A +  +   ++  AALA  L+GG++  V +         W++Y+ FK        Y Y G+   ++ + GE +        LYQ S  K++E  K    G+  + + +         ++   +    EN  IYH+ VP+
Sbjct:  103 EVTDLRFERAAVLFNIAALHTQSGASVTRGDVDGMKMAC-TH--FQAAAWAYGELRERYANVNGGGDFMTPELLVFQQQV-------CFAQAQECILEKSLIDNRKPHIVAKVTAQIV-VYYGAALAALLTGGDDGPVAQVIDSSVYKLWKKYVRFKINYLTCILYLYQGQHSEEKRQMGERVT-------LYQASWDKLEEARKE-SKGLPDQREINESLSFTADVVEAKRKNAKNENEFIYHEAVPE 332          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Fly
Match: ALiX (gene:FBgn0086346 transcript:FBtr0085241)

HSP 1 Score: 50.0618 bits (118), Expect = 6.552e-6
Identity = 63/315 (20.00%), Postives = 128/315 (40.63%), Query Frame = 3
Query:  336 FEQY---ISVLWGFIKPVDS-ESGDSKLRFSLNFRWSQSLS----IKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDA-KETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAV--TKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLP 1247
            FE+Y   + +++ +   + + E+  S     + F+W  +        G + L     ++E V ++ N+A   +     ++A +S++ +D  K T K L+ +AGIF      Y+    P  +    T D+    L        A+AQE+ + +AI+      IIA L  +  + +     A+   + +++   +W   +  K A + A    Y         K GE IA L+  + L++ ++                R     +  +     +R   +  ++N  IY++ +P+ +  L       LA P  + +P
Sbjct:   59 FEKYEASLEIVYAYYDQICALETKISVSELQIPFKWKDAFDKGSIFGGKISLTHTSLLYEKVCVLFNIAALQSN----IAANQSLDSDDGLKLTIKLLQQSAGIFQ-----YLKGATPAAVPSEPTPDLSQDTLTVLQALMVAQAQEVFILKAIKDNLKDQIIAKLCCQAEESYADVLRAMQKESVRSLWEKEWIPTIAGKQAGFHALTQLYQSLVCRAAKKIGEEIARLRNAIDLFKAAQT---------------RSGNETYLDEYFSRAKRNLTESTKDNEFIYNEIIPE-LSTLTSPGKAQLAKPLPIAVP 348          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Zebrafish
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:492786])

HSP 1 Score: 359.377 bits (921), Expect = 1.738e-118
Identity = 187/430 (43.49%), Postives = 275/430 (63.95%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIV 1442
            M+HWFHRNP+KAT  + F+L  VA++  A +I ND+   R +LLDM  +   S + + ++ ++Y ++L GFI P+D  + ++KLRF  NF+W+ +L  +G++     DA+FE V+M  NVALWYTK A++++ KE++  E+AK+ HK L+ AAGIF  +K T+I +L   I    K  D++ ++++ YI Q  AEAQE+T+ARAIEL+H+ S+IA+LAFET+  ++ A   L+  + +  +KW++YL+ K   Y AYA+ YHG+  L  DK GEAI +L+E  K Y  +EV  KEY +  GPG TA+P E LFF+KLG  ++ T EKC RENG IY  KVP   P LELKA+YGLA P + +LP ++       Y+ FD+T+     G  ++     + K+K E  I PVKE      D  P   +GC+V
Sbjct:    1 MTHWFHRNPLKATAPVSFNLYGVASSPAANKICNDLRTARARLLDMFTDATCSPDTLKKSSDEYFALLQGFILPLDGTTQENKLRFIQNFKWTDTL--QGNIASAQQDAVFELVSMAFNVALWYTKFASRLAGKENITEEEAKDVHKSLKIAAGIFKTLKETHIPRL---ITPAEKGRDLEPRVIDTYIVQSQAEAQEVTIARAIELKHNASLIAALAFETANFYQKADHTLNTLDPECSSKWKKYLQLKQHFYMAYAHCYHGQTLLAGDKCGEAIRSLQEAEKCYSRAEVLCKEYRQMKGPGSTAKPSEQLFFKKLGAVIKNTLEKCQRENGFIYFHKVPAEAPALELKASYGLAEPTAFELPPLSAQCTPEVYATFDLTR-----GHKDD-----KAKAKPEEEIKPVKE-----PDLKPQKDTGCVV 410          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Zebrafish
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:492786])

HSP 1 Score: 359.377 bits (921), Expect = 1.738e-118
Identity = 187/430 (43.49%), Postives = 275/430 (63.95%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIV 1442
            M+HWFHRNP+KAT  + F+L  VA++  A +I ND+   R +LLDM  +   S + + ++ ++Y ++L GFI P+D  + ++KLRF  NF+W+ +L  +G++     DA+FE V+M  NVALWYTK A++++ KE++  E+AK+ HK L+ AAGIF  +K T+I +L   I    K  D++ ++++ YI Q  AEAQE+T+ARAIEL+H+ S+IA+LAFET+  ++ A   L+  + +  +KW++YL+ K   Y AYA+ YHG+  L  DK GEAI +L+E  K Y  +EV  KEY +  GPG TA+P E LFF+KLG  ++ T EKC RENG IY  KVP   P LELKA+YGLA P + +LP ++       Y+ FD+T+     G  ++     + K+K E  I PVKE      D  P   +GC+V
Sbjct:    1 MTHWFHRNPLKATAPVSFNLYGVASSPAANKICNDLRTARARLLDMFTDATCSPDTLKKSSDEYFALLQGFILPLDGTTQENKLRFIQNFKWTDTL--QGNIASAQQDAVFELVSMAFNVALWYTKFASRLAGKENITEEEAKDVHKSLKIAAGIFKTLKETHIPRL---ITPAEKGRDLEPRVIDTYIVQSQAEAQEVTIARAIELKHNASLIAALAFETANFYQKADHTLNTLDPECSSKWKKYLQLKQHFYMAYAHCYHGQTLLAGDKCGEAIRSLQEAEKCYSRAEVLCKEYRQMKGPGSTAKPSEQLFFKKLGAVIKNTLEKCQRENGFIYFHKVPAEAPALELKASYGLAEPTAFELPPLSAQCTPEVYATFDLTR-----GHKDD-----KAKAKPEEEIKPVKE-----PDLKPQKDTGCVV 410          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Zebrafish
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:ZFIN;Acc:ZDB-GENE-040426-2678])

HSP 1 Score: 50.0618 bits (118), Expect = 7.861e-6
Identity = 63/296 (21.28%), Postives = 120/296 (40.54%), Query Frame = 3
Query:  309 NSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLS----IKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESV-NMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPD 1181
            +S+E++ + ++Q  ++   F  P             L F W  +        G + L LA   +E   ++ NV       A+++++++++ N E  K   K  + A+G F  IK+T +S L     N+  T DI  + +        ++AQE+ + +A   +   +I+A LA + +  +   A       E         L  K    +A A  +      ++ K GE IA L+   +L + +  +  EY               +  + L   + R      ++N  IYH +VP+
Sbjct:   62 SSLEILLRYYDQLCAIEPKFPFP----------ELCLTFTWKDAFDKGSLFGGSVKLALASLGYEKTCVLFNVGAL----ASQIASEQNLDNDEGLKTAAKFYQLASGAFAHIKDTVLSAL-----NREPTMDISPETVGTLSQIMLSQAQEVFVLKATSDKMKDAIVAKLANQAADYY-GDAFKQCQYKENLPKDVLPVLAAKHCMMQATAEMHQSALANQKKKFGEEIARLQHAQELVKTAASRYDEY---------------VNVKDLSDKINRALTAAKKDNDFIYHDRVPE 322          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Xenopus
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:100125017])

