Protocadherin-11 X-linked

Overview
NameProtocadherin-11 X-linked
Smed IDSMED30024206
Length (bp)4637
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-11 X-linked (SMED30024206) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30024206) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-11 X-linked (SMED30024206) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30024206) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024206

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024206SMESG000076665.1 SmedASXL_010321SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30024206SMESG000076665.1 SmedASXL_012512SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30024206SMESG000076665.1 dd_Smed_v4_18373_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024206SMESG000076665.1 dd_Smed_v6_18373_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 328.561 bits (841), Expect = 3.806e-93
Identity = 218/662 (32.93%), Postives = 341/662 (51.51%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYS------IVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            NDN+P+F+ PV T+ I E+  IG+  P+PLA D D+    + SY L+    A  LF L       D    Q  L ++  +DRE    Y+L +   D G P  +    + + +LD NDN P FE  +Y   + E+   GH ++ +KA D D G N  + Y F       VR+   +D +TG +++   +D E +    F+V+A+D GT+   ++A V V+V D NDN P I +  +   G  T  +G   I+++ +      +V VSD D G    V C + G   F L   +     + K   +++   LDYE+       IV  D G P L+S++  ++ + D+NDN+P+F          ENN+ G V+ ++ A+D DS  N ++ YS++    +   F+I P TG I+ K S DRE+R SY+L V A D G P+  G+A VL+ + D NDN P F  L+G   Y F + EN P+ + +G +   D D+G N QV  +       F I    G I ++   DRE ++ + F ++ +D G+  +   V VT++V+DENDN P    P+N S  + ++     G  V+++ A D D G N+ L Y I  GN        +F +   +G I L++ + R+  G++ L + VSD+G PPR   A
Sbjct:  162 NDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGL---QVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQ-APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGI---GLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM-LSG---YNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY-----GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 806          

HSP 2 Score: 161.384 bits (407), Expect = 3.516e-39
Identity = 148/591 (25.04%), Postives = 251/591 (42.47%), Query Frame = 1
Query: 1240 GKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKE--YSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT-------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIK--ENGPSNAIIGTIHAEDPDEGINGQVLYTF-LSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            G P L   L+ +I++ D NDN P F +    + + E+   G L  +  A+D+D+G NG+  Y   +    E ++ F +      +     L +   LD E+   Y   +  +D G+    S A ++V+V+D NDN PK          +R   E   + N    +S++ V   DS  G   + +    Q   +V    R + +T  I +   +D E+ +  RF ++  DRG    ++  +  + ++D+NDN+P  E        H      + E+      V  V  +DRD   N  +   +             TG+       +++    D EK   Y + + A D G P  S + ++ + + D NDN P F         + E+   EN     +I  I A D D G N +++Y+    P  K  FTI P+ G I+    LDRE +  +E  V   D+G    + + +V V+V+D NDN+P+F++     +    S ++    L  V  +  ID D+G N+ +   +   N         F +    G I    +  R+    Y  ++   D G PPR +Y    I +
Sbjct:  147 GSPRL---LEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAG--PEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKF---------ERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFT------QSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFML-----SGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGD-------FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINV 705          

HSP 3 Score: 75.8702 bits (185), Expect = 5.982e-13
Identity = 76/296 (25.68%), Postives = 128/296 (43.24%), Query Frame = 1
Query: 2101 LSVSYFSIDPVTGTI-RSKISFDREKRASYQLSV--------FARDLGEPAQSGSANVL---ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK-----FTIHPDQG------IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +   Y  +D  TG I  ++ S DRE     Q  +        F   + +  Q+GS  +L   I + D NDNTP F            I EN    ++     A D D G NG   Y   +  E        +  DQ       I+  N  LDRE    ++ +++V D G   + +S  + V+V+D NDN P+F  P   S   ++S     G  V +++A D D+G N+ ++Y     +   +   ++  +D+  G I +Q  + R+D+      ++  D+G  P+ + A  V+ +
Sbjct:   94 VGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF----ASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGN--LDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERP---SYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTV 377          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 328.561 bits (841), Expect = 3.384e-92
Identity = 221/663 (33.33%), Postives = 342/663 (51.58%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYS------IVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDT-AGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            NDN+P+F+ PV T+ I E+  IG+  P+PLA D D+    + SY L+    A  LF L       D    Q  L ++  +DRE    Y+L +   D G P  +    + + +LD NDN P FE  +Y   + E+   GH ++ +KA D D G N  + Y F       VR+   +D +TG +++   +D E +    F+V+A+D GT+   ++A V V+V D NDN P I +  +   G  T  +G   I+++ +      +V VSD D G    V C + G   F L   +     + K   +++   LDYE+       IV  D G P L+S++  ++ + D+NDN+P+F          ENN+ G V+ ++ A+D DS  N ++ YS++    +   F+I P TG I+ K S DRE+R SY+L V A D G P+  G+A VL+ + D NDN P F  L+G   Y F + EN P+ + +G +   D D+G N QV  +       F I    G I ++   DRE ++ + F ++ +D G+  +   V VT++V+DENDN P    P+N  TS K+    T  G  V+++ A D D G N+ L Y I  GN        +F +   +G I L++ + R+  G++ L + VSD+G PPR   A
Sbjct:  162 NDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGL---QVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQ-APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGI---GLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM-LSG---YNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSN--TSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY-----GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 806          

HSP 2 Score: 161.384 bits (407), Expect = 4.602e-39
Identity = 148/591 (25.04%), Postives = 251/591 (42.47%), Query Frame = 1
Query: 1240 GKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKE--YSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT-------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIK--ENGPSNAIIGTIHAEDPDEGINGQVLYTF-LSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            G P L   L+ +I++ D NDN P F +    + + E+   G L  +  A+D+D+G NG+  Y   +    E ++ F +      +     L +   LD E+   Y   +  +D G+    S A ++V+V+D NDN PK          +R   E   + N    +S++ V   DS  G   + +    Q   +V    R + +T  I +   +D E+ +  RF ++  DRG    ++  +  + ++D+NDN+P  E        H      + E+      V  V  +DRD   N  +   +             TG+       +++    D EK   Y + + A D G P  S + ++ + + D NDN P F         + E+   EN     +I  I A D D G N +++Y+    P  K  FTI P+ G I+    LDRE +  +E  V   D+G    + + +V V+V+D NDN+P+F++     +    S ++    L  V  +  ID D+G N+ +   +   N         F +    G I    +  R+    Y  ++   D G PPR +Y    I +
Sbjct:  147 GSPRL---LEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAG--PEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKF---------ERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFT------QSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFML-----SGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGD-------FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINV 705          

HSP 3 Score: 75.8702 bits (185), Expect = 6.969e-13
Identity = 77/296 (26.01%), Postives = 129/296 (43.58%), Query Frame = 1
Query: 2101 LSVSYFSIDPVTGTI-RSKISFDRE--KRASYQLSV------FARDLGEPAQSGSANVL---ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK-----FTIHPDQG------IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +   Y  +D  TG I  ++ S DRE  +    QL        F   + +  Q+GS  +L   I + D NDNTP F            I EN    ++     A D D G NG   Y   +  E        +  DQ       I+  N  LDRE    ++ +++V D G   + +S  + V+V+D NDN P+F  P   S   ++S     G  V +++A D D+G N+ ++Y     +   +   ++  +D+  G I +Q  + R+D+      ++  D+G  P+ + A  V+ +
Sbjct:   94 VGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF----ASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGN--LDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERP---SYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTV 377          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 322.398 bits (825), Expect = 2.779e-91
Identity = 219/709 (30.89%), Postives = 354/709 (49.93%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTL----IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTL-IEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC   G     E  CFFEL+V++                 +    +  I+I + D NDN+P F  PV  I I E+  I ++ P+P A D D+    +  Y L N + ++F L     PE   +   I Q      Q +DRE    Y + +   D G P  S    +++ + D NDN+P+F+     V++ E+   G  ++ L ATD D G N  + Y F + V    ++ F ++++TG +++  +LD E+   +   V+A D  +  A  +ATV ++V D NDNPP I L Y+      T+ +     +N + +++ VSD D+   G V C ++    F L    + +   + +     LDYE      F IV  D G+P L  +    + + D NDN PIF  P    +V ENN+ G+ +  + ATD DS  N  I Y +   + S+F +D  TG + +   FDRE++  +  +V ARD G P     A V++T+ D+NDN+P F        + F + EN P  + +G I   D D G N  V  + L+  + F + P  G+I++N   DRE ++ + F V+  D G   + ++  VT++V+D NDN P  + P ++++   +      G++VA + A+D D G N+ L Y I+SGN++      +F +D   G+I L+      D+G++ L + +SD G P
Sbjct:   92 IDREKLCA--GASYAEENECFFELEVVI---------------LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ-SVFGLDIVETPEGEKWPQLIVQ------QNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA--RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNK-----GLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 134.035 bits (336), Expect = 7.706e-31
Identity = 136/565 (24.07%), Postives = 232/565 (41.06%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGW--LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSID-SLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI+I + D NDN P+F +    +++ E+ +      +  ATD D+G NG+  Y   +  +              W  L + + LD E+   Y   +   D GT    S A ++V+V D NDN P      V          G + I         +D D G+   ++  + G+Q   + P   R      +T  I +  SLD EE  + +  ++  D       ++    I + D+NDN P      I    +    + E +     +  +  +D+D+D+NGK+   I+  +     ++      + +    D E    +   + A D G+P+ + +A V + + D+NDN P F            + EN      + TI A D D G N  ++Y        F +    G++  ++  DRE +    F+V   D G    ++  +V V+V+DENDN P+F   T++     +S      + V  I   D D G N  +   I++ N         F +D  +G I    +  R+    Y   +  +D G PPR S A   I +
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLH-----ATDADIGSNAEIRY-IFGAQ---VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFN----QPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF---THNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDN-------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINV 665          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 319.316 bits (817), Expect = 3.592e-90
Identity = 224/705 (31.77%), Postives = 349/705 (49.50%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTT-INKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC  I +    +  CF+E++V +                      +  IR  I DINDN+P F   V  I I E+  I +K  LP AVD D     + +Y L   ++     + E    D     I  K L   DRE    Y + +   D G P  S    +++ + D NDN P+F+ +   V++ E+   G  +  L ATD D GEN  + + FS+ V++  R+ FH++++TG ++I E LD E+   +   V+A D G   A  +A V V+V D NDN P I + Y+ +    T++      +N + +++ V+D D+ + G V C       F L P  + +   + +     LDYE        ++  D G+P L  S    I ++D NDN+P+F       ++ ENN  GI ++KV ATD DS  N +INY +   +   FS+D  TG +      DREK   Y  ++ A+D G P  + +  V ++I DQNDN+P F        Y F + EN P +  +G I   DPD G N  V  + L   + FTI    G+IR N   DRE +  + F V+  D G + + +S  VT++V+D NDN+P F++P  + +   +      GT+V ++ A+D D G N+ + Y I+ GN+RD     +F +DQ+ G+I L       D+G++ + +  +D G P
Sbjct:  123 IDREKLCAGIPR----DEHCFYEVEVAI---------------LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL---DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPA--RAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---FLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH----NEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791          

HSP 2 Score: 138.658 bits (348), Expect = 3.016e-32
Identity = 128/476 (26.89%), Postives = 210/476 (44.12%), Query Frame = 1
Query: 1570 DAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQK-FILVPPNNREGSTWKINLVE-SLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYF--QGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHP---DQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            D  F    ++  + D NDN P      +  S     I   + IN +Y++    DPD G  G+   +L  SQ  F L      EG      +V+  LD EE++     +   D G PQ +S+   ++ + D NDN P+F+      ++ EN   G  V ++ ATD D   N KI++S    + +++   F ++  TG I  K   DRE+  +++L V A D G       A VL+ +TD NDN P    + +    +    + EN P N  I  I   D D   NG+V   F      F + P   +Q ++     LD E+   +   +   D G      S  + + V DENDN P F   T    +V I   ++ G  + ++ A D D GPN+ ++Y ++  ++  +     F +D++ G + + + L R+    Y+  ++  D G PP  S     + I +    S    + +Y
Sbjct:  149 DEIFRLVKIRFLIEDINDNAPLFPATVINIS-----IPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVT-CFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF---TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPE-----FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEY 607          

HSP 3 Score: 127.102 bits (318), Expect = 1.097e-28
Identity = 151/582 (25.95%), Postives = 238/582 (40.89%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMY-------YFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE-----HPSYHQTV-EENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYI-FEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEP-------RFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI   I D NDN P+F  +   +++ E+        L  A D D G NG+  Y        F  DV         I++  G     L + + LD E+   Y   V   D G     S A ++VSV D NDN P      +  S       G T++ + ++    +D D G    +          I     +   +T  I + E LD EE    + +++  D G   + +     + + D+NDN P  +     +P     V  EN      +  +  TD+D+D NG++    D      F + PV      + +    D E    Y + + A D G+P  + SA + I + D+NDN P F       S++   I EN      +  + A D D G N ++ Y  L P    +F++    G++   ++LDRE +  + F++   D G+    ++V+V VS+ID+NDN P       +F +P N         L   GT V  I   D D G NS +   I+     D+  D  F +D + G I    +  R+    Y   +   D G   R S A   I +
Sbjct:  155 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDV---------IETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVG-TSVTQLHA----TDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT-----QSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPEN---------LPRHGT-VGLITVTDPDYGDNSAVTLSIL-----DENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINV 695          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 319.316 bits (817), Expect = 3.594e-90
Identity = 224/705 (31.77%), Postives = 349/705 (49.50%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTT-INKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC  I +    +  CF+E++V +                      +  IR  I DINDN+P F   V  I I E+  I +K  LP AVD D     + +Y L   ++     + E    D     I  K L   DRE    Y + +   D G P  S    +++ + D NDN P+F+ +   V++ E+   G  +  L ATD D GEN  + + FS+ V++  R+ FH++++TG ++I E LD E+   +   V+A D G   A  +A V V+V D NDN P I + Y+ +    T++      +N + +++ V+D D+ + G V C       F L P  + +   + +     LDYE        ++  D G+P L  S    I ++D NDN+P+F       ++ ENN  GI ++KV ATD DS  N +INY +   +   FS+D  TG +      DREK   Y  ++ A+D G P  + +  V ++I DQNDN+P F        Y F + EN P +  +G I   DPD G N  V  + L   + FTI    G+IR N   DRE +  + F V+  D G + + +S  VT++V+D NDN+P F++P  + +   +      GT+V ++ A+D D G N+ + Y I+ GN+RD     +F +DQ+ G+I L       D+G++ + +  +D G P
Sbjct:  112 IDREKLCAGIPR----DEHCFYEVEVAI---------------LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL---DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPA--RAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---FLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH----NEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 780          