HSP 1 Score: 355.525 bits (911), Expect = 6.355e-117
Identity = 180/433 (41.57%), Postives = 265/433 (61.20%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEE--PIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   VA+T  A +I +D+ + R +LL++  +   + E+M  A + Y S+L GFI  +D  + D+KLR+  NF+W+ +L  +G+ P    DA+FE V+M  NVALWYTK+A++++ KE +  E+AKE H+ L+ AAG+F  +K  +I +L   I    K  D++ ++++AY  QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++     L+  +   + KW+ Y + K   Y AY+Y YHG+  L  DK GEAI +L+E  K Y ++E   KEY +  GPG TA+P  HLFFRK+G  ++ T EKC RENG IY QKVP   P LELKA YGL  P   + P +   W    ++GFD+TK                 + K++   P  +EE  P+ + D  P   SGC +S
Sbjct:    1 MTHWFHRNPLKATAPVSFNFYGVASTQAASKICSDLRSTRARLLELFSDITCNHEMMKNATDAYFSLLLGFIDSLDGGTQDNKLRYIQNFKWTDTL--QGNAPSAQQDAVFELVSMGFNVALWYTKYASRLAGKEDITEEEAKEVHRSLKIAAGVFKHLKENHIPKL---ITPVEKGRDLETRVIDAYTVQCQAEAQEVTIARAIELKHNPGLIAALAYETANYYQKVDHTLATLDPVYIAKWRSYTQLKMCFYMAYSYCYHGQTLLSADKCGEAIRSLQEAEKFYGKAEALCKEYGETKGPGTTAKPSGHLFFRKMGTLVRNTLEKCQRENGFIYFQKVPPEAPQLELKANYGLVEPVPFEFPAMTSQWSPETHTGFDLTK-----------------RPKDDSAKPKKEEEVKPMKEPDIKPQKDSGCQIS 411          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Xenopus
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:100125017])

HSP 1 Score: 311.612 bits (797), Expect = 3.270e-100
Identity = 169/433 (39.03%), Postives = 246/433 (56.81%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEE--PIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   VA+T  A +I +D+ + R +LL++  +   + E+M  A + Y S+L GFI  +D  + D+KLR+  NF+W+ +L  +G+ P    DA+FE V+M  NVALWYTK+A+++            E H                 I +L   I    K  D++ ++++AY  QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++     L+  +   + KW+ Y + K   Y AY+Y YHG+  L  DK GEAI +L+E  K Y ++E   KEY +  GPG TA+P  HLFFRK+G  ++ T EKC RENG IY QKVP   P LELKA YGL  P   + P +   W    ++GFD+TK                 + K++   P  +EE  P+ + D  P   SGC +S
Sbjct:    1 MTHWFHRNPLKATAPVSFNFYGVASTQAASKICSDLRSTRARLLELFSDITCNHEMMKNATDAYFSLLLGFIDSLDGGTQDNKLRYIQNFKWTDTL--QGNAPSAQQDAVFELVSMGFNVALWYTKYASRL------------ENH-----------------IPKL---ITPVEKGRDLETRVIDAYTVQCQAEAQEVTIARAIELKHNPGLIAALAYETANYYQKVDHTLATLDPVYIAKWRSYTQLKMCFYMAYSYCYHGQTLLSADKCGEAIRSLQEAEKFYGKAEALCKEYGETKGPGTTAKPSGHLFFRKMGTLVRNTLEKCQRENGFIYFQKVPPEAPQLELKANYGLVEPVPFEFPAMTSQWSPETHTGFDLTK-----------------RPKDDSAKPKKEEEVKPMKEPDIKPQKDSGCQIS 382          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Xenopus
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:100125017])

HSP 1 Score: 307.76 bits (787), Expect = 2.743e-99
Identity = 147/335 (43.88%), Postives = 220/335 (65.67%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLI 1160
            M+HWFHRNP+KAT  + F+   VA+T  A +I +D+ + R +LL++  +   + E+M  A + Y S+L GFI  +D  + D+KLR+  NF+W+ +L  +G+ P    DA+FE V+M  NVALWYTK+A++++ KE +  E+AKE H+ L+ AAG+F  +K  +I +L   I    K  D++ ++++AY  QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++     L+  +   + KW+ Y + K   Y AY+Y YHG+  L  DK GEAI +L+E  K Y ++E   KEY +  GPG TA+P  HLFFRK+G  ++ T EKC RENG I
Sbjct:    1 MTHWFHRNPLKATAPVSFNFYGVASTQAASKICSDLRSTRARLLELFSDITCNHEMMKNATDAYFSLLLGFIDSLDGGTQDNKLRYIQNFKWTDTL--QGNAPSAQQDAVFELVSMGFNVALWYTKYASRLAGKEDITEEEAKEVHRSLKIAAGVFKHLKENHIPKL---ITPVEKGRDLETRVIDAYTVQCQAEAQEVTIARAIELKHNPGLIAALAYETANYYQKVDHTLATLDPVYIAKWRSYTQLKMCFYMAYSYCYHGQTLLSADKCGEAIRSLQEAEKFYGKAEALCKEYGETKGPGTTAKPSGHLFFRKMGTLVRNTLEKCQRENGFI 330          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Xenopus
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:100125017])

HSP 1 Score: 305.064 bits (780), Expect = 8.725e-98
Identity = 164/433 (37.88%), Postives = 242/433 (55.89%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEE--PIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   VA+T  A +I +D+ + R +LL++  +   + E+M  A + Y S+L GFI  +D  + D+KLR+  NF+W+ +L  +G+ P                                S+  E+AKE H+ L+ AAG+F  +K  +I +L   I    K  D++ ++++AY  QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++     L+  +   + KW+ Y + K   Y AY+Y YHG+  L  DK GEAI +L+E  K Y ++E   KEY +  GPG TA+P  HLFFRK+G  ++ T EKC RENG IY QKVP   P LELKA YGL  P   + P +   W    ++GFD+TK                 + K++   P  +EE  P+ + D  P   SGC +S
Sbjct:    1 MTHWFHRNPLKATAPVSFNFYGVASTQAASKICSDLRSTRARLLELFSDITCNHEMMKNATDAYFSLLLGFIDSLDGGTQDNKLRYIQNFKWTDTL--QGNAP--------------------------------SITEEEAKEVHRSLKIAAGVFKHLKENHIPKL---ITPVEKGRDLETRVIDAYTVQCQAEAQEVTIARAIELKHNPGLIAALAYETANYYQKVDHTLATLDPVYIAKWRSYTQLKMCFYMAYSYCYHGQTLLSADKCGEAIRSLQEAEKFYGKAEALCKEYGETKGPGTTAKPSGHLFFRKMGTLVRNTLEKCQRENGFIYFQKVPPEAPQLELKANYGLVEPVPFEFPAMTSQWSPETHTGFDLTK-----------------RPKDDSAKPKKEEEVKPMKEPDIKPQKDSGCQIS 379          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Mouse
Match: Brox (BRO1 domain and CAAX motif containing [Source:MGI Symbol;Acc:MGI:1918928])

HSP 1 Score: 353.599 bits (906), Expect = 3.039e-116
Identity = 181/431 (42.00%), Postives = 262/431 (60.79%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   + T   A +I ND+ + R +LL++  + + + E M  A + Y S+L GFI  V   + +SKLR+  NF+W+ +L  +G +P    DA+FE ++M  NVALWYTK+A++++ KE++  ++AKE H+ L+ AAGIF  +K ++I +L   +    K  D++ ++++AYI QC AEAQE+T+ARAIEL+H+P +IA+LA++T+  ++ A   LS        KW++YL  K   Y AYAY YHG+  L  DK GEAI +L+E  KLY E+E   KEY +  GPG TA+P  HLFFRKLG  ++ T +KC RENG IY QK+P   P LELKA YGL  P   + P ++  W   A + FD+TK                 K     P P    +P+ + D  P   +GC VS
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGMITGPPASKICNDLRSARTRLLELFTDLSCNPETMKNAADLYFSLLQGFINSVGDSTQESKLRYIQNFKWTDTL--QGHVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHIPKL---LTPAEKGRDLEARLIDAYIIQCQAEAQEVTIARAIELKHAPGLIAALAYDTASFYQKADHTLSSLEPAHSAKWRKYLHLKMCFYTAYAYCYHGQTLLASDKCGEAIRSLQEAEKLYAEAEALCKEYGETKGPGPTAKPSGHLFFRKLGSLVKNTLDKCQRENGFIYFQKIPTEAPQLELKANYGLVEPVPFEFPPMSAHWTPEALAAFDLTK---------------RPKDDSVKPKPEEDVKPVKEPDIRPQKDTGCSVS 411          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Mouse
Match: Brox (BRO1 domain and CAAX motif containing [Source:MGI Symbol;Acc:MGI:1918928])