HSP 2 Score: 138.658 bits (348), Expect = 3.290e-32
Identity = 129/477 (27.04%), Postives = 210/477 (44.03%), Query Frame = 1
Query: 1570 DAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQK-FILVPPNNREGSTWKINLVE-SLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQG---LNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHP---DQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            D  F    ++  + D NDN P      +  S     I   + IN +Y++    DPD G  G+   +L  SQ  F L      EG      +V+  LD EE++     +   D G PQ +S+   ++ + D NDN P+F+      ++ EN   G  V ++ ATD D   N KI++S    + +++   F ++  TG I  K   DRE+  +++L V A D G       A VL+ +TD NDN P       +N     +  + EN P N  I  I   D D   NG+V   F      F + P   +Q ++     LD E+   +   +   D G      S  + + V DENDN P F   T    +V I   ++ G  + ++ A D D GPN+ ++Y ++  ++  +     F +D++ G + + + L R+    Y+  ++  D G PP  S     + I +    S    + +Y
Sbjct:  138 DEIFRLVKIRFLIEDINDNAPLFPATVINIS-----IPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVT-CFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF---TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPE-----FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEY 596          

HSP 3 Score: 127.102 bits (318), Expect = 1.211e-28
Identity = 151/582 (25.95%), Postives = 238/582 (40.89%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMY-------YFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE-----HPSYHQTV-EENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYI-FEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEP-------RFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI   I D NDN P+F  +   +++ E+        L  A D D G NG+  Y        F  DV         I++  G     L + + LD E+   Y   V   D G     S A ++VSV D NDN P      +  S       G T++ + ++    +D D G    +          I     +   +T  I + E LD EE    + +++  D G   + +     + + D+NDN P  +     +P     V  EN      +  +  TD+D+D NG++    D      F + PV      + +    D E    Y + + A D G+P  + SA + I + D+NDN P F       S++   I EN      +  + A D D G N ++ Y  L P    +F++    G++   ++LDRE +  + F++   D G+    ++V+V VS+ID+NDN P       +F +P N         L   GT V  I   D D G NS +   I+     D+  D  F +D + G I    +  R+    Y   +   D G   R S A   I +
Sbjct:  144 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDV---------IETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVG-TSVTQLHA----TDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT-----QSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPEN---------LPRHGT-VGLITVTDPDYGDNSAVTLSIL-----DENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINV 684          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 224.172 bits (570), Expect = 1.640e-58
Identity = 194/673 (28.83%), Postives = 307/673 (45.62%), Query Frame = 1
Query:  958 DNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPV--TGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            DNSP F +     EI E   IG  +    A D DS     I Y L E +   L  +     N  S +    ++   P+DRE +S+  L++IA+DKG P       +EI ++D NDN P+F + +Y V + E+     +I  +KATD+D G NG V Y  +S   S       ID STG +++ E +D  K    T  + A+D    A  S   + ++V+D ND+ P +       + K   +E    I +E   V   D DSG  G+++  ++GS+ FI+      +  +  I   + LD E        +   D G P L +S    ++++DINDN+P F+   Y+ T+ E    G  ++ + A D D D   KI Y I+      FSI  +   G I S     + +    ++ + A D G        NV I   D  ++ PYF        +  +I E+ P    + T+ AED D G N +++Y+  S  + F I P  G I  +  LDRE++A     V   D        S  + V + D NDN P+F   T+ S +  IS     GT   ++ AID D GPN  +DY +   +S    Q  +F +D+ +G + +   L R+   V +L +   D+G P   + +   + + +    + T   + Y+
Sbjct:  265 DNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAI-----NAKSGV----IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS---SSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIA-----AQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII------DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED--QKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFI---DDVNSAPYFN----DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQ--LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYD 898          

HSP 2 Score: 204.912 bits (520), Expect = 1.482e-52
Identity = 197/656 (30.03%), Postives = 293/656 (44.66%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINY----SIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQ---GIIR--TNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPR---FVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGN 2880
            ND++P      K I + E++ IG ++    A+DEDS    II Y +E  E  +        + DS +    +K  + +DRE  + Y+L + A D G PSL+    I + + D NDN P F+   Y V + E    G  I+ LKA D D  +    + Y   +   EV     I      LS+S  L  +  K     + A D G      +  V V + D N  P      Y  D      I   + I      +   D D G+   +   +  SQ F + P      S+  I++   LD E+R     I+   D   P L +S + E+I+ DINDNSP F   SY  T+ E+   G   L+V A D D   NG ++Y    S  S S+  F +D  +GT+R     DRE+ A   L +FARD G P+ S ++ + +T++D NDN P F+ L    SY   I EN P  + +GTI A D DEG N  + +      +   F I  D    G++R  T  + D E KA   F       G L   ++V V + V D NDN+P    FVI  N   +V+++        +  I A D D+  N+ L+Y +         ++ +   ++  G I +++   R +M V   K  VSD  N
Sbjct:  473 NDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII-------DEDSGL----IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK---ITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRV-EISATDQG--GLQGRCVVNVFIDDVNSAP------YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDP------SSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQL----SYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL--SSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMA------RQIGFIPAFDPDQ--NATLEYFL--------EENDLIEAEKYTGKILVKQEWKR-NMDVS-FKTCVSDGAN 1075          

HSP 3 Score: 198.749 bits (504), Expect = 1.043e-50
Identity = 200/686 (29.15%), Postives = 311/686 (45.34%), Query Frame = 1
Query:  961 NSPHFSQ-----------PVKTIEISESIQIGAKIPL--PLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF-LSPVEKFTIH--PDQG-IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDST-SVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            N+ HF Q           P++TI  S      +  PL   +   +DS++ N            LFTL       D+   +I  +L + +DRE +  + L + A ++  P++S    + + +LD  DN PIFE  +Y   ++E    G  +L + A D DSGENG + Y          +    I++ +G +  +  LD E +     +VIA D GT    S A V+++VVD NDN P     + +DS   T++E   TI    + V  +D D G  G V   +  S     +     + ST ++ L E +D +   +   +I   D  +P L+S+    I + DIND++P         T+EEN   G  V +V A D DS  NG I YS++      F ID  +G I++    DRE  A Y L V ARD+G P+ + S  + + + D NDN P F        Y   I E  P  + I T+ A D DE  + ++ Y    +  E F+I    DQG I+  + +L R++  V    +   D+G L+    V+V    ID+ ++ P F    ND   SVKI      G  V  ++A D D G N+ + Y I      D +Q   F +D  +GDI +   L R+D   + + +  SD  +PP  +     + +D+    S    +  Y
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQN------------LFTL-------DTMSGEI--RLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGE---GNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPV----FASDSYNVTILEN-ITIPAVIATVKATDEDFGTNGKVHYSMASSSG---IGGLTIDYSTGEVTLRERIDAKNSPITA-VIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD----KKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGRCVVNV---FIDDVNSAPYF----NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI------DSSQ--FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSY 789          

HSP 4 Score: 170.629 bits (431), Expect = 4.292e-42
Identity = 181/645 (28.06%), Postives = 285/645 (44.19%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNG--GLVQCDLKGSQKFIL-VPPNNRE-------GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL-----SP-VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYL-DTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDM 2838
            NDN+P F+     + I E+I I A I    A DED      + Y + +    +  L  ++S  + T       L + ID +N  +  + + A D  +P+LS  + + I ++D ND+ P    +  ++ ++E+   G  +  + A D+DSG NG++ Y      + E  + F ID  +G +  ++ LD E    Y+  V ARD GT +  +  T+ V + D NDN                    PT   KEY++ I  +   G+    L   D    QK    +   +RE       G    I  V      + +  R  I   D+G   L       + I D+N ++P F    +   + E++  G  V+ + A D D   N +I YSID  S  +F IDP +G I      DRE RA++ + V A D   P  + S  + + + D NDN+P F       SY   I E+ P       + A D D G NG V Y FL     SP ++ F +    G +R + +LDRE  AV    +   D+G      +  +T+++ D NDN P F   + D    + S +  T GT+VAR    D DEG N+ + ++I  G        K+F +++      + R LTR + 
Sbjct:  369 NDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-SSGIGGLTIDYSTGEVT-------LRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY------SMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDN-------------------APTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID--SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFT----SSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVAR----DADEGDNADISFRIFGG-----ADAKLFDIEEDAEQNGVVRILTRAEF 960          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 205.297 bits (521), Expect = 1.083e-52
Identity = 197/656 (30.03%), Postives = 293/656 (44.66%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINY----SIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQ---GIIR--TNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPR---FVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGN 2880
            ND++P      K I + E++ IG ++    A+DEDS    II Y +E  E  +        + DS +    +K  + +DRE  + Y+L + A D G PSL+    I + + D NDN P F+   Y V + E    G  I+ LKA D D  +    + Y   +   EV     I      LS+S  L  +  K     + A D G      +  V V + D N  P      Y  D      I   + I      +   D D G+   +   +  SQ F + P      S+  I++   LD E+R     I+   D   P L +S + E+I+ DINDNSP F   SY  T+ E+   G   L+V A D D   NG ++Y    S  S S+  F +D  +GT+R     DRE+ A   L +FARD G P+ S ++ + +T++D NDN P F+ L    SY   I EN P  + +GTI A D DEG N  + +      +   F I  D    G++R  T  + D E KA   F       G L   ++V V + V D NDN+P    FVI  N   +V+++        +  I A D D+  N+ L+Y +         ++ +   ++  G I +++   R +M V   K  VSD  N
Sbjct:  114 NDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII-------DEDSGL----IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK---ITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRV-EISATDQG--GLQGRCVVNVFIDDVNSAP------YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDP------SSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQL----SYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL--SSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMA------RQIGFIPAFDPDQ--NATLEYFL--------EENDLIEAEKYTGKILVKQEWKR-NMDVS-FKTCVSDGAN 716          

HSP 2 Score: 191.045 bits (484), Expect = 1.976e-48
Identity = 161/568 (28.35%), Postives = 261/568 (45.95%), Query Frame = 1
Query: 1270 IEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPV--TGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            +EI ++D NDN P+F + +Y V + E+     +I  +KATD+D G NG V Y  +S   S       ID STG +++ E +D  K    T  + A+D    A  S   + ++V+D ND+ P +       + K   +E    I +E   V   D DSG  G+++  ++GS+ FI+      +  +  I   + LD E        +   D G P L +S    ++++DINDN+P F+   Y+ T+ E    G  ++ + A D D D   KI Y I+      FSI  +   G I S     + +    ++ + A D G        NV I   D  ++ PYF        +  +I E+ P    + T+ AED D G N +++Y+  S  + F I P  G I  +  LDRE++A     V   D        S  + V + D NDN P+F   T+ S +  IS     GT   ++ AID D GPN  +DY +   +S    Q  +F +D+ +G + +   L R+   V +L +   D+G P   + +   + + +    + T   + Y+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS---SSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIA-----AQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII------DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED--QKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFI---DDVNSAPYFN----DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQ--LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYD 539          

HSP 3 Score: 170.629 bits (431), Expect = 4.141e-42
Identity = 181/645 (28.06%), Postives = 285/645 (44.19%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNG--GLVQCDLKGSQKFIL-VPPNNRE-------GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL-----SP-VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYL-DTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDM 2838
            NDN+P F+     + I E+I I A I    A DED      + Y + +    +  L  ++S  + T       L + ID +N  +  + + A D  +P+LS  + + I ++D ND+ P    +  ++ ++E+   G  +  + A D+DSG NG++ Y      + E  + F ID  +G +  ++ LD E    Y+  V ARD GT +  +  T+ V + D NDN                    PT   KEY++ I  +   G+    L   D    QK    +   +RE       G    I  V      + +  R  I   D+G   L       + I D+N ++P F    +   + E++  G  V+ + A D D   N +I YSID  S  +F IDP +G I      DRE RA++ + V A D   P  + S  + + + D NDN+P F       SY   I E+ P       + A D D G NG V Y FL     SP ++ F +    G +R + +LDRE  AV    +   D+G      +  +T+++ D NDN P F   + D    + S +  T GT+VAR    D DEG N+ + ++I  G        K+F +++      + R LTR + 
Sbjct:   10 NDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSS-GIGGLTIDYSTGEVT-------LRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY------SMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDN-------------------APTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID--SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFT----SSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVAR----DADEGDNADISFRIFGG-----ADAKLFDIEEDAEQNGVVRILTRAEF 601          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 180.259 bits (456), Expect = 5.709e-45
Identity = 190/680 (27.94%), Postives = 307/680 (45.15%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLEN---HEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPI--FEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGK---INYS-IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARD-----LGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-----PVEKFTIHPDQGIIRTN--QQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSA 2931
            N +SP FS   + +E++E   IG  +    A DED+     I Y + +     H + T+  +  + + T+     KL++  ++  V    L + A D G P  S    ++++I D N++ P F+  +Y + + E+E  G  I  + A D D G NG + +   ++   E      ID+ TG + + ++LD E    +TF +IA D G     S   + +SV D NDNPPK  +++        L  G        S +   D D G    ++  L   +    +  ++  G  +       LDY +       I   D G+P L++S    + + DI  N     F+  +   +V EN++ G  V+ + A +   +   K   + Y  I      +FSID   GT+R+    DRE +++Y ++V ARD       +P +    +V I I D+ND+ P  +       YI  + EN P+N +I  + A D D+  N              P   F I    G I T+  ++LDRE ++ HE  V + D G  +  ++V V V+V+DENDN P F    +   SV+  +   AG L  RI A+D DEG N+ L Y I  G++R        F    NG+I    A+   +   Y L +  +D G P ++  A  V+   NSA
Sbjct:  602 NKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTV--DEQSGEITVASDLSKLMK--EKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNN--QEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFV-----SCMAAFDEDIGQNSKLKFLLNSEKVPFRI--DHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQ-KGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAK----KPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIH-HYSVRSKF---AGKL-CRIFAVDADEGENARLTYNITEGDAR--------FSIDNNGNIIASEAIHGDES--YALTVQATDHGTPGQQFAATRVVLTANSA 1248          

HSP 2 Score: 130.568 bits (327), Expect = 6.567e-30
Identity = 144/550 (26.18%), Postives = 247/550 (44.91%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIG--AKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFS-SDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK-----GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGK-INYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPD-EGINGQVLYTFL-----SPVEK---------FTIHPDQGIIRTNQQLDRENKAVHEFSVRVID 2532
            NDN P   + +  + I E++     A+  +   V ED+ +F+ I +R+ +    LF +          IN + + +++P+D E +  +NL ++A+D        K  I + ++D NDN P FE STY + V ESE  G+ +   +A+  D  +N  + YY   SDVTS V    ++++ TG L++++ LD+E +      V+A+DSG     ++A V++SV+D NDN PK   E      K     G   +      V   D DS + G V  +L+      +   +L    N  G    + + +S+DYE+       ++  D G P L S    EI + D ND++P F+  +    V+E    G  +LK   +D D   NG      I       F ++     + +K   +  K+  Y L+V A+D+    ++    + I I   + + P  + +           +N     IIG + A D D E  NG + +  +     SP  +         F + P+ G I ++  +    + +H F+V V D
Sbjct: 3005 NDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDA-DFDEIKFRMVDDFGGLFQI--------DDINGV-VTVVKPLDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVTSFV----NLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLT-----VKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGD---VLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLELLTAK-KLEYRKKDKYLLTVIAKDV--KGKTTDCPLTIFIRQTSRHAPTMKPMK----IQINTLQNELPEGIIGRLKASDEDEEDQNGLLRFGLVEGSIQSPRAQVQESRSTHLFRVDPNTGDIWSDHSI---TQGLHTFNVTVTD 3517          