HSP 1 Score: 353.599 bits (906), Expect = 3.039e-116
Identity = 181/431 (42.00%), Postives = 262/431 (60.79%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   + T   A +I ND+ + R +LL++  + + + E M  A + Y S+L GFI  V   + +SKLR+  NF+W+ +L  +G +P    DA+FE ++M  NVALWYTK+A++++ KE++  ++AKE H+ L+ AAGIF  +K ++I +L   +    K  D++ ++++AYI QC AEAQE+T+ARAIEL+H+P +IA+LA++T+  ++ A   LS        KW++YL  K   Y AYAY YHG+  L  DK GEAI +L+E  KLY E+E   KEY +  GPG TA+P  HLFFRKLG  ++ T +KC RENG IY QK+P   P LELKA YGL  P   + P ++  W   A + FD+TK                 K     P P    +P+ + D  P   +GC VS
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGMITGPPASKICNDLRSARTRLLELFTDLSCNPETMKNAADLYFSLLQGFINSVGDSTQESKLRYIQNFKWTDTL--QGHVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHIPKL---LTPAEKGRDLEARLIDAYIIQCQAEAQEVTIARAIELKHAPGLIAALAYDTASFYQKADHTLSSLEPAHSAKWRKYLHLKMCFYTAYAYCYHGQTLLASDKCGEAIRSLQEAEKLYAEAEALCKEYGETKGPGPTAKPSGHLFFRKLGSLVKNTLDKCQRENGFIYFQKIPTEAPQLELKANYGLVEPVPFEFPPMSAHWTPEALAAFDLTK---------------RPKDDSVKPKPEEDVKPVKEPDIRPQKDTGCSVS 411          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Mouse
Match: Brox (BRO1 domain and CAAX motif containing [Source:MGI Symbol;Acc:MGI:1918928])