HSP 3 Score: 126.331 bits (316), Expect = 1.251e-28
Identity = 166/661 (25.11%), Postives = 287/661 (43.42%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKN-----FNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENV----SMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFS-------SDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-----DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            ND  P F +   + +IS+S   G  I +  A D D+ N        + Y++ + +  LF + P             L L +P++++++    +   LN+  TD G  +   KL +EI    +    P FE S Y+ N  E+ I     LL  A      + G+    FS       +  TS+      ID  TG + +S  L+Y + K Y   ++  D+    AFS  T+ +SV+D ND PP   L + + S   +  EG T       +++ +  D  N  +    L GS+ +F  V P  R+G+   I + + L+++        I   D   P   ++   E+ I   +   P F +  Y  +V E+   G V+ +V   + + D   +I ++I     +S S   FS++  TG I  K S DRE++  +++++ A   G         V + I D NDN P F     G    F I E+      +    A D D+  +G++ ++ +     F ++ + G +    QLDRE    ++   R  D+G    +   ++ VS  D ND+ P+F     +  ++ +    T+  L   I+  D D  PN+   + I  GN     ++ +F++D  N D+ L+R    ++   Y LK+   D
Sbjct: 2279 NDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGE---------LSLARPVEQDDLVNEDTKKVLNVSVTD-GMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAV-----KGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFS--TLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTV------MMVSATDDDENDTIEYSLLDGSESQFFSVHP--RQGT---ITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEID---EIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAG--GVHAITTVTVDIGDVNDNAPAFH----GDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVVS--DVNDSPPQF---EKEEFNIDLHLPSTSPILHFSIK--DDDLSPNNVSQFFIPKGN-----EEGVFWIDS-NNDLLLKRPEIVENKMQYQLKVTAFD 2889          

HSP 4 Score: 121.709 bits (304), Expect = 4.050e-27
Identity = 143/598 (23.91%), Postives = 246/598 (41.14%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSG-----ENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKV----KYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVP-------------PNNREGSTWKINLVESLDYEERNVERFIIVCHD----RGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS-IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK------FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            +D E    Y+L L+AT  GK  +S + +  + I D ND  P F  S     + +S I+G  I ++ ATD D+      E+  ++Y     +       F+I  +TG LS++  ++ + +         NV   D G   A++K  V++        PP+     YV ++ + T+      +NK   + +     +  GG+         +F L P             P   +  T +I++   L+Y      +  +V  D    R    LT S      + DIND  P F  P Y  ++ E+ + G  V+ V ATD D   N  I YS +D     +FS+ P  GTI      + +   +  L++ A D   P    +  V + I  ++   P F        Y+F + E+     +IG +   + +     ++ +T +   E+      F++    G I     LDRE K   + ++R    G +      +VTV + D NDN P F     D     IS     GT V    A+D+D+ P+  + + ++  N         F +++ +G + +   L R+ +  Y L    +D+G
Sbjct: 2244 LDYEKTQKYDLKLVATSSGK-QVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLY----KIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTD-GMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTI------VNKSALLTV-----AVKGGVPPL------QFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFSTLTLS------VIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRF----SNSHYLFSVMEDADVGNVIGRVQQMETE---IDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHA--ITTVTVDIGDVNDNAPAF---HGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENP-------YFDLNENSGWLTVASQLDREKIDHYKLIARATDEG 2791          

HSP 5 Score: 121.324 bits (303), Expect = 4.119e-27
Identity = 155/608 (25.49%), Postives = 256/608 (42.11%), Query Frame = 1
Query: 1207 MYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFE----NSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVI------ARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGP--------TTINKEYSIVIVSDPDSGNGGLVQC---DLKGSQKFILVPPNNREGSTWKINLVESLDYEERNV--ERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQ---QLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA-GTLVARIEAI---DKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQ-----GNPPRKSYANYVIKI 2919
            +YN  +IA+  G      +  + I+ILD+ND+ P+F       T IV  K     G +++ + ATD+D GENG ++Y F+S++  E      I+++TG +++ E          T   I      +R S  +  F K   K+        P  I ++   +         P          I    + +  +D D+G  G ++    D+ GS   +L   + + G     + +  L  E+  V   +  +   D G P  +S    ++ I+D+N++SP F+  SY+  + EN + G  + KV A D D   NGKI +S+  +    S  SID  TG ++   S DRE +  +  ++ A D G P +    N+ I++ D NDN P     +        I E+ P  A +  + A D D G N ++ +   S    F I    G I  +     LD         S+ V D G      S  + V ++D   N     I  +D       Y ++  GT V  IEA    D+ +    +L+Y+II G+         F +DQK G +     L R+    Y + +   D       +P R+   +  I+I
Sbjct:  457 VYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGK----PGDVLVKVDATDQDEGENGKIVYKFTSELPLE------INANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPA-----KPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLT-VDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRA----RIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHN--HLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPH-----FSIDQK-GTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRI 1036          

HSP 6 Score: 120.553 bits (301), Expect = 7.302e-27
Identity = 168/681 (24.67%), Postives = 285/681 (41.85%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARD----SGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEE-RNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEEN----NQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFT-IHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQ--IISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNN 2955
            NDN+P F    +   ISE   +G  + +  A+D D       S R+       F+L+ E   FD   N  +L +   +DRE +  Y L   ATD+G    +  L   I + D ND+ P FE   + +++     S   IL     D D   N +  ++        V   F IDS+   L     +   K++Y    V A D    + T    +  + K S + C +    + L    +S K T++ G +++        +SD D GN  +V               N R G   K+   + +DYE+ + +E   +   D  E          ++I ++NDN P         +++EN      A   + ++VA D D D   +I + +       F ID + G +      D E    + L+V A D GE      A +L+T+ DQNDN P F+      +Y  ++ E+      +    A   D+    + +  +L P  V  F  ++   GI+   + LD E  +  + +V   D G+   E    V +SV+DENDN P+F     +    K+     +G  V  ++A+D D      + Y+  I+S  + D     + F    NGD+ + +++  + +  Y LK++  D G PP +S A   I +++    + T ++
Sbjct: 2706 NDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSP----SGRIR------FSLVEENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSP--ILHFSIKDDDLSPNNVSQFFIPKGNEEGV---FWIDSNNDLLLKRPEIVENKMQY-QLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKTVIL--AENSKKGTVVLGESSLLGPNVTFKLSDND-GNVFVV---------------NFRNGIV-KVKESDQIDYEKNQQLEFHRLTIQDNSE---VCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFD---EIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASD-GE--FEDKATILVTVIDQNDNAPTFEK----STYSMKVMESESIGYELAHFRASGGDQN---ETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF---EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPV--LPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDD 3328          

HSP 7 Score: 108.612 bits (270), Expect = 3.139e-23
Identity = 150/577 (26.00%), Postives = 250/577 (43.33%), Query Frame = 1
Query: 1303 QPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFI-IVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREK-RASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGT-------IHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVS--VTVSVIDENDNEPRFVIPTNDSTSVKISY-LDTA-GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDM-GVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQHAT 2985
            +P F  S Y  +V E    G  I  LKA+ +  G   LV   FS D  + +  K  ++ S+G + + E LDYE  +     V  + +      S AT  V++ D NDN P     Y         ++   T++   + V   D D G  G+V   +    +  L   + + G   ++ L + LD E ++VE  + I   D     L       I   +    +  F+   Y  T+ ++ + G  VL + A       +G ++Y ++  + ++F +  ++G +       + K R S + +          Q   A V+  I   N ++P F+     G+    I+EN P+ + + +       + A D D G NG V Y  LSP ++  F++    G IRT    D E    + F V+  D G   + + +   + V+VIDEND  PRF  P+N   S+ IS  L TA G  V    A D D      L Y I     +DQ+    F +D K GD+ ++ +    DM  ++ L++ V+D      K  A+YV+KI   +  +   +  K+ +N++ T
Sbjct: 1360 RPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVA-MEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQANMK---SFATFSVNINDENDNSP-----YFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSG---EVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALH-----HGTVSYKLEP-NCTFFEVHTLSGAVHLATWLTKLKHRKSVECTAIVE--STEGQQDIAKVIAKIIRTNQHSPIFRRQVYRGT----IRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRF--PSN---SLDISMILPTANGVSVGGQTAQDMDS--VGSLRYFI-----KDQSVP--FSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTDG-----KQSASYVMKISTISTEN---SKFKFTRNEYHT 1890          

HSP 8 Score: 92.4337 bits (228), Expect = 2.641e-18
Identity = 94/350 (26.86%), Postives = 152/350 (43.43%), Query Frame = 1
Query: 1951 DINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSA----------------NVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL----SPVEKFTIHPDQGIIRTNQQLDRENKAVHE-----FSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            D ND++P+F      QT     + G V++KV ATD+D   NGKI Y     S     I+  TG I   +    +K  S+  +V+A DLG P    SA                  +I    +N ++P F         I E+ E+ P   ++  + A D D G NG + Y       S  E  T+    G I     L +  K   E       V  ID G   + +  ++ + + D N++ P+F      S  ++IS  +  G  + ++ A D D G N  + + +  GN  +Q +  +  +D K G + L ++L R+D  V+   ++ SD+G P R S  N  I +++
Sbjct:  484 DSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKF--TSELPLEINANTGEI--TLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSF----PEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQF---DEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSL--GN--NQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVED 818          

HSP 9 Score: 76.2554 bits (186), Expect = 2.325e-13
Identity = 157/683 (22.99%), Postives = 262/683 (38.36%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDAND---------NQP---IFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYL-EYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDRE-KRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVR--VIDKGILRQENSVSVTVSVIDENDNEPRFV-----------IPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            NDNSP F+Q +    +    +   K+    AVD D      ++Y +   + A F++       D+  N I  + +   +      Y L + ATD G P    +      +L AN          N P     + S Y++ + +++  G  +  L+A+D D  E   + +  SS     V   F +   TG L +++ ++  K      N+   D     A+  +TV + V       PK     Y TD  +R  +       K     + + P   N  L   D    +  I V P     S+  + ++E LDYE     R ++      +  + S     + I D NDNSP F   +    V+E++    V+  V A D+D   NG + YSI S +  S F ID  +G +R     D E +     L + A D    +     ++ I  +++   T  F       + +++    G    ++  +H        +G V Y        F +H   G +     L    K  H  SV    I +    Q++   V   +I  N + P F            +PT  S   K         L   + AID+D G N  + Y+++S        +++F +DQ +G I  Q +   + M  Y   +   D G PPR+S    +I +
Sbjct: 1150 NDNSPTFTQAIHHYSVRS--KFAGKLCRIFAVDADEGENARLTYNITEGD-ARFSI-------DNNGNIIASEAIHGDES-----YALTVQATDHGTPG--QQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDE---LWWSISSGDPDSV---FDVRQDTGQLLLAKKVELLKRGELRLNISVTDG---QAWDHSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFN--LFSVDDVAMEDKIRVEP-----SSGNVIVMEPLDYEAARRIRAVVQVQ---QANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFD-RKVYQTTLYDSTRPGTPVLVLNALH--------HGTVSYKLEPNCTFFEVHTLSGAVHLATWL---TKLKHRKSVECTAIVESTEGQQDIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSK-------SLLPLVVSAIDEDPGSNGLVGYRMLSPK-----DEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVV 1772          

HSP 10 Score: 76.2554 bits (186), Expect = 2.384e-13
Identity = 157/700 (22.43%), Postives = 280/700 (40.00%), Query Frame = 1
Query:  961 NSPHFSQPVKTIEI-SESIQIG--AKIPLPLAVDEDSKNFNIISYRLENHEHAL----FTLIPEWSNFDS--------TINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSG---TDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKIN----LVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTV--EENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTP-YFQGLNGGGSYIFEIKENGPSN----AIIGTIHAEDPD-EGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFF--MDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            N PH +     + I SES+++   +      +V ED+   N+I  R++  E  +    FT++P     DS        +  +I +K    +DRE  + + + + A   G   +     + + I D NDN P F        + E    G  + +  A D+D   +G + +        E    F ++ ++GWL+++  LD EK+ +Y     A D G   TD  F+     + V D ND+PP+   E          +  P+T +      I  D  S N          SQ FI  P  N EG  W  +    L++  +  E  ++  + V    G  + ++  +  +     +D       P  ++TV   EN++ G VVL        S L   + + +     + F ++   G ++ K S   +   + QL      + + ++     + + I + NDN P   + L         I EN P++      I  I AED D + I  +++  F      F I    G++   + LD E       +V   D      E+  ++ V+VID+NDN P F      + S+K+   ++ G  +A   A   D+  N  ++Y +       +  D   F  ++ + G + L + L  + +    L ++  D G PP ++ A   I + +    +      KY
Sbjct: 2585 NPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIG-RVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVK--SSLDRERKNQWKMTIRADAAG--GVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLV-----EENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFT-----IVVSDVNDSPPQFEKEEFNID-----LHLPST-SPILHFSIKDDDLSPNNV--------SQFFI--PKGNEEGVFWIDSNNDLLLKRPEIVENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSD----IRCPEANKTVILAENSKKGTVVL-----GESSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKL-----LKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGG---LFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEF---EDKATILVTVIDQNDNAPTF---EKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYL-------KPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKY 3221          

HSP 11 Score: 55.8398 bits (133), Expect = 3.153e-7
Identity = 74/306 (24.18%), Postives = 135/306 (44.12%), Query Frame = 1
Query: 2116 FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKG----------ILRQENSVSVTVS----VIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQI--ISGNSRDQTQDKIFFMDQKNGDIFLQRALT---RQDMGVYILKMMVS--DQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            F+I    G +R     +R +R  Y   V A   G   +    +V I I D ND+ P F       + I      G    ++  + A D DEG NG+++Y F S  P+E   I+ + G I   +   + N      +V  ID G          ++  +N   +       +I E++N+   V  +     V+++     GT+VA+++A D+D G N  + Y I  I+G+S +     +  +D+++G+I +   L+   ++ + V  +++ VS  D G P + S     ++I +    S   + + Y
Sbjct:  436 FAIGSKNGILRVSAKINRSERV-YNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIV----IGKPGDVLVKVDATDQDEGENGKIVYKFTSELPLE---INANTGEITLVEVPKKGNS--WPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEI-VEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHE-----VLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSY 725          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 175.252 bits (443), Expect = 1.808e-43
Identity = 179/660 (27.12%), Postives = 284/660 (43.03%), Query Frame = 1
Query:  967 PHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPP-----KIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPR------FVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYV 2910
            P F + +  +EI E   IG  +   +A +    N   I Y L+N +  L          D+    + ++  +  D E    Y   +IAT+    + +  + I +K  D NDN PIF  + Y + V+E       +L++ A+D DSG  G V Y+  S+ +S     F I+  TG +   + L   +   +   V A+D G  ++ + A + ++V+D +   P     K  +    D      I     ++K    +   D D         D    + ++    +     T  +N+  +L   E N  + +I   D                   NDN P F       ++ E+ +       V A+D+D   NG++ YSI  S   S   ID  TG + +    D E   +Y+L V A DLG P +S +  + I + D NDN P F+       Y  E+ EN P   I+G + A D D   NGQ++Y   +  E F I    G + T + +DRE  +  + S+   DKG+  + ++ S  +SV+D NDN P        V+P     S  I      GT+V    A+D D+G N  + Y       R Q Q  +F + + NGD++L+R L   D     L ++VSDQG  PRKS   +V
Sbjct:  538 PQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHL--------TVDTMSGTVCIQ--KTFDFEKQKSYQTTVIATNANSETSTSLISIRLK--DVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS-----FSINPVTGEVFAQKPLARGR---FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHN----FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDH------------------NDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEK----SWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAI------GTIV----AMDPDKGLNGSVLY-------RAQLQSSLFVV-KSNGDVYLRRQLNASDERHQRLSVIVSDQGV-PRKSVVCHV 1132          

HSP 2 Score: 152.14 bits (383), Expect = 1.715e-36
Identity = 174/672 (25.89%), Postives = 282/672 (41.96%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYR-LENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVS-VTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            NDN+P F+  V  +EISE  Q+G    LP   D D   F++  +  L+ + + +F L     N      Q  L +   +DRE    Y L + A D GKP+  G+L+  I+I+DANDN P+F  S Y  +V  +   G  ++ ++ATD D GEN  + Y      ++     F I  S     I+ T        +   V+A D G+ +  S A V ++V+    + P + + ++ +S    L+E  T  +    + I            +  L GS    L P    +   + + L   LD E  +      +    G  Q+   H + + I DINDN+P +     H ++    Q G   L   A D D   NG I YS+  L     SID  TG I    + D    +  +  V A D G PA S    V+  + D     P F+       +  EI E+ P    +  + A +   G + ++ Y+  +  E  T+    G +   +  D E +  ++ +V   +      E S S +++ + D NDN P F  P     +V+         LV  + A D D G    + Y I+S +S        F ++   G++F Q+ L R   G + L +   D G    ++ AN  I + +   ++   +  KY
Sbjct:  116 NDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQL---QADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKK-TSAPSNSNFAISQSG---VITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRD-----TKLRLIGSSA--LCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDG--QIIIEHPQLLTIGDINDNAPQWHSSQIHISLNR-TQGGSRTL--TAKDPDLGQNGWIRYSV--LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFE----KALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNA---NSETSTSLISIRLKDVNDNWPIFY-PNEYHLTVREGPKPEEPLLV--VSASDMDSGTFGEVSYHILSESSS-------FSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKY 746          

HSP 3 Score: 146.747 bits (369), Expect = 6.973e-35
Identity = 163/582 (28.01%), Postives = 255/582 (43.81%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAV----DEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSV----IDENDNEP--RFV-IPTNDSTSVKISYLDTAG 2667
            NDN P F      + + E    G K   PL V    D DS  F  +SY + + E + F++ P          ++F +  +P+ R     ++L + A D G  S      I I ++D +   P F  S Y +   E  + G  I  + A  K       V Y   S    +    F ID  TG + ++  LD +       N+ A     ++  ++  V + + D NDNPP+     V  S +  L      +++ + +V  SD D    G V+  +  S     +  +   G     +L   LDYE     +  +   D G P  +S+    I + D+NDN+P FE   Y   V EN+    +V KVVA D+DS  NG+I Y I + S  YF ID   G + +K S DRE  +   +S+ A D G P +S +A+  I++ D NDN P    +         +    P +  IGTI A DPD+G+NG VLY        F +  + G +   +QL+  ++     SV V D+G+ R+     V V +     D    EP  +++ IP +  T  +++ L+  G
Sbjct:  635 NDNWPIFYPNEYHLTVRE----GPKPEEPLLVVSASDMDSGTFGEVSYHILS-ESSSFSINP-------VTGEVFAQ--KPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK-------VKYSIYS---GDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGES--NQTQVVIFIEDHNDNPPQFSSSLVEISIREDL-----KLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSL---LDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGS-EYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITP-----IVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSN-GDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQEPFQKYIEIPKSCPTGCRLTTLNATG 1172          

HSP 4 Score: 142.51 bits (358), Expect = 1.651e-33
Identity = 151/576 (26.22%), Postives = 258/576 (44.79%), Query Frame = 1
Query: 1228 ATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYL-EYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVER----FIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSY-FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI--KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQ--GIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA--GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            A D G P+LS  L++   +LD     P FE + + V + E    G  ++ + A +   G +  + Y   +       +   +D+ +G + I +T D+EK K Y   VIA ++ ++ + S  ++++   D NDN P  Y  EY       T+ EGP    +   +V  SD DSG  G V   +              E S++ IN V    + ++ + R     ++   D G     +S    I + D +  +P F    Y     E+   GI +  V A         K+ YSI S    + FSID  TG I      D +   +  L++ A       +S    V+I I D NDN P F       S + EI  +E+   +     + A D D+  NG+V Y+ +S     +I  DQ  G + T   LD E    ++  V+  D GI  + +++++ + V+D NDN P F     + +   +  L+ +   T+V ++ A DKD   N  + Y+I +G+       + F +D+K G+++ +R++ R+ +    + ++  D+G PPR S A+  I +
Sbjct:  512 AEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQ-----DEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLK--DVNDNWPIFYPNEY-----HLTVREGPKP-EEPLLVVSASDMDSGTFGEVSYHILS------------ESSSFSINPVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-------SKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQAT--LPSGESNQTQVVIFIEDHNDNPPQFS------SSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF-----EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGS-------EYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISV 1035          

HSP 5 Score: 107.457 bits (267), Expect = 7.635e-23
Identity = 147/575 (25.57%), Postives = 253/575 (44.00%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE-YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFI--IVCHDRGEPQLTSSHXXXXXXRDIN-DNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQ----QLDRENKAVHEFSVRVIDKGILRQE--NSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            +DRE +  Y+L +I T  G+       ++++++ + NDN P F  S     V E+   G  +  + A D D+     + Y+  SD + +    F+ID  TG + ++  LD+E +  +T  + A D   D  F+  T+ VS  D NDN P      Y T     T   G     + ++ +   D D+  G L     +GS     V P +  G+ +   L  +        ER++  +   D G P  ++S    +II +    + P FE   +   V EN++ G+ +  +   +     + + +Y I D  +   FSID   G +      DRE+RA+++  V   +    +Q       + + D+NDN P F  +    +Y   +K++      IG I A D D G NG+V Y  LS   +   T++PD G I+ N+    QLD    A  +  V   D G   +     V V++ +   + + P FV+P  +   V +    + GT++ +I A ++    N  L Y      S  + Q K+  +D K G++ L+  L  +   +  + + VSD
Sbjct: 1888 LDREILERYSLKVIGTGSGQ---QIGTRVDVRVNNLNDNVPSFPMSKP-RRVPENLRVGSYVATVGAKDVDN--LAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFD-TFTNLTIFVS--DINDNAPTFSKPLYQTTVSPATFSPG-----QPFAKIEAHDLDA-RGALTYSLGQGSSSIFRVAPES--GALFMKVLPPA-------GERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEE-----SREFHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSV----AYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYE---VHVLEDTSVGTVLQKIRASNRLGMRNDGLLY------SLKEHQGKL-GIDVKTGELTLKTHLDWESEPIISMYLSVSD 2418          

HSP 6 Score: 88.9669 bits (219), Expect = 3.063e-17
Identity = 163/679 (24.01%), Postives = 287/679 (42.27%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEIS-GHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKV-----KYYTFNVIARDSGTDAAFSKATVKVSVV----DCNDNPPKIYLEY---VTDSGKRTL----IEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIR----SKISFDREKRASYQLSVFARDLGEPAQS--GSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            NDN P F    K   + E++++G+ +    A D D  N   + Y L +         P   N D     I L    P+D E +  + L + ATD    S      + I + D NDN P F    Y   V  +  S G     ++A D D+   G + Y      +S     F +   +G L       + KV     + Y   V A D+G   +FS  +V VSV+    +  D P     E+   V ++ K  L    + G  +    Y I    DP++    +   D K  + F+  P +  + +T +  +   +D E    ++    CH              +I+ D NDN P+F   +Y+ +++++   G  + +++A+D+DS  NG+++Y I S + ++  +++P TG+I+    +    D    A++Q+ V ARD G PA++  G   V + ++  + + P+F        Y   + E+     ++  I A +     N  +LY+      K  I    G +     LD E++ +    + V D         + + V  +DE    P F   T  S +++I     AG  V +++AID+D G +  + Y I    S  Q+  KI   ++  G I LQ+ L  +   + I ++ V    +P ++S     ++I
Sbjct: 1921 NDNVPSFPMS-KPRRVPENLRVGSYVATVGAKDVD--NLAPLRYFLVSDSSGQ---TPTHFNIDQFTGTIHLT--APLDFEVLPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSS----IFRVAPESGAL-------FMKVLPPAGERYLVTVTATDNGV-PSFS-TSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRI---QDPEASK--IFSID-KFGRLFVAGPIDREQRATHEFQV--EIDNEMMTSQKVQCKCH--------------VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFV----LPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVDE--FAPVF---TKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSI----SDRQSTVKI---EEHTGIIRLQKPLVSR-RNLTIEQITVVAYSSPTKQSKTTVYLEI 2534          

HSP 7 Score: 55.0694 bits (131), Expect = 5.282e-7
Identity = 75/325 (23.08%), Postives = 131/325 (40.31%), Query Frame = 1
Query: 1999 TVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQL-SVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGIN------GQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLN 2952
            TV E+ Q G  +  +     +S          D  +  +  +D  +G I +    D EKR+ + + +V   + GE     + ++L+ + D+NDN P F         I E  + G S A+      + P   ++      G V   F     K      Q  +  N QLDRE +  +E  +   D G   +   +  ++ +ID NDN P F   +    +  +S   + G+ +  ++A D D G NS + Y I   ++   +     F   ++G I    +L       + + ++ SD G+P   S A   I +  S   S  L+
Sbjct:   30 TVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGE-----TIDILVEVDDENDNAPSFAD-QVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVN-EQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF---SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSN----FAISQSGVITTTASLL--PASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLD 338          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 138.272 bits (347), Expect = 3.101e-32
Identity = 175/652 (26.84%), Postives = 280/652 (42.94%), Query Frame = 1
Query:  955 NDNSPHFSQP----VKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNG-KINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARD-LGEPAQSGSANVLITITDQNDNTPYF-QGLNGGGSYIFEIKEN-GPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF--VIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKI-FFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            ND +P F       +K +E  +++     I   +A D D     +++Y + +   +LF +       +ST   I    L P+DRE  S++ L + A D G PSLS   KI I + D NDN P FE S+Y + + E+   G  I+ + ATDKD  ++  + Y   S+   E+   F I+ +TGW++++  ++ E+ + + F V   D       SK  V++ V D NDN P I      D      +  PT   +   ++ V D D  +            KF L   N       +I L   L   +  V   + V  D G              +      P+F       +V E+++  + V K          NG  I YSI S    +  ++  TG +++K S D E+ +   + + A         S      I I D NDN+P F Q L     Y F + EN GP   +IG + A D D   + +V Y  +      +F +  + G I + + LDRE K+ +   V  ID G  R+  + +V V+V+DE+DN PRF  +        V+I      G  V ++ A D DE  N   +         D   + I F +D+  G +F+  +L  +    Y +K+ ++D
Sbjct: 1642 NDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAV-------NSTTGDILS--LIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKD--KDAELQYSLESN--DEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDGEKS---SKVIVEIHVEDFNDNHPMI-----NDRNSDIFVPDPTRSVEIIHVINVHDLDKSD----------HLKFSLNNSNLNLSENGEITLKSPL---QTAVPVRVTVSDDAGHVAFMEYLFHPHSRKHF----PVFVEKLDTVSVREHDEQELAVFKA---------NGDSIRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQL-----YRFNVTENSGPK--LIGHVIARDIDR--SSRVFYEIVGGDANHEFMV-TESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRIFHVEVPEDVRI------GEPVIQLSASDADEHSNHRFEL--------DGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTD 2222          

HSP 2 Score: 100.523 bits (249), Expect = 8.311e-21
Identity = 158/682 (23.17%), Postives = 277/682 (40.62%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDED-SKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMY-YFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREG-----STWKINLVESLDYEERNVERFII--VCHDRGEP--QLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQG----LNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVI----PTNDSTSV----KISYLDTA--GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            NDNSP F   V+ +EI E+  IG ++ +  A D D  KN  I  Y L +    + T+ P       +   +FL++   +DRE   +Y++ L A D+G P LS    + I ILD NDN P F   +  +N   + +    +  L ATD DS EN L+ Y    S  TSE+   F I      ++ + T   E ++   F V ARDSG     +   + V++   N++ P I + +        +++      K  +I+ ++D D   G L      G+   I +   N +      S   IN++     E  N E++I+    +D   P  ++T    +    + +       E  S H TVE++   G  V  V       + N     S +  +   F IDP  G I +  S   E   SY L +         Q   A+V + +  ++      +     ++   +Y F   ++     +IG +             +Y+ +  V +  + PD  +                     + K I    + V++ V++++ N  +   +     P N  + +    +I  L+ A  GT+  RI+A D+D G +  + Y+I+   ++    D IF +D  +G +   +A   +    Y  +    D G P + +     I I++
Sbjct:  111 NDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSP--FGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLTLN--WNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEM---FSISDENILVTQNNT---ECLQRCEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYPSDYPFIIVQPEDVNGKTLAILSITDSD---GPL------GANSTIWIENGNEQSIFSLISRQSINILTVKHVENANQEQYILEFRANDGQSPADRITRKELKIFFKKYVKSTQIHVERES-HVTVEKDTVPGSFVAHV-------ETNCTDMCSFELANSDVFKIDPFNGIIVTS-SILPEGVTSYHLPIRIHLPPPSTQLVEADVFVKVIQESVPKNLIRSSESPIHLKRAYTFTTWQDVSLGTVIGRLPKAQ---------IYSTIDTVSELGVFPDGSVF--------------------VGKTI--TSDFVTLPVTLVNRNTTQTSIITLIVKPLNQHSPICQITEIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKIL---TKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIED 730          

HSP 3 Score: 91.2781 bits (225), Expect = 5.898e-18
Identity = 103/383 (26.89%), Postives = 169/383 (44.13%), Query Frame = 1
Query: 1441 VTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIAR---DSGTDAAFSKATVKVSVVDCNDNPPK----IYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQ-CDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGII-RTNQQLDRENKAVHEFSVRVIDKGILRQENSV 2562
            + S       ++ STG L    +LD E+       +IA    D+   +  +KAT+K+  VD NDN P+    +Y   VT++       GP  I      VI  D D  +    +      + +F++         + +I  V  LD E ++    I+   D G+P+   +    + + D +DN+P F    +H  V E+ + G  V+++ A+D D   N +         +  F +D  TG +    S D EK+ SY++ V    L + A     ++ + + D NDN P F+       Y+F  +EN   +A IG  HA D D   NG++ Y+  SP   F I P  G++ R  QQL    + +    V   D G+ R + +V
Sbjct: 1979 IVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKI--VDINDNSPRFDQQLYRFNVTENS------GPKLIGH----VIARDIDRSSRVFYEIVGGDANHEFMVT-------ESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSR-IFHVEVPEDVRIGEPVIQLSASDADEHSNHRFELDGGGEGIP-FRVDENTGMVFVNDSLDFEKKQSYRIKV---KLTDGAWLIETSLFVNVKDVNDNAPIFEK----PEYLFISEEN---SAEIGQFHASDMDSENNGKIRYSVTSPY--FKIEPSTGVLSRFRQQLP---QPLMSLKVTATDHGVPRLQKTV 2325          