HSP 1 Score: 75.0998 bits (183), Expect = 3.192e-16
Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFR 428
            M+HWFHRNP+KAT  + F+   + T   A +I ND+ + R +LL++  + + + E M  A + Y S+L GFI  V   + +SKLR+  NF+
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGMITGPPASKICNDLRSARTRLLELFTDLSCNPETMKNAADLYFSLLQGFINSVGDSTQESKLRYIQNFK 91          
BLAST of BRO1 domain-containing protein BROX vs. UniProt/SwissProt
Match: sp|A3KQV2|BROX_DANRE (BRO1 domain-containing protein BROX OS=Danio rerio OX=7955 GN=brox PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.312e-117
Identity = 187/430 (43.49%), Postives = 275/430 (63.95%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIV 1442
            M+HWFHRNP+KAT  + F+L  VA++  A +I ND+   R +LLDM  +   S + + ++ ++Y ++L GFI P+D  + ++KLRF  NF+W+ +L  +G++     DA+FE V+M  NVALWYTK A++++ KE++  E+AK+ HK L+ AAGIF  +K T+I +L   I    K  D++ ++++ YI Q  AEAQE+T+ARAIEL+H+ S+IA+LAFET+  ++ A   L+  + +  +KW++YL+ K   Y AYA+ YHG+  L  DK GEAI +L+E  K Y  +EV  KEY +  GPG TA+P E LFF+KLG  ++ T EKC RENG IY  KVP   P LELKA+YGLA P + +LP ++       Y+ FD+T+     G  ++     + K+K E  I PVKE      D  P   +GC+V
Sbjct:    1 MTHWFHRNPLKATAPVSFNLYGVASSPAANKICNDLRTARARLLDMFTDATCSPDTLKKSSDEYFALLQGFILPLDGTTQENKLRFIQNFKWTDTL--QGNIASAQQDAVFELVSMAFNVALWYTKFASRLAGKENITEEEAKDVHKSLKIAAGIFKTLKETHIPRL---ITPAEKGRDLEPRVIDTYIVQSQAEAQEVTIARAIELKHNASLIAALAFETANFYQKADHTLNTLDPECSSKWKKYLQLKQHFYMAYAHCYHGQTLLAGDKCGEAIRSLQEAEKCYSRAEVLCKEYRQMKGPGSTAKPSEQLFFKKLGAVIKNTLEKCQRENGFIYFHKVPAEAPALELKASYGLAEPTAFELPPLSAQCTPEVYATFDLTR-----GHKDD-----KAKAKPEEEIKPVKE-----PDLKPQKDTGCVV 410          
BLAST of BRO1 domain-containing protein BROX vs. UniProt/SwissProt
Match: sp|Q5VW32|BROX_HUMAN (BRO1 domain-containing protein BROX OS=Homo sapiens OX=9606 GN=BROX PE=1 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 4.114e-117
Identity = 181/431 (42.00%), Postives = 262/431 (60.79%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   V T   A +I ND+ + R +LL++  + + + E+M  A + Y S+L GFI  +D  + +SKLR+  NF+W+ +L  +G +P    DA+FE ++M  NVALWYTK+A++++ KE++  ++AKE H+ L+ AAGIF  +K +++ +L   I    K  D++ +++EAY+ QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++ A   LS        KW++YL  K   Y AYAY YHGE  L  DK GEAI +L+E  KLY ++E   KEY +  GPG T +P  HLFFRKLG  ++ T EKC RENG IY QK+P   P LELKA YGL  P   + P  +  W     + FD+TK                 K     P P  + +P+ + D  P   +GC +S
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTL--QGQVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHLPKL---ITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTK---------------RPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS 411          
BLAST of BRO1 domain-containing protein BROX vs. UniProt/SwissProt
Match: sp|Q5RDD7|BROX_PONAB (BRO1 domain-containing protein BROX OS=Pongo abelii OX=9601 GN=BROX PE=2 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 6.131e-117
Identity = 181/431 (42.00%), Postives = 262/431 (60.79%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   V T   A +I ND+ + R +LL++  + + + E+M  A + Y S+L GFI  +D  + +SKLR+  NF+W+ +L  +G +P    DA+FE ++M  NVALW+TK+A++++ KE++  ++AKE H+ L+ AAGIF  +K ++I +L   I    K  D++ +++EAY+ QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++ A   LS        KW++YL  K   Y AYAY YHGE  L  DK GEAI +L+E  KLY ++E   KEY +  GPG T +P  HLFFRKLG  ++ T EKC RENG IY QK+P   P LELKA YGL  P   + P  +  W     + FD+TK                 K     P P  + +P+ + D  P   +GC +S
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTL--QGQVPSAQQDAVFELISMGFNVALWHTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHIPKL---ITPAEKGRDLESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSAQWTPETLAAFDLTK---------------RPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS 411          
BLAST of BRO1 domain-containing protein BROX vs. UniProt/SwissProt
Match: sp|A4IIL4|BROX_XENTR (BRO1 domain-containing protein BROX OS=Xenopus tropicalis OX=8364 GN=brox PE=2 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 3.366e-116
Identity = 180/433 (41.57%), Postives = 265/433 (61.20%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEE--PIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   VA+T  A +I +D+ + R +LL++  +   + E+M  A + Y S+L GFI  +D  + D+KLR+  NF+W+ +L  +G+ P    DA+FE V+M  NVALWYTK+A++++ KE +  E+AKE H+ L+ AAG+F  +K  +I +L   I    K  D++ ++++AY  QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++     L+  +   + KW+ Y + K   Y AY+Y YHG+  L  DK GEAI +L+E  K Y ++E   KEY +  GPG TA+P  HLFFRK+G  ++ T EKC RENG IY QKVP   P LELKA YGL  P   + P +   W    ++GFD+TK                 + K++   P  +EE  P+ + D  P   SGC +S
Sbjct:    1 MTHWFHRNPLKATAPVSFNFYGVASTQAASKICSDLRSTRARLLELFSDITCNHEMMKNATDAYFSLLLGFIDSLDGGTQDNKLRYIQNFKWTDTL--QGNAPSAQQDAVFELVSMGFNVALWYTKYASRLAGKEDITEEEAKEVHRSLKIAAGVFKHLKENHIPKL---ITPVEKGRDLETRVIDAYTVQCQAEAQEVTIARAIELKHNPGLIAALAYETANYYQKVDHTLATLDPVYIAKWRSYTQLKMCFYMAYSYCYHGQTLLSADKCGEAIRSLQEAEKFYGKAEALCKEYGETKGPGTTAKPSGHLFFRKMGTLVRNTLEKCQRENGFIYFQKVPPEAPQLELKANYGLVEPVPFEFPAMTSQWSPETHTGFDLTK-----------------RPKDDSAKPKKEEEVKPMKEPDIKPQKDSGCQIS 411          
BLAST of BRO1 domain-containing protein BROX vs. UniProt/SwissProt
Match: sp|Q4V8K5|BROX_RAT (BRO1 domain-containing protein BROX OS=Rattus norvegicus OX=10116 GN=Brox PE=2 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 5.960e-116
Identity = 182/431 (42.23%), Postives = 263/431 (61.02%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   + T   A +I ND+ + R +LL++  + + + E M  A + Y S+L GFI  V   + +SKLR+  NF+W+ +L  +G +P    DA+FE ++M  NVALWYTK+A++++ KE++  ++AKE H+ L+ AAGIF  +K ++I +L   +    K  D++ ++++AYI QC AEAQE+T+ARAIEL+H+P +IA+LA+ET+  ++ A   LS        KW++YL  K   Y AYAY YHG+  L  DK GEAI +L+E  KLY E+E   KEY +  GPG TA+P  HLFFRKLG  ++ T +KC RENG IY QK+P   P LELKA YGL  P   + P ++  W   A + FD+TK                 K     P P  + +P+ + D  P   +GC VS
Sbjct:    1 MTHWFHRNPLKATAPVSFNYYGMITGPPASKICNDLRSARTRLLELFTDLSCNPETMKNAADLYFSLLQGFINSVGDSTQESKLRYIQNFKWTDTL--QGHVPSAQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHIPKL---LTPAEKGRDLEARLIDAYIIQCQAEAQEVTIARAIELKHAPGLIAALAYETASFYQKADHTLSSLEPAHSAKWRKYLHLKMCFYTAYAYCYHGQTLLASDKCGEAIRSLQEAEKLYAEAEALCKEYGETKGPGPTAKPSGHLFFRKLGSLVKNTLDKCQRENGFIYFQKIPTEAPQLELKANYGLVEPVPFEFPPMSALWTPEALAAFDLTK---------------RPKDDSIKPKPEEEVKPVKEPDIKPQKDTGCSVS 411          
BLAST of BRO1 domain-containing protein BROX vs. TrEMBL
Match: A0A1I8H9K1 (BRO1 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 514.998 bits (1325), Expect = 6.950e-176
Identity = 247/431 (57.31%), Postives = 319/431 (74.01%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            MSHWFHRNP+KAT ++ FDL  VA+ T ARQ+ +D  NKRNKLLDM+ +PN SV ++ +A  QY+S+L GFI   ++ +  SK+R +L F+W+ SL +KG+ P   ADA FE + M+ N+ALWYTKHAAK+SA E V MEDAKE HKCLR AAGIF E+K    +QL   I   +  TD DD++++AY+NQC+AEAQE+TMARAIELEHS SI+ASLA +T++MF+ A LALS  +++ V KW++YL FK  CY+AYAYSYHGE  LK DK GEAIA L+E +K YQ++EV   EY+K  GPGMT RP++HLFFRKLGP ++ T EKC RENG IYHQ VP  IP LELK T+GLA+PE+ +LPEIN  W   AY GFD+TK+      +   +     + +++ P+ PVKE+PIYQS+KDP NSSGC+VS
Sbjct:    1 MSHWFHRNPLKATAKVSFDLKMVASNTAARQLTSDATNKRNKLLDMLADPNLSVSIVEEAANQYLSLLVGFIHGPETGTDSSKIRHALKFKWTDSLQLKGEQPAFQADAQFELICMLTNLALWYTKHAAKLSASEKVGMEDAKEVHKCLRIAAGIFKEVKE---NQLQKLIQKDNIGTDFDDRVVDAYVNQCSAEAQEVTMARAIELEHSHSIVASLASDTARMFKTAELALSTMDDRKVLKWRKYLTFKYCCYQAYAYSYHGEGLLKVDKCGEAIACLREAVKFYQKAEVAAAEYNKTTGPGMTVRPEQHLFFRKLGPHVRMTLEKCERENGFIYHQNVPSEIPELELKPTFGLAAPENYQLPEINKLWTPEAYKGFDLTKMGV---KSESEESKKAEEKEDKAPVQPVKEQPIYQSEKDPNNSSGCVVS 425          
BLAST of BRO1 domain-containing protein BROX vs. TrEMBL
Match: A0A267DYX2 (BRO1 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008503g1 PE=4 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 6.745e-153
Identity = 221/390 (56.67%), Postives = 287/390 (73.59%), Query Frame = 3
Query:  279 KLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            KLLDM+ +PN SV ++ +A  QY+S+L GFI   ++ +  SK+R +L F+W+ SL +KG+ P   ADA FE + M+ N+ALWYTKHAAK+SA E V MEDAKE HKCLR AAGIF E+K    +QL   I   +  TD DD++++AY+NQC+AEAQE+TMARAIELEHS SI+ASLA +T++MF+ A LALS  +++ V KW++YL FK  CY+AYAYSYHGE  LK DK GEAIA L+E +K YQ++EV   EY+K  GPGMT RP++HLFFRKLGP ++ T EKC RENG IYHQ VP  IP LELK T+GLA+PE+ +LPEIN  W   AY GFD+TK+      +   +     + +++ P+ PVKE+PIYQS+KDP NSSGC+VS
Sbjct:    1 KLLDMLADPNLSVSIVEEAANQYLSLLVGFIHGPETGTDSSKIRHALKFKWTDSLQLKGEQPAFQADAQFELICMLTNLALWYTKHAAKLSASEKVGMEDAKEVHKCLRIAAGIFKEVKE---NQLQKLIQKDNIGTDFDDRVVDAYVNQCSAEAQEVTMARAIELEHSHSIVASLASDTARMFKTAELALSTMDDRKVLKWRKYLTFKYCCYQAYAYSYHGEGLLKVDKCGEAIACLREAVKFYQKAEVAAAEYNKTTGPGMTVRPEQHLFFRKLGPHVRMTLEKCERENGFIYHQNVPSEIPELELKPTFGLAAPENYQLPEINKLWTPEAYKGFDLTKMGV---KSESEESKKAEEKEDKAPVQPVKEQPIYQSEKDPNNSSGCVVS 384          
BLAST of BRO1 domain-containing protein BROX vs. TrEMBL
Match: A0A1S3KBL9 (BRO1 domain-containing protein BROX OS=Lingula unguis OX=7574 GN=LOC106180253 PE=4 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 3.703e-150
Identity = 222/432 (51.39%), Postives = 304/432 (70.37%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAK-ESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKGA-YSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNPIKAT  + FDL  V +T   R+I +D+   RN+LLD++ NPN ++E ++   ++Y S+L GF+  VD + G+SKLR  + FRW+ +L+  G+ P    DAM+EFV+M +NVALWYTKHAAK++A+ +  +M++AKE H CLR AAGIF  +++  I+ L   I +  + TD+D +++ AY++Q TAEAQE+T+ARA+EL+H+ S+I++LAFETS MF+ A  +L G +E+ VTKW++YL+ K A Y AYAYSYHGE  L +DK GEAI  L+E +K Y+++    KEY +A GPG TARP+EHLFFR+LGP ++RT EKC RENG IYH KVP+ +P L LKATYGLASPE ++ P  +PAW  A Y+ F V         NN      E +  E   IPPVKEE I  + KDP N+SGC+VS
Sbjct:    1 MAHWFHRNPIKATAPVTFDLRGVTSTGPTRKICSDLRQHRNRLLDILSNPNENMETVDNVAKEYFSLLQGFLTAVDEKGGESKLRHIIRFRWTNTLT--GNTPTAQYDAMYEFVSMAVNVALWYTKHAAKIAAENDEPSMDEAKEVHTCLRKAAGIFVHLRDKCIAGL---IESPEQGTDLDSRVVTAYMHQSTAEAQEVTLARAVELKHTASLISALAFETSNMFQSADDSLKGEDERLVTKWRKYLQLKRAFYMAYAYSYHGETLLAQDKCGEAIRCLRESVKEYEKAGALAKEYKQAKGPGTTARPEEHLFFRRLGPIVKRTLEKCERENGFIYHHKVPEELPDLALKATYGLASPEEVEFPPPSPAWNPAVYAEFKV--------ENNPPVPEKEKEKGEGKEIPPVKEEDIKHAGKDPRNNSGCVVS 419          
BLAST of BRO1 domain-containing protein BROX vs. TrEMBL
Match: R7TPV8 (BRO1 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_175164 PE=4 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 3.091e-144
Identity = 224/432 (51.85%), Postives = 301/432 (69.68%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSES-GDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWK-GAYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT   KF+L  V T T+A++I +++   R +LLD++ NP NS +++  A E+Y+S+L G I  +D E  GDSKLR  + FRW+ +L   G  P E AD ++E +N++ NVALWYTKHAAK++ KE  +M++AKE H+CLR AAGIFT IKN  +++L   I    K TD+D +IL+AYINQCTAEAQE+T+ARAIEL+H+ ++I++LA ET+KM++ A  AL   +EK   KW++Y +FK A Y AYAYSYHGE  L EDK G+AI  L+E    Y++SE   K+Y+ + G G TA+P EHLFFRKLGP LQRT +KC REN  IYH KVP + P LELKATYGL +P+ L LP  +  W    Y  FD+TK   K   N       E ++K++  +PPVKE  I  S+KDP+NSSGC++S
Sbjct:    1 MAHWFHRNPLKATAPAKFELKGVVTKTEAQRICSELRMSRERLLDVIANPENSKDVVQPASEKYLSLLHGMISSLDPEKPGDSKLRHCMKFRWTNTLL--GSTPTEQADFLYEEINVLFNVALWYTKHAAKMAGKEEPSMDEAKEVHQCLRIAAGIFTGIKNELVTRL---IEVPEKGTDLDGRILDAYINQCTAEAQEVTIARAIELKHANTLISALAHETAKMYQTADDALVSQDEKVAGKWRKYFQFKQAIYSAYAYSYHGESLLAEDKCGDAIKCLQESNAAYEKSEKLSKDYASSKGAGSTAKPHEHLFFRKLGPILQRTLDKCVRENNFIYHHKVPPTAPDLELKATYGLVAPQELSLPSAHELWTPDVYKMFDITK---KEEPNLIEAKKEEKEAKKD--LPPVKEPDISGSNKDPSNSSGCVLS 422          
BLAST of BRO1 domain-containing protein BROX vs. TrEMBL
Match: A0A4Y2FPI2 (BRO1 domain-containing protein BROX OS=Araneus ventricosus OX=182803 GN=Brox PE=4 SV=1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.454e-138
Identity = 205/431 (47.56%), Postives = 288/431 (66.82%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVP-DSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIV 1442
            M+HWFHRNP+KAT ++ F+L  + + +QA QI +++   RN+LLD++ +PNN     + A E+Y+  L   I   D + G+SKLR+S  FRW+QSL   G+ P+   DA+FE V++  NV +W  KHAA ++ K+ ++M++AKE HKCLR AAG+F+ ++  YI   G  ++     +D+D  ++ AYI+QCTAEAQE+T+ARAIEL+H+PS++++LA ETS+M+   A  LS  N   V KW++Y E K   Y AYAY Y GE  L ++K G+AI AL+E  K Y  +    KEY    GPG++A+P  HLFFRKLGP ++R  EKC RENG I+HQKVP D +P LE+KATYGL SPE   LP IN  W   AY+ FD +    K+  N+ A   S++  K EG +PPVKE  ++QS +DP N+SGCI+
Sbjct:    1 MAHWFHRNPLKATAKVNFELKLIVSDSQAVQICSELRQSRNRLLDLLSDPNNDTTTFDAALEKYLGFLHAMIVAPDEKGGESKLRYSARFRWTQSL--LGNTPIAQQDAVFELVSICQNVGIWLMKHAAMIAGKDEISMDEAKEVHKCLRKAAGLFSVMQEKYI---GSLLLKTEPASDLDSAVVNAYISQCTAEAQEVTIARAIELKHAPSLVSALANETSRMYSAGANYLSKLNPSKVGKWKKYFELKSTFYLAYAYCYSGENLLSQEKCGDAIRALQESEKCYATANKLSKEYVTLKGPGVSAKPDNHLFFRKLGPIMKRILEKCERENGFIFHQKVPVDPVP-LEIKATYGLVSPEEFHLPSINSLWTPVAYAAFDSS----KHNPNDAAH--SKSAVKAEGDLPPVKEATVHQSAQDPKNTSGCIL 419          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Cavefish
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:103035153])

HSP 1 Score: 353.599 bits (906), Expect = 2.745e-116
Identity = 187/431 (43.39%), Postives = 276/431 (64.04%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWK-GAYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+L  VA++  A +I ND+   R +LLDM  +   + E+M +A ++Y+S+L GFI  +D    ++KLRF  NFRW+ +L  +G+ P    DA+FE V+M  N+A+W+TK A++++ KE++  ++AK+ HK L+TAAG+F  +K   I +L   I    K  D++ ++++ YI Q  AEAQE+T+ARAIEL+H+  +IA+LAFET+  ++ A   L+  + +   KW++YL+ K   Y AYA+ YHG+  L  DK G+AI +L+E    Y  +EV  KEY +  GPG TA+P E LFFRKLG  ++ T EKC RENG IY  KVP   P+LELKA+YGLA P S +LP ++       Y+ FD+T+       +++AKV    K K +  I PVK EP  +S  D    +GC++S
Sbjct:    1 MTHWFHRNPLKATAPVSFNLYGVASSPAASKICNDLRTSRARLLDMFTDATCTPEIMKKATDEYLSLLQGFIVSLDGTGQENKLRFIQNFRWTDTL--QGNTPSSQQDAVFELVSMGFNIAIWHTKFASRLAGKENITEDEAKDVHKSLKTAAGMFKYLKEVQIPRL---ITPAEKGRDLEPRVIDTYIVQSQAEAQEVTIARAIELKHNVGLIAALAFETANFYQKADHTLNTLDPEYSMKWRKYLQLKQHFYMAYAHCYHGQTLLASDKCGDAIRSLQEAETYYSRAEVLCKEYRQTKGPGSTAKPSEQLFFRKLGGLIKNTLEKCQRENGFIYFHKVPAEAPVLELKASYGLAEPISFELPALSDQCTLEVYATFDLTRGQ----KDDKAKV----KPKPDEDIKPVK-EPDVKSQID----TGCVIS 413          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Cavefish
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:NCBI gene;Acc:103031070])

HSP 1 Score: 51.2174 bits (121), Expect = 3.058e-6
Identity = 68/318 (21.38%), Postives = 131/318 (41.19%), Query Frame = 3
Query:  309 NSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLS----IKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESV-NMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLP 1247
            +S+E++ + ++Q  +V   F  P             L F W  +        G + L LA   +E   ++ N+       A+++++++++ N E  K   K  + A+G F  IK+T +S L     N+  T DI  + +        ++AQE+ + +A   +   +I+A LA + +  F   A       E    +    L  K    +A A  +      ++ + GE IA L+   +L +                + +R  E++  + L   + R      ++N  IYH +VP+ +  LE      L    S+++P
Sbjct:   62 SSLEILLRYYDQLCAVEPKFPFP----------ELCLTFTWKDAFDKGSLFGGSVKLALASLGYEKTCVLFNIGAL----ASQIASEQNLDNDEGLKSAAKFYQLASGAFAHIKDTVLSAL-----NREPTMDISPETVGTLSQIMLSQAQEVFVMKATADKMKDAIVAKLANQAAD-FYGDAFKQCQYKENLPKEVLPVLAAKHCMMQATAELHQSALANQKKRFGEEIARLQHATELVKT---------------VASRYDEYVNVKDLSEKINRALTAAKKDNDFIYHDRVPE-VKDLEHIGKAALVKTTSIQVP 343          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Sea Lamprey
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:ZFIN;Acc:ZDB-GENE-040426-2678])