HSP 4 Score: 88.1965 bits (217), Expect = 5.084e-17
Identity = 96/317 (30.28%), Postives = 151/317 (47.63%), Query Frame = 1
Query: 1465 FHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVT-DSGKRTLIEGPTTINKEYSIVIVS----DPDSGNGGLVQCD-LKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI---DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDE 2388
            F I    G +  +  LD+E +K Y FN+ A         S + V + V D ND  P+    ++T D     ++E   T++  Y ++I S    D D G  GLV    L G+     V       +T  I  +  LD EE ++   +I   D G P L+++ +  I + DINDN+P FE  SY   + EN++ G  +++++ATD+D D   ++ YS+   D +++  F I+  TG I      +RE+   ++  V   D GE  +S    V I + D NDN P    +N   S IF + +   S  II  I+  D D+
Sbjct: 1598 FTISPFDGTIFTNSPLDFENIKTYRFNITA-------GKSTSQVIIHVTDENDEAPR----FITGDVVNLKVLEELDTVS--YPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAV-----NSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKD--AELQYSLESNDEITIP-FRINVATGWITVAGKVNREENEEFRFFVKVTD-GE--KSSKVIVEIHVEDFNDNHPM---INDRNSDIF-VPDPTRSVEIIHVINVHDLDK 1886          

HSP 5 Score: 88.1965 bits (217), Expect = 5.817e-17
Identity = 99/331 (29.91%), Postives = 150/331 (45.32%), Query Frame = 1
Query: 1168 LKLLQPIDRENVSMYNLNLIATD--KGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKES---EISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTI 2145
            LK    +D E  S   + +IAT     KP LS   K  IKI+D NDN P F+   Y  NV E+   ++ GH+I       +D   +  V Y     V  +   +F +  S G +     LD E    Y   V A D G        TV V+V+D +DN P+          +   +E P  +     ++ +S  D+      + +L G  + I   P   + +T  + + +SLD+E++   R  +   D      TS     + ++D+NDN+PIFE P Y    EEN+     + +  A+D DS+ NGKI YS+ S    YF I+P TG +
Sbjct: 1996 LKTKSSLDAEEYSECLVFIIATTYFDNKP-LSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGHVIA------RDIDRSSRVFYEI---VGGDANHEFMVTES-GQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF--------SRIFHVEVPEDVRIGEPVIQLSASDADEHSNHRFELDGGGEGI---PFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETS---LFVNVKDVNDNAPIFEKPEYLFISEENSAE---IGQFHASDMDSENNGKIRYSVTS---PYFKIEPSTGVL 2295          

HSP 6 Score: 83.9593 bits (206), Expect = 1.106e-15
Identity = 81/272 (29.78%), Postives = 126/272 (46.32%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSY---FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVL-YTFLSPVEKFTIHPDQG-------IIRTNQQLDRENKAVHEFSVRVI-DKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLD 2727
            + +N +SPI +    H  V EN   G +  ++ A D DS L+G ++Y I + S  Y   F +D  +G++RS  +FD EK+ SY     A+DLG P+++ +    I I D NDN P F      GS  +    +G SN  +  + A D D  +  Q L Y  L+  + F +  + G       +  T Q+L+    AV+  S R +  K  L    + S  ++V   + N  R  I  ND    K+ +LD A +       +D    P  H+D
Sbjct:  624 KPLNQHSPICQITEIH--VLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKF------GSRYYTATISGKSNETVAIVQANDNDVDVKNQKLQYHLLNYHDFFQLDKETGKVTTIQDVPMTWQRLNISISAVNMDSERFLQSKTFLLVTVTSSSKLAVQLNSGNLIR--IFKNDKIGEKVGHLDIASSETVYWSTLD----PRLHVD 881          

HSP 7 Score: 83.9593 bits (206), Expect = 1.124e-15
Identity = 103/362 (28.45%), Postives = 158/362 (43.65%), Query Frame = 1
Query: 1813 EGSTWKINLVESLDYEERN-VERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIG----TIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            E ST  +    SLD EE +    FII         L++  +  I I DINDNSP F+   Y   V EN+   ++   V+A  RD D + ++ Y I     ++  +   +G I S    DRE ++ Y L V A D G+P + G+  V++T+ D++DN P F       S IF ++   P +  IG     + A D DE  N +           F +  + G++  N  LD E K  +   V++ D   L +    S+ V+V D NDN P F  P      + IS  ++A   + +  A D D   N  + Y + S           F ++   G   L R   +    +  LK+  +D G P
Sbjct: 1990 EKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIG-HVIA--RDIDRSSRVFYEIVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF-------SRIFHVEV--PEDVRIGEPVIQLSASDADEHSNHRFELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIE---TSLFVNVKDVNDNAPIFEKP----EYLFISEENSAE--IGQFHASDMDSENNGKIRYSVTS---------PYFKIEPSTG--VLSRFRQQLPQPLMSLKVTATDHGVP 2319          

HSP 8 Score: 71.2478 bits (173), Expect = 7.265e-12
Identity = 68/229 (29.69%), Postives = 107/229 (46.72%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKI---PLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPP 1632
            NDNSP F Q +    ++E+   G K+    +   +D  S+ F  I     NHE     ++ E    +S         ++ +DRE  S Y+L + A D GKP   G   + + +LD +DN P F +  + V V E    G  ++ L A+D D   N    + F  D   E    F +D +TG + ++++LD+EK + Y   V   D    A   + ++ V+V D NDN P
Sbjct: 2039 NDNSPRFDQQLYRFNVTENS--GPKLIGHVIARDIDRSSRVFYEIVGGDANHEF----MVTESGQIES---------VRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF-SRIFHVEVPEDVRIGEPVIQLSASDADEHSN----HRFELDGGGE-GIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDG---AWLIETSLFVNVKDVNDNAP 2243          

HSP 9 Score: 69.3218 bits (168), Expect = 2.480e-11
Identity = 52/167 (31.14%), Postives = 80/167 (47.90%), Query Frame = 1
Query: 1168 LKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYY--FSSDVTSEVRKKFHIDSSTGWLSISET--LDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVT 1656
            L +  P+DRE+ +  ++ +I +    PS+   + I I +LD NDN PIF      V + E+   G  + +  ATD D G+NG +  Y    S  T +    F I  S G+L +  T  LD E    Y+  + A D G     S   + + ++D NDNPP   +  +T
Sbjct:   75 LSVSSPLDRESENAIDMLIITS---PPSI---IHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLT 235          

HSP 10 Score: 67.3958 bits (163), Expect = 1.010e-10
Identity = 77/273 (28.21%), Postives = 120/273 (43.96%), Query Frame = 1
Query: 2116 FSIDPVTGTIRSKISFDREKR-ASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLN-GGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKI-SYLDTAG--TLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            F IDP+TG I+S  +       A  ++   + D GE  + G  +V I I    D   + + +    G++ F I E       +G I       G+ G V +        FTI P  G I TN  LD EN   + F+       I   +++  V + V DEND  PRF+  T D  ++K+   LDT     ++    A D DEG N  + Y I+SGN+       +F ++   GDI     L R++  ++ L +   D G P   + +  +I +
Sbjct: 1499 FKIDPITGIIQSTPNTKPTSDIAKLKIQAISYD-GE--RVGFCDVKIHI----DKAAFVENVVLSNGTFEFNISETADRFTEVGKIVILG--AGLEGSV-FRIQDNDYNFTISPFDGTIFTNSPLDFENIKTYRFN-------ITAGKSTSQVIIHVTDENDEAPRFI--TGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNT------SLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHV 1746          

HSP 11 Score: 66.2402 bits (160), Expect = 2.227e-10
Identity = 88/325 (27.08%), Postives = 141/325 (43.38%), Query Frame = 1
Query: 1951 DINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS--IDSLS----VSYFSIDPVTGTIRSKIS--FDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL--SPV-EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIP--TNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIF-FMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            D+NDNSPIF        + E    G  V    ATD D   NG I     +DSL+    +S F I    G +  +++   DRE R  Y + + A D G P  S S ++ I I D NDN P F      G     +  NG  N  + +++A D D   N  + Y  L   P  E F+I  D+ I+ T    +   +   EF V   D G+     ++++ V++   N++EP   I    +D   + +   D  G  +A +   D D    ++    I +GN     +  IF  + +++ +I   + +   +   YIL+   +D  +P
Sbjct:  109 DVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNF------GIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSIS-DENILVTQNNTECLQRC--EFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYPSDYPFIIVQPEDVNGKTLAILSITDSDGPLGANSTIWIENGN-----EQSIFSLISRQSINILTVKHVENANQEQYILEFRANDGQSP 419          

HSP 12 Score: 62.7734 bits (151), Expect = 2.661e-9
Identity = 63/249 (25.30%), Postives = 107/249 (42.97%), Query Frame = 1
Query: 2242 NVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQV-LYTFLSPVEKFTIHPDQGIIRTN--------QQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQII-SGNSRDQ--TQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLN 2952
            ++LI + D NDN+P F           EI E  P    +    A DPDEG NG +  Y  +  +         GI++++         +LDRE + ++   +  ID+G+    +S  + + ++D NDN P F I      S+ +++     T +  + A D D   NS L Y+I+ SG + +     D+   + Q N +  LQR             +   D G PP  +  N V+ ++   +    +N
Sbjct:  102 HILIDVLDVNDNSPIFP----IDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGI-----RSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENILVTQNNTEC-LQRCE---------FVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNIN 331          

HSP 13 Score: 57.3806 bits (137), Expect = 1.058e-7
Identity = 86/302 (28.48%), Postives = 139/302 (46.03%), Query Frame = 1
Query: 1084 YRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESE----ISGHLILLLK-ATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPI 1974
            +R++++++  FT+ P    FD TI   F     P+D EN+  Y  N+ A   GK +     ++ I + D ND  P F     +VN+K  E    +S  LI+    A D D G+NGLV Y   S  TS     F ++S+TG +     LD E+   +   + A+D+G  +  + + + + V D NDN P+  L     S     I   + I  +   ++ +D D      +Q  L+ + + I +P      + W I +   ++ EE    RF +   D GE   +S    EI + D NDN P+
Sbjct: 1589 FRIQDNDYN-FTISP----FDGTI---FTN--SPLDFENIKTYRFNITA---GKST----SQVIIHVTDENDEAPRFITGD-VVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTS----LFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFEL-----SSYFIKISENSKIGSKIIRILATDKD--KDAELQYSLESNDE-ITIPFRINVATGW-ITVAGKVNREENEEFRFFVKVTD-GEK--SSKVIVEIHVEDFNDNHPM 1856          

HSP 14 Score: 56.225 bits (134), Expect = 2.853e-7
Identity = 38/114 (33.33%), Postives = 60/114 (52.63%), Query Frame = 1
Query: 1333 VNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTD--SGK 1668
            ++V E+   G +   ++A D+DSG +G+V Y   +  + +    FH+DS++G L   +  D EK + YTF   A+D GT +  +     + + D NDN PK    Y T   SGK
Sbjct:  638 IHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTK-SDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATISGK 750          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 266.929 bits (681), Expect = 1.720e-71
Identity = 218/696 (31.32%), Postives = 321/696 (46.12%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDED-----SKNFNIIS------YRLENHEH--ALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNG-GLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS---VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF---LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKIS---YLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRA--LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            NDN+P F Q    IE  E+     K  L  A D D     ++ +NI+S      +RL +H     +  L  + S F              +DRE    Y+L + A D G P L G + + I I D NDNQPIF  S Y   V E+   G  +L + A+D D+ ENGLV Y  +    S+  + F ID  TG + I++ LD+E  + +   V+A+D G     + A V + V D NDN P I + +++D     + E      +  + + V DPDS      V   L G      +    R+ S + + +   LD E  +     +V  D+G P L +S    + I D+NDN P FE   YH  V E    G  VL+V+A DRD  LN  + YS+         +F IDP TG I ++   D E     QL+V ARD G P  S +A VL+TI D NDN P F        Y   + EN P    I  + A DPD G+N  V YT       + +F +    G I    +LD E ++ +EF V   D+G L    +  + + + D NDN P F  P     S++ S       + T +  + A D D G    + Y+I++GN     +  IF +D+  G+IF+ R   L+ +   +++L +  +D GN    + A   + I ++ QR       +YN
Sbjct:  168 NDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGF--------------LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRR-QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISES-AQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFAL--TTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFD----QSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL--STTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGN-----EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYN 833          

HSP 2 Score: 246.899 bits (629), Expect = 2.524e-65
Identity = 203/680 (29.85%), Postives = 312/680 (45.88%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYF---------SSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI----YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYH-QTVEENNQAGIVVLKVVATDRDSDLNGKINYSI----DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHA-EDPDEGINGQVLYTF--------LSPVEK------FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILR--QENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQII----SGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQ 2874
            NDN+P F   +  I + ES ++GA +    A D+DS +   ++Y L +     LF +       D+    + L   Q +D E+   + L + ATD G PSLS  L I + + D NDN P+FE   Y VNV ES      I+ + A+D D+G N  + Y           +S  +S+V + F I  ++GW+ +   LD E    Y   V+A D+GT AA +K  V V V+D NDN PK     Y   + ++ +R  + G         +V  SD D G    ++  L        V P      T +I+  E LD E R +   ++   D+G P  ++     I + D+NDN+P    P     +V E    G  V++V A DRD   N  I YSI    DS     FSIDP +G IR+++  D E+R+ Y+L V A D G P +     + + + D NDN P F       S +F ++E+     ++G+I   E P + +   V  +F        L+P+ K      F I    G +   + LDRE ++     +R +D       Q ++++V + V D NDN P +     D   +++S     GT++    A D D G N  L Y++I      N   +    +F MD   G + LQ  L  + +  Y+L +   DQ
Sbjct:  925 NDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI-------DARSGHLILS--QHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVG---------VVTASDLDLGENAAIRYSLLPINSSFQVHP-----VTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFT----SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW---PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQ 1574          

HSP 3 Score: 200.675 bits (509), Expect = 4.288e-51
Identity = 199/716 (27.79%), Postives = 312/716 (43.58%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-----ENHEHAL--------FTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQK-----FILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSD-LNGKINYSIDSLSVSY-------------FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEP--AQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL-----------SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKG---ILRQENSVSVTVSVIDENDNEPRFVIPTND---STSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRAL--TRQDM---GVYILKMMVSDQGNP-PRKSYANYVIKIDNS 2928
            NDN P F +   ++ +SES  I A+I    A D D+ N   I+YR+     +N  +++        F + P         N  ++ L  P+DRE    Y L ++ATD G P+   K ++ +++LDANDN P F+ S Y   ++E+   G ++ ++ A+D D GEN  + Y         +   F +   TG +S  E LD E  + Y   V ARD GT    ++  V++ V D NDN P+I  +   D       + P T   E   V   D D G N  +    +KG        F + P      ++  I     LD+EER++ R  +   D G P   +     + + D+NDN P F   S    V E+   G VV  +   +R +D +   +  S + L V+Y             F ID  +G +      DRE ++ ++L + A D       QS +  V I + D NDN P +           ++ E  P   II    A D D G NG + Y  +             +  F +    G +     LD E    +   V+ +D+      R + SV+V + ++D ND+ P FV P +    + S+ IS     G +VA I A+D+D G N  L Y+I  GN   +     F ++ + G I L ++L    +D+   G + L +   D G P P+KS  N  + +  S
Sbjct: 1030 NDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFP---------NSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-----INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI-ADPQEDVVSVREEQPPGT---EVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDP------TSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWP----QDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR-----FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGS 1712          