HSP 1 Score: 50.0618 bits (118), Expect = 6.680e-7
Identity = 57/227 (25.11%), Postives = 93/227 (40.97%), Query Frame = 3
Query:  609 AAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKGAYSGFD 1289
            A+G F +IK + +S L     N+  T DI    + A      A+AQE+   +A   +   +I+A LA + +  +   A       E+   +    L  K   Y+A A  +      ++ K GE IA L+    L +                +T+R  E++  + L   + R      ++N  IYH +VPD I  LE      L  P  L  P ++P + G    F+
Sbjct:   29 ASGCFLQIKESVLSAL-----NREPTVDISPDTVGALSVIMLAQAQEVFYMKASADKMKDAIVAKLANQAADYYG-DAFKQCQYKEQLPKEVLPLLAAKHCIYQATAQLHQSNVAKQQKKFGEEIARLQHATDLVKT---------------VTSRYDEYISVKDLSDKISRALTAAKKDNDFIYHDRVPD-IKDLEAIGKATLVKPLQLASP-MSPRFVGKSDLFE 232          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Yeast
Match: BRO1 (Cytoplasmic class E vacuolar protein sorting (VPS) factor; coordinates deubiquitination in the multivesicular body (MVB) pathway by recruiting Doa4p to endosomes [Source:SGD;Acc:S000006005])

HSP 1 Score: 57.7658 bits (138), Expect = 3.628e-9
Identity = 66/299 (22.07%), Postives = 128/299 (42.81%), Query Frame = 3
Query:  360 WGFIKPVDSESGDSKLRFSLNFRW--SQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSP---SIIASLAFETSKMFE-CAALALSGGNEKAV---TKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASP 1229
            + F++ +    G    R  ++F W  ++  S +  L        FE    + N+A+ +T+      A+E++N ED K +   L  A   F  +   +++         S + D+  +      N C AEAQE+ + + +  + S    ++I+ L+  T  +F+ C        ++ A+    KW+  +  K   Y++ +  YHG    +E++ GEAIA L   ++         +  S  P         E + F      L++  ++  ++N  IYH+ VP  + +  +KA   + SP
Sbjct:   71 YSFLEHLYFRLGSKGSRLKMDFTWYDAEYSSAQKGLKYTQHTLAFEKSCTLFNIAVIFTQ-----IARENIN-EDYKNSIANLTKAFSCFEYLSENFLN---------SPSVDLQSENTRFLANICHAEAQELFVLKLLNDQISSKQYTLISKLSRATCNLFQKCHDFMKEIDDDVAIYGEPKWKTTVTCKLHFYKSLSAYYHGLHLEEENRVGEAIAFLDFSMQ---------QLISSLPFKTWLV---EFIDFDGFKETLEKKQKELIKDNDFIYHESVPAVVQVDSIKALDAIKSP 342          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Yeast
Match: RIM20 (Protein involved in proteolytic activation of Rim101p; part of response to alkaline pH; PalA/AIP1/Alix family member; interaction with the ESCRT-III subunit Snf7p suggests a relationship between pH response and multivesicular body formation [Source:SGD;Acc:S000005801])

HSP 1 Score: 49.6766 bits (117), Expect = 1.201e-6
Identity = 65/263 (24.71%), Postives = 110/263 (41.83%), Query Frame = 3
Query:  417 LNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHK--CL--RTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKA-GEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIP 1190
            + F W Q+LS K     + +   +E + ++ N+   Y+  A   +        DA E+ K  CL  + AAG F  + +           N      +DD  L A  +   A+AQE    +A++ +H  S+IA L+ +    F C A+  +   +   + W  +L+ K A + A  Y Y       E K  G  + AL+ GL+   ES +     S+A                K    ++ + ++  R+N  IY Q+VP  +P
Sbjct:   82 IEFTWFQTLSQKSRGTSQYS-LQWEKLTIIYNIGCMYSLLALNSN-------NDAAESLKTSCLYFQNAAGCFKHVLDHQ--------KNLETIPVVDDATLNALTSLMLAQAQECFWFKAVQDKHKDSLIAKLSQQIVD-FYCEAINDAQRGKLIRSDWINHLKAKKAYFSAVTY-YRIALSFNEKKQFGNVVKALQMGLQFINESTLS----SQA----------------KFKTVVESSLKEAQRDNEFIYLQEVPSELP 306          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Nematostella
Match: EDO43006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU6])

HSP 1 Score: 381.333 bits (978), Expect = 1.670e-127
Identity = 193/431 (44.78%), Postives = 279/431 (64.73%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFD-LGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKGAYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNPIKAT  + F+ L +  T + A +I+ D+   R KLL ++ +P N V+ + QA+E Y+S+L G +      +GDSKLR  + F+W+ S  I G+ PL  AD +FE ++M +N+A WYTKHAAK++AKE ++M++AKE H  LRTAAG+F  +K+  + +L    ++  K  DI+ +++EAY  QC AEAQE+T+ARA+EL+H  S+I+SLA ET+K+F  AA +L   ++    KW++YLE K A Y AYAY + GEQ L  D+ G+AI +L+E  KLY+ +E   ++YS   GPG TARPQEH FFR++GP ++   +K  RENG IY  K+P+    L++KAT+GLASP+   LP  N  W  AY+ FD TK       + E  +    +S+++GP+ P K            NSSGC+VS
Sbjct:    1 MAHWFHRNPIKATAPVSFESLRSTVTNSAAGKIITDLKTNRAKLLSLLTDPANEVQTVQQAYEVYLSLLHGLVNDPGG-AGDSKLRKLIMFKWTNS--ICGNTPLCEADTVFELLSMCMNIASWYTKHAAKLAAKEDISMDEAKEVHTSLRTAAGMFQYVKDQLLGRLEQ--LSAEKGADIEKRVVEAYHMQCVAEAQEVTVARAVELKHKASLISSLANETAKLFTSAADSLKSVDDLKAGKWRKYLELKAAFYEAYAYCFQGEQLLDADECGKAIRSLQESEKLYKTAEALCRDYSATKGPGTTARPQEHPFFRRIGPLMKTRLDKATRENGFIYFHKIPEEPQELDMKATFGLASPQEFILPAPNAIWTEAYAAFDATKAQPPQKRSAEGDLNPVQESEDKGPVKPAK------------NSSGCVVS 414          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Nematostella
Match: EDO31840 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWR0])

HSP 1 Score: 53.5286 bits (127), Expect = 1.205e-7
Identity = 40/130 (30.77%), Postives = 60/130 (46.15%), Query Frame = 3
Query:  915 YRAYAYSYHGEQKLK-EDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVP-DSIPILELKATY---GLASPESLKLPEINPAWKGAYSGFD 1289
            Y A A  + G   L+ EDK GE+I  L+E  K  ++++   KEY K   P       E     ++   +     K +RENG+IYHQ++P + +P+ E K          P+S  L  +  A     SG D
Sbjct:  258 YFALARCFQGINLLEAEDKCGESIVVLRESSKHIEQAKAFAKEYDKL-KPKTKVHLDESQQLIRVKKLINEKQAKSDRENGMIYHQRLPEECLPLYEPKCVVQPTAFHLPDSHDLTSVQSATDVDASGTD 386          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Medaka
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:101161111])

HSP 1 Score: 351.288 bits (900), Expect = 1.960e-115
Identity = 187/431 (43.39%), Postives = 266/431 (61.72%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   VA +  A +I ND+   R +LLDM  +   + E+M  A + Y S+L GFI  +D  + ++K+RF  NF+W+ +L   G+ P    DA+FE  +M  NVALWYTK A++++ KE+V   +AK+ HK L+ AAGIF  +K  ++ +L   I    K  D++ ++++AYI Q  AEAQE+T+ARAIEL+H+ S+IA+LAFET+  ++ A   L+  + +  +KW++YL+ K   Y AYAY YHG+  L  DK GEAI +L+E  K Y  +E   KEY    GPG TA+P E LFF KLG  ++ T EKC RENG IY  KVP   P LELKA+YGLA P   ++P ++       Y+ FD+TK     G+ N+     + K KEE  + PVKE      D  P   +GC++S
Sbjct:    1 MAHWFHRNPLKATAPVSFNYYGVAGSPAANKICNDLRTTRARLLDMFTDSTCNPEMMKNATDAYFSLLQGFIAALDGTTQENKMRFIQNFKWTDTLH--GNTPSAQQDAIFELASMAFNVALWYTKFASRLAGKENVTEAEAKDVHKSLKVAAGIFKNLKEVHVPRL---ITPAEKGKDLEPRVMDAYIIQSQAEAQEVTIARAIELKHNASLIAALAFETANFYQKADHTLNTLDPEYSSKWRKYLQLKQQFYMAYAYCYHGQTLLASDKCGEAIRSLQEAEKCYSRAEALCKEYRHTSGPGSTAKPSEQLFFLKLGALIKNTLEKCQRENGFIYFHKVPAEAPQLELKASYGLAEPVGFEMPPLSEQCTPEVYATFDLTK-----GAKND-----KGKPKEE-EVKPVKE-----PDLKPQKDTGCVLS 410          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Medaka
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:101161111])

HSP 1 Score: 350.903 bits (899), Expect = 1.543e-114
Identity = 187/431 (43.39%), Postives = 266/431 (61.72%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   VA +  A +I ND+   R +LLDM  +   + E+M  A + Y S+L GFI  +D  + ++K+RF  NF+W+ +L   G+ P    DA+FE  +M  NVALWYTK A++++ KE+V   +AK+ HK L+ AAGIF  +K  ++ +L   I    K  D++ ++++AYI Q  AEAQE+T+ARAIEL+H+ S+IA+LAFET+  ++ A   L+  + +  +KW++YL+ K   Y AYAY YHG+  L  DK GEAI +L+E  K Y  +E   KEY    GPG TA+P E LFF KLG  ++ T EKC RENG IY  KVP   P LELKA+YGLA P   ++P ++       Y+ FD+TK     G+ N+     + K KEE  + PVKE      D  P   +GC++S
Sbjct:   52 MAHWFHRNPLKATAPVSFNYYGVAGSPAANKICNDLRTTRARLLDMFTDSTCNPEMMKNATDAYFSLLQGFIAALDGTTQENKMRFIQNFKWTDTLH--GNTPSAQQDAIFELASMAFNVALWYTKFASRLAGKENVTEAEAKDVHKSLKVAAGIFKNLKEVHVPRL---ITPAEKGKDLEPRVMDAYIIQSQAEAQEVTIARAIELKHNASLIAALAFETANFYQKADHTLNTLDPEYSSKWRKYLQLKQQFYMAYAYCYHGQTLLASDKCGEAIRSLQEAEKCYSRAEALCKEYRHTSGPGSTAKPSEQLFFLKLGALIKNTLEKCQRENGFIYFHKVPAEAPQLELKASYGLAEPVGFEMPPLSEQCTPEVYATFDLTK-----GAKND-----KGKPKEE-EVKPVKE-----PDLKPQKDTGCVLS 461          
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Medaka
Match: brox (BRO1 domain and CAAX motif containing [Source:NCBI gene;Acc:101161111])

HSP 1 Score: 314.694 bits (805), Expect = 1.306e-101
Identity = 175/431 (40.60%), Postives = 251/431 (58.24%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKG-AYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            M+HWFHRNP+KAT  + F+   VA +  A +I ND+   R +LLDM  +   + E+M  A + Y S+L GFI  +D  + ++K+RF  NF+W+ +L   G+ P    DA+FE  +M  NVALWYTK A++++ KE + +                       ++ +L   I    K  D++ ++++AYI Q  AEAQE+T+ARAIEL+H+ S+IA+LAFET+  ++ A   L+  + +  +KW++YL+ K   Y AYAY YHG+  L  DK GEAI +L+E  K Y  +E   KEY    GPG TA+P E LFF KLG  ++ T EKC RENG IY  KVP   P LELKA+YGLA P   ++P ++       Y+ FD+TK     G+ N+     + K KEE  + PVKE      D  P   +GC++S
Sbjct:    1 MAHWFHRNPLKATAPVSFNYYGVAGSPAANKICNDLRTTRARLLDMFTDSTCNPEMMKNATDAYFSLLQGFIAALDGTTQENKMRFIQNFKWTDTL--HGNTPSAQQDAIFELASMAFNVALWYTKFASRLAGKEKLEV-----------------------HVPRL---ITPAEKGKDLEPRVMDAYIIQSQAEAQEVTIARAIELKHNASLIAALAFETANFYQKADHTLNTLDPEYSSKWRKYLQLKQQFYMAYAYCYHGQTLLASDKCGEAIRSLQEAEKCYSRAEALCKEYRHTSGPGSTAKPSEQLFFLKLGALIKNTLEKCQRENGFIYFHKVPAEAPQLELKASYGLAEPVGFEMPPLSEQCTPEVYATFDLTK-----GAKND-----KGKPKEE-EVKPVKE-----PDLKPQKDTGCVLS 387          
BLAST of BRO1 domain-containing protein BROX vs. Planmine SMEST
Match: SMESG000055804.1 (SMESG000055804.1)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 429/430 (99.77%), Postives = 429/430 (99.77%), Query Frame = 3
Query:  156 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKGAYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 1445
            MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLEL DAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKGAYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS
Sbjct:    1 MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENPNNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKGDLPLELTDAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKGAYSGFDVTKLAWKYGSNNEAKVASENKSKEEGPIPPVKEEPIYQSDKDPTNSSGCIVS 430          
BLAST of BRO1 domain-containing protein BROX vs. Planmine SMEST
Match: SMESG000019014.1 (SMESG000019014.1)