HSP 4 Score: 185.267 bits (469), Expect = 2.172e-46
Identity = 187/665 (28.12%), Postives = 296/665 (44.51%), Query Frame = 1
Query:  955 NDNSPH----FSQPVKTIEISESIQIGAKIPLPLAVDEDSK----NFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKK-FHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQA-----GIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTI---RSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA--GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            NDN P     F     + +ISES Q G  +      D DSK    N N+     + H    F L    +  D++I  + + L  P+DRE VS Y L+++ATDKG P L     I ++I D NDN P FE   Y  NV E    G  +L + A D+D G N  + Y  +   T E   + F ID  TG ++    +D E        V+ARD G     S ATV V++ D NDN P     +   S       G   +      V  SDPD G   +V   +   + F  +       ++ +I +   LD+E R+   F ++  DRG   L+++   ++ + D+NDN P+F    Y  ++ E+ +A        ++ VVATD D    G+++Y I + +    F ID  TG I   R  +      +  + L++ A D G    +  A V ++I D     P F+       Y + +KE+ P   ++G++ A   D      V Y+  S  P   F+I  + G IR  + LD E K+    +++    G         V + V D NDN P F     +++ V+IS  ++A  G  +    A DKD G +  + Y ++      ++   +F +D ++G + L + L  +    + L +  +D G P
Sbjct:  387 NDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH----FAL----TTRDNSIYLVIVHL--PLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAE--TPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILK-----VSASDPDCGVNAMVNYTI--GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDM-LSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE----KARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEF-----EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVK-----ESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVP 1014          

HSP 5 Score: 172.94 bits (437), Expect = 1.030e-42
Identity = 190/719 (26.43%), Postives = 315/719 (43.81%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL--------ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGK---PSLSGKLKIEIKILDANDNQPIF------ENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETL-----DYEKVKYYTFNVIARDSG-TDAAFSKATVKVSVVDCNDNPPKIYLEYV--------TDSGKRTL------IEGPTTINKEYSIVIVSDPDSGNGGLVQCDL------------KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPS-YHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS-YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEP-AQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE-KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILR-QENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTL 2949
            NDN+P + Q    +++SE+  +G  I    A D D+     + YRL        E+ E A+          DS      L L  P+D E V  Y L + A D+       L   + + ++ILDAND+ P F         T  + + ++   G ++  + A D+DSG+NG + Y  +         +F I+S TG + + ++L     D EK   +   + A+D G  +   S   + + V   ++NPP+ +L+ V          SG   L      + G    N  Y I     P      L   D             + SQ   ++P   R+      N   +L       +R      D    Q        I + D+NDNSP F   S Y  +V EN++ G V+  VVA+D D   N  + YSI   ++   FSID  +G + ++   DRE+ + Y L + A D G+P ++ G  N+ I + DQNDN P F+       Y   ++E+ P    +  I A D D G+N +++Y+  +  + +F I    G+I T  +LDRE +A + F V   D G    +  +V V ++V+D NDN P F          ++  L   G  + +++A+D D G N+ + Y +   N+ +      F ++   G +   ++L  +   +  L+++  D+GNPP+ S     + I  + Q +  L
Sbjct: 1479 NDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLF-----RMDSLTGA--LSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITG---GNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPR-FLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI-----PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDA-----NRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL----SKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIF---ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL---NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVL 2164          

HSP 6 Score: 153.68 bits (387), Expect = 8.333e-37
Identity = 187/666 (28.08%), Postives = 293/666 (43.99%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL--ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKK--FHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE----YVTDSGKRTLIEGPTTINKEYSIVIVSDPDS-GNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFI-IVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLS-VFARDLGEP-----AQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDE--GINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKA-VHEFSVRVIDKGILRQENSVS-VTVSVIDENDNEPRFVIPTNDSTSVKISYL---DTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            NDNSP FSQ      +SE    G  +    A D D+ +   + Y +   NH++A F + P +S    T   I L      DRE   +Y L +IATD+G P ++G   I ++I+D NDNQP F  +  +V V E+   G +I  + A D D+     + Y   ++ T ++     F +D  +G L +   LDYE  + Y  +VIA D+  +A   +  + V V D NDN P    +    Y       + I    +++ +   V  +D DS GN   V   ++ +Q+   V P+N       +N+         + + F+ I+  D G+P L SS    +   D       F    Y   + E    G VVL++     D  L       I     S F +      +  K   DRE+   Y+L  V +   G P       S   +V+ITI D NDN P F   +    Y  EI E  P    I  + A D D+    N +V+Y   S  ++  FTI    G++  N +LD ++ A  +E  +R  D    R   S+    + + DENDNEP+F +      +  + +L   +  G+ V R  A D D+GP   L+Y I    S D++  K+F +D ++G +        +    Y ++++ SD G
Sbjct: 2316 NDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA-FVIEPAFSGIVRT--NIVL------DREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNN-LVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEA---RTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSN---GVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSL-----AIIAGNEESAFELLQSKAIVLVK-PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF---DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPL------TEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPS-DESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 7 Score: 144.821 bits (364), Expect = 4.097e-34
Identity = 167/666 (25.08%), Postives = 287/666 (43.09%), Query Frame = 1
Query:  955 NDNSPHFSQP------VKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLEN-HEHALFTLIPEWSNFDSTINQIFLKLLQPI--DRENVSMYNLNLIATDKGKPSLS-GKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSK-----------------------ATVKVSVVDCNDNPPKI-----YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKG--SQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXX-XRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGE-PAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF----LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEP--RFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDI 2805
            ND++PHF  P        ++ IS++ +IG  +   +AVDEDS +   ++Y +   +    F +     N  + I ++ +K L P   D E    +NL + A D G+P      L + + +  +++N P F  + Y   + E+  SG  +L + A      EN  + Y   + V +++   FH+D   G ++     D E    Y   V  RD+   +  S                        AT+ ++V D NDN P+      Y   V ++ +  +I            V+ SD D G N  L+     G    KF +      + S+ +++    LD E+ +     I   DRG+P+    H    I + D NDN+P F+   Y  +V+E+   G  V+++ A D D  +N ++ YS+ + +   F+ID  +G I +    DRE +ASY   V A D G    +S +  V I + D NDN P F+       YI ++         +  + A D D G N +++Y+      +   KF I+P  G +  +Q L  E+  +    V   DKG   Q +   + + + +     P  RF    N++  V +     +GT + ++ A+  D G    + +   +GN     +D I  +D  +G+I
Sbjct: 1596 NDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRI-----NSQTGIIEL-VKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIH----------TVVASDLDEGPNADLIYSITGGNLGNKFSI------DSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERY----PYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF---QNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGN-----EDGILSLDSLSGEI 2222          

HSP 8 Score: 142.51 bits (358), Expect = 1.900e-33
Identity = 158/588 (26.87%), Postives = 258/588 (43.88%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGK-LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMY-YFSSDVTSEVRKKFHIDSSTGW---LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI----YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL--KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP----IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLN-GKINYSIDSLSVSYFSIDPVTGTIR---SKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYF-QGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK----FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            +DRE  + Y+L  I        LSG+ +++ + + D NDN P F  ++  +   E+        LL A D D        Y   S +V    R   H +        L IS  LD E    Y+  + A D GT       TV +++ D NDN P      Y   V ++          T+      V  SD D+   GLV+  +  + S K  +   + R G+ + IN  ++LD+E + +   ++V  D GE  L ++    I + D+NDN P    IF        + E+ Q G  V ++   D DS      +N +++     +F++     +I      +  DRE  ++Y LSV A D G P    S ++ + ITD NDN P F Q L      + E+ + G S   +  + A D DEG+N  + Y+     E     F I P  G+I T   +D E + V + +V   D G+    ++ +V V++ D NDNEP F        +V ++  +  G  + ++ A D D G N+ ++Y I  G  +  T+   F +   +G+I +   L  +    Y   ++ +D+G
Sbjct:  138 LDRETRASYSLVAIP-------LSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENA---------TVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIY-IN--KALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHAN--VMEVADPGTS---VLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEG-FKHLTE---FEVRSASGEICIAGELDFERRSSYEFPVLATDRG 693          

HSP 9 Score: 104.76 bits (260), Expect = 7.014e-22
Identity = 163/673 (24.22%), Postives = 294/673 (43.68%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHE------HALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIF----ENSTYIVNVKESEISGHL-----ILLLKATDKDS-GENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKY---YTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGS-----TWKINLVESLDYEERNVERF-IIVCHDRGEPQLTSSHXXXX-----XXRDINDNSPIFEHPS-YHQTVEENN--QAGIVVLKVVATDRDSDLNGKINYSIDSLSVSY-FSIDPVTGT--IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVL-ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF------LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEP-------RFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRAL 2823
            NDN P F  P   + +SE+ ++GA I    A D D+  +  ++YRL           ++F L       D    ++ LK  + +D E    Y L++IA+D        +  + +++ D NDN P+F      + + +    SEIS  L     +L + ATD DS G N  V+Y     +    ++ F +  S G +S++ +     V     Y   +IA+D+G  A  S   ++V     NDN           SG+   ++       +Y   I      G+  ++Q       + + +   N E +     +  I LV+ LD E  ++ +  +++ H  G P ++S +          I D NDN PIF+  + Y   + E    +  I  L+ +  D+++  N ++ Y I S +  + F+ID VTG   + +++ +D   + SY+L + A D        S     + + D+NDN P F        Y+  + EN P  + +   HA D D+G  GQ+ Y+        S  + F +  + G++ +    D E +  ++  +   D G   ++ SV+V V +   ++  P       RFV+P     +V +      G +V ++ A D D GP+  + YQ+ + +S        F +++ +G + ++R L
Sbjct: 2422 NDNQPTFP-PNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFAL-------DRYSGKLVLK--RRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY-----IIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQ---ANDN----------GSGRSQFLQ------NQYRAQISEAAPLGSV-VLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAK-SYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTE----YVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPA----AVALP----QGYVVGQVTATDSDSGPDGRVVYQLSAPHSH-------FKVNRSSGAVLIKRKL 3032          

HSP 10 Score: 101.293 bits (251), Expect = 6.981e-21
Identity = 109/355 (30.70%), Postives = 150/355 (42.25%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-------SYFSIDPVTGTIRSKIS--FDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF----LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF-VIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFL---QRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTL 2949
            +D NDN+P F   S H    EN    +    + A D D +      Y+I S +V       S+   D V   +  +IS   DRE    Y L + A D G P   G   V ITI D NDN P F        Y   + EN      +  ++A D D   NG V Y          + F I P  G I  N+ LD E K +HE  V   D G    E +  V++ V D NDN+P   VI  +D  S KIS     G  VARI   D    P+S  +Y  +  N      D  F +  ++  I+L      L R+ +  Y L ++ +D+G PP  +  +  ++I    DN  +  Q L
Sbjct:  165 KDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVL-YLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFN----QSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHD----PDSKTEYANV--NVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDL 508          

HSP 11 Score: 95.5153 bits (236), Expect = 3.999e-19
Identity = 132/567 (23.28%), Postives = 226/567 (39.86%), Query Frame = 1
Query: 1222 LIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSS-TGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGN------GGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIF---EHPSYHQT------VEENNQAGIVVLKVVATDRDSDL-NGKINYSIDSLSVSYFSIDPVTGTIR---SKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGI-----NGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRV------IDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDE--GPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRAL 2823
            L+A     P L+   ++ I++ D NDN P F    ++  V E    G  +  + A D D+G N  + Y+    V       F I+ + +G +  +  LD E    Y   +IA D G       AT++V +VD NDN P               +   T +    + +  +D D+        G     D++    F L      +  + K+ L   LDYE +      ++  D      T      + + D NDN+P+F   + P+Y         + E+      +L V ATD DS+  N K+ Y I+  +   FS+ P  G +    S++         Y + + A+D G+PA   S  + +   D       F        Y  +I E  P  +++  +  +  D+ +     N +  +  L       + P          LDRE   +++  + +           L   + +SV ++++D NDN P F    +     +IS L      +A+++AID D+   PNS + Y I SGN      + +F +D   G +F+   L
Sbjct: 2292 LVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI---VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF------PPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFAL------DRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP-AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFL----QNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKP----------LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF--DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGN-----DEHMFTIDLVTGVLFVNNRL 2818          

HSP 12 Score: 89.7373 bits (221), Expect = 2.428e-17
Identity = 80/295 (27.12%), Postives = 133/295 (45.08%), Query Frame = 1
Query: 2116 FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPD-EGINGQ---VLYTFLSPVEKFTIHPDQ-GIIRTNQQ----LDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF-------VIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLN 2952
             +ID  TG IR+K+  DRE RASY L         P    +  VL+T+ D+NDN P F       S   E  EN P       + A D D E  N Q   ++   ++   + + H ++ G++  + Q    LDRE    +   +  +D G       ++V +++ D NDN+P F        +P N           T GT V ++ A D D   N  ++Y I   N R   ++++F +D + G I++ +AL  +   ++ L ++  D G  P ++ A   I++ +      T+N
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAI------PLSGRNIRVLVTVKDENDNAPTFPQT----SMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPEN----------ATVGTSVLQVYASDTDADENGLVEYAI---NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTIN 394          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 266.929 bits (681), Expect = 1.720e-71
Identity = 218/696 (31.32%), Postives = 321/696 (46.12%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDED-----SKNFNIIS------YRLENHEH--ALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNG-GLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS---VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF---LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKIS---YLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRA--LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            NDN+P F Q    IE  E+     K  L  A D D     ++ +NI+S      +RL +H     +  L  + S F              +DRE    Y+L + A D G P L G + + I I D NDNQPIF  S Y   V E+   G  +L + A+D D+ ENGLV Y  +    S+  + F ID  TG + I++ LD+E  + +   V+A+D G     + A V + V D NDN P I + +++D     + E      +  + + V DPDS      V   L G      +    R+ S + + +   LD E  +     +V  D+G P L +S    + I D+NDN P FE   YH  V E    G  VL+V+A DRD  LN  + YS+         +F IDP TG I ++   D E     QL+V ARD G P  S +A VL+TI D NDN P F        Y   + EN P    I  + A DPD G+N  V YT       + +F +    G I    +LD E ++ +EF V   D+G L    +  + + + D NDN P F  P     S++ S       + T +  + A D D G    + Y+I++GN     +  IF +D+  G+IF+ R   L+ +   +++L +  +D GN    + A   + I ++ QR       +YN
Sbjct:  168 NDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGF--------------LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRR-QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISES-AQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFAL--TTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFD----QSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL--STTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGN-----EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYN 833          