HSP 1 Score: 69.707 bits (169), Expect = 4.365e-12
Identity = 70/297 (23.57%), Postives = 128/297 (43.10%), Query Frame = 3
Query:  417 LNFRWSQSLSIKGDL-----PLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMED---AKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAV--TKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKGAY 1277
            ++F+W  + + K  L      L++A   +E + ++ N+A  Y++ A      E+ N+ D    K   K  + AAGIF+ ++++      P I+ +  T D++   L A      A+AQE+   +A+   H    IA +  + + ++      +   + KA+    W   +  K A Y A A  Y  +        GE I+  ++ + L + +               + R  +   FR     ++R  E   +EN LIYH  +PD +  L + A   LA   SL+ P IN  ++  +
Sbjct:   89 IDFKWDDAFA-KDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVA------ETANLSDDSGLKTAAKYFQQAAGIFSYLRSSV-----PNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTA---------------STRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPD-VATLSIVAKVILAREISLENP-INKDFRDLF 356          
The following BLAST results are available for this feature:
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BROX8.567e-11842.00BRO1 domain and CAAX motif containing [Source:HGNC... [more]
BROX4.181e-10245.37BRO1 domain and CAAX motif containing [Source:HGNC... [more]
BROX9.610e-9938.52BRO1 domain and CAAX motif containing [Source:HGNC... [more]
BROX9.610e-9938.52BRO1 domain and CAAX motif containing [Source:HGNC... [more]
BROX1.434e-6143.64BRO1 domain and CAAX motif containing [Source:HGNC... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0507.24.650e-10439.86BRO1 domain-containing protein BROX homolog [Sour... [more]
alx-11.554e-819.59Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-11.562e-718.73Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-11.562e-718.73Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-11.660e-720.34Apoptosis-linked gene 2-interacting protein X 1 [... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mop2.874e-723.69gene:FBgn0036448 transcript:FBtr0075700[more]
ALiX6.552e-620.00gene:FBgn0086346 transcript:FBtr0085241[more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
brox1.738e-11843.49BRO1 domain and CAAX motif containing [Source:NCBI... [more]
brox1.738e-11843.49BRO1 domain and CAAX motif containing [Source:NCBI... [more]
pdcd6ip7.861e-621.28programmed cell death 6 interacting protein [Sourc... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
brox6.355e-11741.57BRO1 domain and CAAX motif containing [Source:NCBI... [more]
brox3.270e-10039.03BRO1 domain and CAAX motif containing [Source:NCBI... [more]
brox2.743e-9943.88BRO1 domain and CAAX motif containing [Source:NCBI... [more]
brox8.725e-9837.88BRO1 domain and CAAX motif containing [Source:NCBI... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Brox3.039e-11642.00BRO1 domain and CAAX motif containing [Source:MGI ... [more]
Brox3.039e-11642.00BRO1 domain and CAAX motif containing [Source:MGI ... [more]
Brox3.192e-1639.56BRO1 domain and CAAX motif containing [Source:MGI ... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A3KQV2|BROX_DANRE1.312e-11743.49BRO1 domain-containing protein BROX OS=Danio rerio... [more]
sp|Q5VW32|BROX_HUMAN4.114e-11742.00BRO1 domain-containing protein BROX OS=Homo sapien... [more]
sp|Q5RDD7|BROX_PONAB6.131e-11742.00BRO1 domain-containing protein BROX OS=Pongo abeli... [more]
sp|A4IIL4|BROX_XENTR3.366e-11641.57BRO1 domain-containing protein BROX OS=Xenopus tro... [more]
sp|Q4V8K5|BROX_RAT5.960e-11642.23BRO1 domain-containing protein BROX OS=Rattus norv... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H9K16.950e-17657.31BRO1 domain-containing protein OS=Macrostomum lign... [more]
A0A267DYX26.745e-15356.67BRO1 domain-containing protein (Fragment) OS=Macro... [more]
A0A1S3KBL93.703e-15051.39BRO1 domain-containing protein BROX OS=Lingula ung... [more]
R7TPV83.091e-14451.85BRO1 domain-containing protein OS=Capitella teleta... [more]
A0A4Y2FPI21.454e-13847.56BRO1 domain-containing protein BROX OS=Araneus ven... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
brox2.745e-11643.39BRO1 domain and CAAX motif containing [Source:NCBI... [more]
pdcd6ip3.058e-621.38programmed cell death 6 interacting protein [Sourc... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pdcd6ip6.680e-725.11programmed cell death 6 interacting protein [Sourc... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
BRO13.628e-922.07Cytoplasmic class E vacuolar protein sorting (VPS)... [more]
RIM201.201e-624.71Protein involved in proteolytic activation of Rim1... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO430061.670e-12744.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318401.205e-730.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
brox1.960e-11543.39BRO1 domain and CAAX motif containing [Source:NCBI... [more]
brox1.543e-11443.39BRO1 domain and CAAX motif containing [Source:NCBI... [more]
brox1.306e-10140.60BRO1 domain and CAAX motif containing [Source:NCBI... [more]
back to top
BLAST of BRO1 domain-containing protein BROX vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000055804.10.000e+099.77SMESG000055804.1[more]
SMESG000019014.14.365e-1223.57SMESG000019014.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024210 ID=SMED30024210|Name=BRO1 domain-containing protein BROX|organism=Schmidtea mediterranea sexual|type=transcript|length=1856bp
ATAAATTTAACGGATATTAATGTGAAAATCCAATTAAATTAGAAATTTGT
TTTTATATGTAAATTGAAAATTAATAAACATTAAAACTTTAAATTTAGGA
AATTCAATATTTAATTAGTTGATAAGCTAAATCTAATTTCATAAACTATT
TTCTAATGTCTCATTGGTTTCATCGAAATCCGATTAAAGCTACTAATCGA
ATAAAGTTTGACTTAGGCACTGTTGCGACTACAACACAAGCTAGACAGAT
TCTAAATGACGTTGCAAACAAAAGAAACAAATTATTGGATATGGTTGAAA
ATCCCAACAACTCAGTAGAATTGATGAATCAAGCCTTTGAGCAATATATA
AGTGTTCTATGGGGATTTATTAAACCGGTTGATTCTGAAAGTGGAGATAG
TAAATTAAGATTTAGTCTCAATTTTCGATGGTCTCAAAGCTTATCTATTA
AAGGCGATTTACCACTAGAACTAGCTGATGCTATGTTTGAATTCGTCAAC
ATGATGATCAATGTTGCCCTCTGGTACACAAAACATGCTGCTAAGGTTTC
TGCTAAAGAAAGTGTCAATATGGAAGATGCTAAGGAAACACATAAATGTT
TACGCACTGCAGCAGGAATATTTACGGAAATAAAAAACACTTATATATCC
CAGTTGGGGCCAACAATTATGAACAAAAGTAAAACCACCGATATCGATGA
TCAGATTCTCGAAGCCTACATAAATCAGTGTACGGCAGAAGCTCAAGAAA
TCACAATGGCTAGAGCTATTGAACTAGAACACAGTCCAAGTATAATCGCA
TCTTTAGCGTTTGAAACCTCCAAAATGTTCGAATGTGCAGCTCTGGCTCT
ATCGGGTGGAAACGAAAAGGCTGTTACGAAATGGCAGCGATATTTGGAGT
TTAAATGCGCTTGCTATCGTGCATACGCTTATAGTTATCACGGAGAGCAA
AAATTAAAGGAAGACAAAGCCGGAGAGGCAATCGCAGCTCTAAAAGAAGG
TTTGAAATTATATCAAGAGAGTGAAGTTAAAATAAAAGAATACAGCAAAG
CTCCTGGTCCTGGAATGACAGCGAGACCTCAGGAGCATTTGTTTTTTCGT
AAATTAGGGCCTTTCTTGCAGAGAACCTATGAAAAATGTAATAGGGAAAA
TGGATTGATATACCACCAGAAGGTTCCCGATTCCATTCCGATTTTGGAAT
TGAAAGCTACTTATGGTCTCGCGTCGCCAGAAAGCTTGAAACTGCCGGAA
ATCAATCCCGCTTGGAAAGGGGCTTATTCGGGATTTGATGTGACAAAATT
AGCCTGGAAATATGGTTCCAACAATGAGGCCAAGGTGGCAAGTGAGAACA
AGAGTAAAGAAGAAGGGCCGATTCCACCGGTTAAAGAAGAGCCTATCTAT
CAGTCAGACAAAGATCCAACAAATAGCAGCGGCTGCATCGTGTCATAAGC
TCACAATCGTTCTTGTCATGAGATATATTGATATTAAATGGAAGTCACGT
TGATTGTATTTTTTCATACTCGTTATCAATCATAATTTCTTACATTATAT
ATTCTATTTATTACATCAACTGACGCTGGATAAAGGCTGTGCCGGGAATT
TGTGGTTATCATTAACTGTTTAATTCATAGATTATTCATTATTCATCAGT
CATATTTAAATGTGACACTTAGTAACCTATTTTTTGGTTTCTATGGAAAC
ATTAATATTTTCTATGGTCAATACCTTTTATGATATTTCAAATAGCAACA
TATCGGCTGCTATGCCGACATCAAATGCGGCTTTTTATTTTTTCAGACAA
TTAAGGAATCATGGAGTCAGAAAGATTAATCTTGAAATTTCCCGAAATTT
AATATA
back to top

protein sequence of SMED30024210-orf-1

>SMED30024210-orf-1 ID=SMED30024210-orf-1|Name=SMED30024210-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=431bp
MSHWFHRNPIKATNRIKFDLGTVATTTQARQILNDVANKRNKLLDMVENP
NNSVELMNQAFEQYISVLWGFIKPVDSESGDSKLRFSLNFRWSQSLSIKG
DLPLELADAMFEFVNMMINVALWYTKHAAKVSAKESVNMEDAKETHKCLR
TAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEIT
MARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAVTKWQRYLEFK
CACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAP
GPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELK
ATYGLASPESLKLPEINPAWKGAYSGFDVTKLAWKYGSNNEAKVASENKS
KEEGPIPPVKEEPIYQSDKDPTNSSGCIVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038499BRO1_sf
IPR038898BROX
IPR004328BRO1_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004328BRO1 domainSMARTSM01041BRO1_2coord: 4..373
e-value: 3.7E-56
score: 202.6
IPR004328BRO1 domainPFAMPF03097BRO1coord: 63..349
e-value: 9.4E-37
score: 126.7
IPR004328BRO1 domainPROSITEPS51180BRO1coord: 1..430
score: 15.736
IPR038499BRO1 domain superfamilyGENE3DG3DSA:1.25.40.280coord: 1..378
e-value: 2.0E-117
score: 394.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 395..417
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 391..430
NoneNo IPR availablePANTHERPTHR23032:SF1BRO1 DOMAIN-CONTAINING PROTEIN BROXcoord: 3..381
IPR038898BRO1 domain-containing protein BROXPANTHERPTHR23032UNCHARACTERIZEDcoord: 3..381