HSP 2 Score: 246.899 bits (629), Expect = 2.524e-65
Identity = 203/680 (29.85%), Postives = 312/680 (45.88%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYF---------SSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI----YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYH-QTVEENNQAGIVVLKVVATDRDSDLNGKINYSI----DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHA-EDPDEGINGQVLYTF--------LSPVEK------FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILR--QENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQII----SGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQ 2874
            NDN+P F   +  I + ES ++GA +    A D+DS +   ++Y L +     LF +       D+    + L   Q +D E+   + L + ATD G PSLS  L I + + D NDN P+FE   Y VNV ES      I+ + A+D D+G N  + Y           +S  +S+V + F I  ++GW+ +   LD E    Y   V+A D+GT AA +K  V V V+D NDN PK     Y   + ++ +R  + G         +V  SD D G    ++  L        V P      T +I+  E LD E R +   ++   D+G P  ++     I + D+NDN+P    P     +V E    G  V++V A DRD   N  I YSI    DS     FSIDP +G IR+++  D E+R+ Y+L V A D G P +     + + + D NDN P F       S +F ++E+     ++G+I   E P + +   V  +F        L+P+ K      F I    G +   + LDRE ++     +R +D       Q ++++V + V D NDN P +     D   +++S     GT++    A D D G N  L Y++I      N   +    +F MD   G + LQ  L  + +  Y+L +   DQ
Sbjct:  925 NDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI-------DARSGHLILS--QHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVG---------VVTASDLDLGENAAIRYSLLPINSSFQVHP-----VTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFT----SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW---PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQ 1574          

HSP 3 Score: 200.675 bits (509), Expect = 4.288e-51
Identity = 199/716 (27.79%), Postives = 312/716 (43.58%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-----ENHEHAL--------FTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQK-----FILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSD-LNGKINYSIDSLSVSY-------------FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEP--AQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL-----------SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKG---ILRQENSVSVTVSVIDENDNEPRFVIPTND---STSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRAL--TRQDM---GVYILKMMVSDQGNP-PRKSYANYVIKIDNS 2928
            NDN P F +   ++ +SES  I A+I    A D D+ N   I+YR+     +N  +++        F + P         N  ++ L  P+DRE    Y L ++ATD G P+   K ++ +++LDANDN P F+ S Y   ++E+   G ++ ++ A+D D GEN  + Y         +   F +   TG +S  E LD E  + Y   V ARD GT    ++  V++ V D NDN P+I  +   D       + P T   E   V   D D G N  +    +KG        F + P      ++  I     LD+EER++ R  +   D G P   +     + + D+NDN P F   S    V E+   G VV  +   +R +D +   +  S + L V+Y             F ID  +G +      DRE ++ ++L + A D       QS +  V I + D NDN P +           ++ E  P   II    A D D G NG + Y  +             +  F +    G +     LD E    +   V+ +D+      R + SV+V + ++D ND+ P FV P +    + S+ IS     G +VA I A+D+D G N  L Y+I  GN   +     F ++ + G I L ++L    +D+   G + L +   D G P P+KS  N  + +  S
Sbjct: 1030 NDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFP---------NSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-----INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI-ADPQEDVVSVREEQPPGT---EVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDP------TSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWP----QDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR-----FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGS 1712          

HSP 4 Score: 185.267 bits (469), Expect = 2.172e-46
Identity = 187/665 (28.12%), Postives = 296/665 (44.51%), Query Frame = 1
Query:  955 NDNSPH----FSQPVKTIEISESIQIGAKIPLPLAVDEDSK----NFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKK-FHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQA-----GIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTI---RSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA--GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            NDN P     F     + +ISES Q G  +      D DSK    N N+     + H    F L    +  D++I  + + L  P+DRE VS Y L+++ATDKG P L     I ++I D NDN P FE   Y  NV E    G  +L + A D+D G N  + Y  +   T E   + F ID  TG ++    +D E        V+ARD G     S ATV V++ D NDN P     +   S       G   +      V  SDPD G   +V   +   + F  +       ++ +I +   LD+E R+   F ++  DRG   L+++   ++ + D+NDN P+F    Y  ++ E+ +A        ++ VVATD D    G+++Y I + +    F ID  TG I   R  +      +  + L++ A D G    +  A V ++I D     P F+       Y + +KE+ P   ++G++ A   D      V Y+  S  P   F+I  + G IR  + LD E K+    +++    G         V + V D NDN P F     +++ V+IS  ++A  G  +    A DKD G +  + Y ++      ++   +F +D ++G + L + L  +    + L +  +D G P
Sbjct:  387 NDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH----FAL----TTRDNSIYLVIVHL--PLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAE--TPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILK-----VSASDPDCGVNAMVNYTI--GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDM-LSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE----KARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEF-----EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVK-----ESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVP 1014          

HSP 5 Score: 172.94 bits (437), Expect = 1.030e-42
Identity = 190/719 (26.43%), Postives = 315/719 (43.81%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL--------ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGK---PSLSGKLKIEIKILDANDNQPIF------ENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETL-----DYEKVKYYTFNVIARDSG-TDAAFSKATVKVSVVDCNDNPPKIYLEYV--------TDSGKRTL------IEGPTTINKEYSIVIVSDPDSGNGGLVQCDL------------KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPS-YHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS-YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEP-AQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE-KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILR-QENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTL 2949
            NDN+P + Q    +++SE+  +G  I    A D D+     + YRL        E+ E A+          DS      L L  P+D E V  Y L + A D+       L   + + ++ILDAND+ P F         T  + + ++   G ++  + A D+DSG+NG + Y  +         +F I+S TG + + ++L     D EK   +   + A+D G  +   S   + + V   ++NPP+ +L+ V          SG   L      + G    N  Y I     P      L   D             + SQ   ++P   R+      N   +L       +R      D    Q        I + D+NDNSP F   S Y  +V EN++ G V+  VVA+D D   N  + YSI   ++   FSID  +G + ++   DRE+ + Y L + A D G+P ++ G  N+ I + DQNDN P F+       Y   ++E+ P    +  I A D D G+N +++Y+  +  + +F I    G+I T  +LDRE +A + F V   D G    +  +V V ++V+D NDN P F          ++  L   G  + +++A+D D G N+ + Y +   N+ +      F ++   G +   ++L  +   +  L+++  D+GNPP+ S     + I  + Q +  L
Sbjct: 1479 NDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLF-----RMDSLTGA--LSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITG---GNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPR-FLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI-----PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDA-----NRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL----SKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIF---ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL---NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVL 2164          

HSP 6 Score: 153.68 bits (387), Expect = 8.333e-37
Identity = 187/666 (28.08%), Postives = 293/666 (43.99%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL--ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKK--FHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE----YVTDSGKRTLIEGPTTINKEYSIVIVSDPDS-GNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFI-IVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLS-VFARDLGEP-----AQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDE--GINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKA-VHEFSVRVIDKGILRQENSVS-VTVSVIDENDNEPRFVIPTNDSTSVKISYL---DTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            NDNSP FSQ      +SE    G  +    A D D+ +   + Y +   NH++A F + P +S    T   I L      DRE   +Y L +IATD+G P ++G   I ++I+D NDNQP F  +  +V V E+   G +I  + A D D+     + Y   ++ T ++     F +D  +G L +   LDYE  + Y  +VIA D+  +A   +  + V V D NDN P    +    Y       + I    +++ +   V  +D DS GN   V   ++ +Q+   V P+N       +N+         + + F+ I+  D G+P L SS    +   D       F    Y   + E    G VVL++     D  L       I     S F +      +  K   DRE+   Y+L  V +   G P       S   +V+ITI D NDN P F   +    Y  EI E  P    I  + A D D+    N +V+Y   S  ++  FTI    G++  N +LD ++ A  +E  +R  D    R   S+    + + DENDNEP+F +      +  + +L   +  G+ V R  A D D+GP   L+Y I    S D++  K+F +D ++G +        +    Y ++++ SD G
Sbjct: 2316 NDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA-FVIEPAFSGIVRT--NIVL------DREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNN-LVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEA---RTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSN---GVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSL-----AIIAGNEESAFELLQSKAIVLVK-PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF---DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPL------TEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPS-DESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 7 Score: 144.821 bits (364), Expect = 4.097e-34
Identity = 167/666 (25.08%), Postives = 287/666 (43.09%), Query Frame = 1
Query:  955 NDNSPHFSQP------VKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLEN-HEHALFTLIPEWSNFDSTINQIFLKLLQPI--DRENVSMYNLNLIATDKGKPSLS-GKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSK-----------------------ATVKVSVVDCNDNPPKI-----YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKG--SQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXX-XRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGE-PAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF----LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEP--RFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDI 2805
            ND++PHF  P        ++ IS++ +IG  +   +AVDEDS +   ++Y +   +    F +     N  + I ++ +K L P   D E    +NL + A D G+P      L + + +  +++N P F  + Y   + E+  SG  +L + A      EN  + Y   + V +++   FH+D   G ++     D E    Y   V  RD+   +  S                        AT+ ++V D NDN P+      Y   V ++ +  +I            V+ SD D G N  L+     G    KF +      + S+ +++    LD E+ +     I   DRG+P+    H    I + D NDN+P F+   Y  +V+E+   G  V+++ A D D  +N ++ YS+ + +   F+ID  +G I +    DRE +ASY   V A D G    +S +  V I + D NDN P F+       YI ++         +  + A D D G N +++Y+      +   KF I+P  G +  +Q L  E+  +    V   DKG   Q +   + + + +     P  RF    N++  V +     +GT + ++ A+  D G    + +   +GN     +D I  +D  +G+I
Sbjct: 1596 NDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRI-----NSQTGIIEL-VKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIH----------TVVASDLDEGPNADLIYSITGGNLGNKFSI------DSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERY----PYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF---QNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGN-----EDGILSLDSLSGEI 2222          

HSP 8 Score: 142.51 bits (358), Expect = 1.900e-33
Identity = 158/588 (26.87%), Postives = 258/588 (43.88%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGK-LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMY-YFSSDVTSEVRKKFHIDSSTGW---LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI----YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL--KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP----IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLN-GKINYSIDSLSVSYFSIDPVTGTIR---SKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYF-QGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK----FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            +DRE  + Y+L  I        LSG+ +++ + + D NDN P F  ++  +   E+        LL A D D        Y   S +V    R   H +        L IS  LD E    Y+  + A D GT       TV +++ D NDN P      Y   V ++          T+      V  SD D+   GLV+  +  + S K  +   + R G+ + IN  ++LD+E + +   ++V  D GE  L ++    I + D+NDN P    IF        + E+ Q G  V ++   D DS      +N +++     +F++     +I      +  DRE  ++Y LSV A D G P    S ++ + ITD NDN P F Q L      + E+ + G S   +  + A D DEG+N  + Y+     E     F I P  G+I T   +D E + V + +V   D G+    ++ +V V++ D NDNEP F        +V ++  +  G  + ++ A D D G N+ ++Y I  G  +  T+   F +   +G+I +   L  +    Y   ++ +D+G
Sbjct:  138 LDRETRASYSLVAIP-------LSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENA---------TVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIY-IN--KALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHAN--VMEVADPGTS---VLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEG-FKHLTE---FEVRSASGEICIAGELDFERRSSYEFPVLATDRG 693          

HSP 9 Score: 104.76 bits (260), Expect = 7.014e-22
Identity = 163/673 (24.22%), Postives = 294/673 (43.68%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHE------HALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIF----ENSTYIVNVKESEISGHL-----ILLLKATDKDS-GENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKY---YTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGS-----TWKINLVESLDYEERNVERF-IIVCHDRGEPQLTSSHXXXX-----XXRDINDNSPIFEHPS-YHQTVEENN--QAGIVVLKVVATDRDSDLNGKINYSIDSLSVSY-FSIDPVTGT--IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVL-ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF------LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEP-------RFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRAL 2823
            NDN P F  P   + +SE+ ++GA I    A D D+  +  ++YRL           ++F L       D    ++ LK  + +D E    Y L++IA+D        +  + +++ D NDN P+F      + + +    SEIS  L     +L + ATD DS G N  V+Y     +    ++ F +  S G +S++ +     V     Y   +IA+D+G  A  S   ++V     NDN           SG+   ++       +Y   I      G+  ++Q       + + +   N E +     +  I LV+ LD E  ++ +  +++ H  G P ++S +          I D NDN PIF+  + Y   + E    +  I  L+ +  D+++  N ++ Y I S +  + F+ID VTG   + +++ +D   + SY+L + A D        S     + + D+NDN P F        Y+  + EN P  + +   HA D D+G  GQ+ Y+        S  + F +  + G++ +    D E +  ++  +   D G   ++ SV+V V +   ++  P       RFV+P     +V +      G +V ++ A D D GP+  + YQ+ + +S        F +++ +G + ++R L
Sbjct: 2422 NDNQPTFP-PNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFAL-------DRYSGKLVLK--RRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY-----IIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQ---ANDN----------GSGRSQFLQ------NQYRAQISEAAPLGSV-VLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAK-SYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTE----YVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPA----AVALP----QGYVVGQVTATDSDSGPDGRVVYQLSAPHSH-------FKVNRSSGAVLIKRKL 3032          

HSP 10 Score: 101.293 bits (251), Expect = 6.981e-21
Identity = 109/355 (30.70%), Postives = 150/355 (42.25%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-------SYFSIDPVTGTIRSKIS--FDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF----LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF-VIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFL---QRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTL 2949
            +D NDN+P F   S H    EN    +    + A D D +      Y+I S +V       S+   D V   +  +IS   DRE    Y L + A D G P   G   V ITI D NDN P F        Y   + EN      +  ++A D D   NG V Y          + F I P  G I  N+ LD E K +HE  V   D G    E +  V++ V D NDN+P   VI  +D  S KIS     G  VARI   D    P+S  +Y  +  N      D  F +  ++  I+L      L R+ +  Y L ++ +D+G PP  +  +  ++I    DN  +  Q L
Sbjct:  165 KDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVL-YLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFN----QSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHD----PDSKTEYANV--NVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDL 508          

HSP 11 Score: 95.5153 bits (236), Expect = 3.999e-19
Identity = 132/567 (23.28%), Postives = 226/567 (39.86%), Query Frame = 1
Query: 1222 LIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSS-TGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGN------GGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIF---EHPSYHQT------VEENNQAGIVVLKVVATDRDSDL-NGKINYSIDSLSVSYFSIDPVTGTIR---SKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGI-----NGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRV------IDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDE--GPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRAL 2823
            L+A     P L+   ++ I++ D NDN P F    ++  V E    G  +  + A D D+G N  + Y+    V       F I+ + +G +  +  LD E    Y   +IA D G       AT++V +VD NDN P               +   T +    + +  +D D+        G     D++    F L      +  + K+ L   LDYE +      ++  D      T      + + D NDN+P+F   + P+Y         + E+      +L V ATD DS+  N K+ Y I+  +   FS+ P  G +    S++         Y + + A+D G+PA   S  + +   D       F        Y  +I E  P  +++  +  +  D+ +     N +  +  L       + P          LDRE   +++  + +           L   + +SV ++++D NDN P F    +     +IS L      +A+++AID D+   PNS + Y I SGN      + +F +D   G +F+   L
Sbjct: 2292 LVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI---VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF------PPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFAL------DRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP-AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFL----QNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKP----------LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF--DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGN-----DEHMFTIDLVTGVLFVNNRL 2818          

HSP 12 Score: 89.7373 bits (221), Expect = 2.428e-17
Identity = 80/295 (27.12%), Postives = 133/295 (45.08%), Query Frame = 1
Query: 2116 FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPD-EGINGQ---VLYTFLSPVEKFTIHPDQ-GIIRTNQQ----LDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF-------VIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLN 2952
             +ID  TG IR+K+  DRE RASY L         P    +  VL+T+ D+NDN P F       S   E  EN P       + A D D E  N Q   ++   ++   + + H ++ G++  + Q    LDRE    +   +  +D G       ++V +++ D NDN+P F        +P N           T GT V ++ A D D   N  ++Y I   N R   ++++F +D + G I++ +AL  +   ++ L ++  D G  P ++ A   I++ +      T+N
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAI------PLSGRNIRVLVTVKDENDNAPTFPQT----SMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPEN----------ATVGTSVLQVYASDTDADENGLVEYAI---NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTIN 394          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 249.595 bits (636), Expect = 4.231e-66
Identity = 198/691 (28.65%), Postives = 324/691 (46.89%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDED------SKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEK---------VKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNN------REGSTWKINLVES-LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK-----FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGI-LRQENSVSVTVSVIDENDNEPRFVIP-------TNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            NDNSP F +P   I  SES   G ++ L  A D D      +  + I++  ++N     F L+   +N     + + L+    +DRE+   Y LN+ A D G P   G L++ + ILD NDN PIF++S Y V++ E+ + G  ++ + A+D D G+N  + YY      +E   +F ++  TG +S +E ++  +          K   F V ARD G+     +  V V+++D ND+ P I   +  D GK   ++         + V V D DSG        L G     +V  N        E +   I  V   LD EE       +V  D+G P  T++    I + D+ND+ P+FE   Y   + E    G  V  + ATD D+ +N +++Y I S + + +FS+DP+TG I +    DRE R + +LS+ ARD G   +     + + I D+ND  P F            + E+ P   I+  + A D D+G NG V +     VE+     F +    G + T + LDRE  + +E SV   D+G    Q  + +V ++V D NDN+P+F  P        +D   +K+        ++  + A DKD+G N+ ++Y++ SG       + +F +D ++G I L+             K++VS +    R+S  + +++I
Sbjct:  150 NDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNK----FRLV-TTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL-----AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSG--------LNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQN----VTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQF-YPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGG------EGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEI 811          

HSP 2 Score: 206.838 bits (525), Expect = 5.639e-53
Identity = 172/602 (28.57%), Postives = 278/602 (46.18%), Query Frame = 1
Query: 1186 IDRENV-SMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI--------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-KFILVPPNNREGSTWKINLVESLDYEERNVER---FIIVCHDRGEPQLTSSHXXXXXXRDINDNSPI-----FEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTG--TIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP-PRKSYANYVIKI 2919
            +DRE +   Y+L ++++    P     +++ IK+LD NDN P F   +  ++  ES  SG  +LL  ATD D GENG+   Y    V   V  KF +        D+S   L  +  LD E    Y  N+ ARD G+   F    V V+++D NDNPP         S   T + G   +      V+ SD D G+   +   L  ++ +F + P      +T ++N  +  + +    ++   F +   D G P+        + + D ND+ PI     F       TV+EN   G VV  V   D DS LNG+ +  I S + + +F ++       +R     DRE+   Y L+V A D G PA++ +A+++I + D ND+ P F+       Y   + E  P+ + + +I A D D G+N QV Y  LS   ++ F++ P  G+I T   LDRE +   E S+   D G   +     + V ++DEND  P+F   +    +V +       T+VA + A D D+G N  + + +    S ++     F +D   G +  +R L R+ M  Y + ++  DQG P P+ + A   + +
Sbjct:  118 LDREGMRDHYDLVVLSSQPTYP-----IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQY--EIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVT-----VMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFE----KSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQF---SQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFAL--APSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNV 698          

HSP 3 Score: 201.83 bits (512), Expect = 1.951e-51
Identity = 195/716 (27.23%), Postives = 309/716 (43.16%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSK-----NFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKG--KPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKY----YTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGS--QKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL-SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVI-DKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKD-EGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRAL-------TRQDMGVYILKMMVSDQG-------------------NPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQ 2976
            NDN P F        + E++  G  +  P A D+D        FN+    L  H H          + DS   +I       +DRE  S+Y+L L+A D    +P  S  + + I + D NDN P F+++TY V V E    G  +   +A D D GEN +V Y     ++   +  F I++ TG +S    L  +   +    YT  + A D G  +  SKA + V +      PP+++  +   +     +       K  + V  + P  G  G ++  + G      + V PN+   S  +    + LDYE  ++    I   D   P L S     + + D NDN+P+ E   Y+  V E      ++  V A+DRDS  NG + Y + +     F I   +G I +++  DRE+   Y   V A D G P  +G+A+VL+ + D+NDN P F  L     +   + EN    + +  + + D D G N    Y+F  +P EKF I P  G I     LDRE +   E+ ++V+   G  R E  +++T+   D+NDN P F    +   S     L  +  LV +I A D+D +GPNS + Y +       Q    +F +D   G++F ++A+        R    +Y L ++ +D G                   NPP+   A Y+  +   A R Q +  +  N  Q
Sbjct: 2485 NDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNL----LGEHMHRF--------HIDSETGEI--STATTLDREETSVYHLTLMAQDSSITEPRAS-SVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHY----TISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVIL-----RPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQ----DGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITE-SGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRL-----FSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQ--DEYILKVVASDGAWRAETPITITIQ--DQNDNAPEF---EHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSL-------QQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQ 3152          

HSP 4 Score: 200.675 bits (509), Expect = 3.969e-51
Identity = 189/697 (27.12%), Postives = 320/697 (45.91%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTD-AAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNN-------REG---------STWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARD--LGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK-FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVS----VTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFL-QRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            ND  P F    +T  I E++ I   +    AVD D      I Y + E  +  +    P   + + T  Q  L+++  +DRE  S Y LN+ A D+G+P  S + ++ I+ILD NDN P+F+   Y  +V E+   G ++L + ATD D G NG + Y   S V  +    F I   TG + +++ L+YE++  Y+  V A D   +  A   A + ++++D NDN P             T ++ P      Y   ++ +    NGG V   L  +      PP N       +EG         S+  I L++ LD E+++     +V  D G P LT +    + ++DINDN P+FE  SYH TV EN  +G  VL   ATD+D  LN K+ +++    +  F ID  TG I +  + DRE+ + Y L++ A+D  + EP ++ S N+ I+++D NDN P F       +Y   + E       +    A D D+G N  V YT     +  F I+   G++ T  +L  + K+  + +  ++   + + E S+S    +TV ++   +  P F    N  +   +S     G ++ ++ A    +G    + Y I  G   D  +     +D  +G + + Q  L  +   +Y + +  +D   P  +S     + + ++   +  +  + YN
Sbjct: 2161 NDEVPVFISANET-AIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQ--LRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRY---SIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRP-------------TFLDSP------YLARVMENTVPPNGGYV---LTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEP-RASSVNLTISVSDVNDNIPKFDST----TYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMAN--SHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLR-----VDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYN 2816          

HSP 5 Score: 197.593 bits (501), Expect = 3.456e-50
Identity = 174/632 (27.53%), Postives = 278/632 (43.99%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKV----------------------KYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRG-EPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF------LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVS---VTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISG 2745
            ND++P F        + E+ ++  +     A D D  +   ISY + E +   +F + P+           +L +  P+DRE    Y L +   D G+PS S  + + I ++D NDN P F NST+  ++ E+  +   +  L A D+D G N  + +  SS       + F ID+  G++      D E +                       Y        D+G      K  VKV V D NDN P    E++      T+ EG +      + V   D D G NG +     KG++        N + +T +++L   LD E + +   I+V  D   +  L+S+    I++ D NDN+P F   S   +V E +  G  +++  A+D D  +N ++ +SI + +    F ID +TG++      D E   SY L++ A D G P+ S +    + + D NDN P F       + + +IKE  P    I T+ A+DPD G+NG+V Y        L     F I+ + G+I T +++DRE+      +V   D+    +    +   VTV V D NDN P FV         K S    + T V ++ A D D   N  + Y+I+SG
Sbjct: 1043 NDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDG----------YLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQT-----QDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAP----EFLRAPYHVTISEGASE-GTHITHVFTQDADEGLNGDVYYSLAKGNEAGQF----NLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPST----AIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSG 1646          

HSP 6 Score: 192.2 bits (487), Expect = 1.497e-48
Identity = 182/667 (27.29%), Postives = 302/667 (45.28%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFN-IISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDK-DSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYF-QGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL--SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENS--VSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKD-EGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            NDN+P F     +    E  Q  A +   +A D D +  N +ISY L+     +F++ P      S    +  K  Q + R   +MY L ++ATD GKP L  +  + I I+DA++N P FE + Y+  + +  + G  I+ + A DK D G N +     + +++S     F +    GW+++ + +       Y   V A D G      +  V + V   N + P+  +     +  + ++     +      V  +D D+G  G+++  + G  +      + R G    I + + LDY+        I   D G   L+S     II+ D+NDN P+F H  YH  + EN   G  V +  A D+DS  N  I+Y+         +F ++   GTI S +SFD E+R  Y L + A++     +S  AN+ + +   N+  P F Q +     + F++ E       +G + A D D G +G+V Y  +  S  + F I  + G+I   + LDRE +     +V   + G +R  ++    V +S+ D ND  P F+     ST   IS     GT V  ++AIDKD    N+   Y II+GN +     + F +D + G+I     L R++   Y L +   D G PP+   A   I++++
Sbjct: 3007 NDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQ-QPSPMFSIDPATGEVFSK-KAVRFKHSQYV-RSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSS----IFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSV-----NSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGG---IVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMES-YANLYVHVLGVNEFYPQFLQPV-----FHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTST---ISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLK-----QSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELED 3643          

HSP 7 Score: 187.963 bits (476), Expect = 3.133e-47
Identity = 185/611 (30.28%), Postives = 272/611 (44.52%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK--GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHD---RGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSD-LNGKINYSIDSLSVSYFSIDPVTGTIRSKIS-------FDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDP-DEGINGQ--VLYTF-LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            +D E   +Y + + A D   PSL     I + + DANDN P+ E   Y   V E E    LI ++KA+D+DSG+NG V+Y   +D        F I  S G +     LD E++  Y F V A D G       A+V + ++D NDNPPK    +  +  +   I G   I      V  SD D G              +KF + P       +  I +   LD E+++     +V  D   R E  +T +      I+D NDN+P FEH  Y  +  E  Q+  +V +++ATDRD    N  I+YS+   S   FSIDP TG + SK +       + R     Y L+V A D G+P       V I I D ++N P F+       Y+  + ++      I  +HA D  D G N     L TF LS +  F++    G I   + +       +E  VR  D+G+  Q +   V + V  EN + PRF +   +S  V +   +  G+ +  + A D D GPN  L Y I  GN R   QD  F +D++ G I +Q+ L    +  Y L + V D G  P  S A   I + +        N+ +Y+
Sbjct: 2768 LDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDG----TFEITES-GEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEI-GSFVIR-----VTSSDLDLGANANASYSFSENPGEKFRIEP------QSGNITVAGHLDREQQDEYILKVVASDGAWRAETPITIT------IQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS-PMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFE----QAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSI--FSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSV---NSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNER---QD--FSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYH 3340          

HSP 8 Score: 187.193 bits (474), Expect = 6.054e-47
Identity = 189/674 (28.04%), Postives = 301/674 (44.66%), Query Frame = 1
Query:  955 NDNSPHF-----SQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDS-----------GKRTLIEGPTTINKEYSIVIVSDP-----DSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARD--LGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQ--GIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSV--KISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRK 2892
            NDN+P F     S+P  TI + E+  +G +I L    D D+   + ISY L N+ +  F + P             L L +PI  E  S+ ++ L+ATD G P LS KL + + I D ND+ P+F++++Y  ++ E+         L ATD D G+NG + Y      T  +   F      G+L +   LD E+  YY   V  RD+G  +  S   V + V+D NDN P+      T S           GK T ++     N E S  + S       D+ N G ++      ++ ++    N E S    +L  S+     N         D G P+L    + ++I+ D+NDN+P F    YH T+ E    G  +  V   D D  LNG + YS+   +    F++D  TG +      DRE +  + L V A+D  L  P  S +A++ I + D+NDN P F       S    + E  P+   +    A D D+G+N QV+++  +   + T H D   G +  ++ LD E+   +  ++   D G      +V   V V+D+NDN P F      ST++  +I       T +  + A D D G N  + Y  IS       Q + F ++ + G I   R + R+ +  + L ++ +D+  P  +
Sbjct:  936 NDNAPVFALDRESEP--TISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTG---------VLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVF----PDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRN-GFIKTLRPFDREALVKVSRNAEASGEDGSLRGSM---AGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSS-NASITIVVLDENDNAPEFT----QSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIF-----PSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYA-ISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSER 1579          

HSP 9 Score: 170.244 bits (430), Expect = 7.533e-42
Identity = 167/595 (28.07%), Postives = 264/595 (44.37%), Query Frame = 1
Query: 1165 FLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPP----KIYLEYVTDSGKRTLIEGPTTINKEYSIVI----VSDPDSGNGGLVQCDLKGS---QKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINY-SIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLG--EPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPD-EGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSH-LDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKS 2895
            ++ L++PI     + Y L + ATD+G P  S + ++ I +   N + P F  ++Y V V E+E  G  IL + ATD D+G NG++ Y  S       R+ F +D  TG + I + LDY+ ++ Y  N+  +D G     S A + + + D NDNPP    K Y  Y+ +             NK     +     +D DS    ++      S   + F ++  N   G+   I+   S DYEER +    I   +  +  + S     + +  +N+  P F  P +H  V E +  G  V  V ATD+DS  +G++ Y  + S +   F ID  TG I      DRE +    L+V A++ G      +  A V+I+I D ND   + +       Y   I E  P    + T+ A D D    N Q  Y+ ++    + F I    G I T  +LDRE  + +   +  ID G+  Q  S +V + + D NDN P F   T +  +  IS  + AGT +  + A D D   N     YQ+I G  +         +D+ +G +    +  R+   +    + V D G P +KS
Sbjct: 3180 WITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISG---GNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPE-------------NKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIM--NQSNGT---ISSAVSFDYEERRIYTLQIKAKNP-DSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHY-----YTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTF---TPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHK-----SWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKS 3739          

HSP 10 Score: 166.007 bits (419), Expect = 1.479e-40
Identity = 191/715 (26.71%), Postives = 304/715 (42.52%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATD------------------------------------KGKPSLSGKLKIEIKILDANDNQPIF--ENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFS----SDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNP----PKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGS----TWKINLVESLDYEERNVERFIIVCHDRG-EPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQA--GIVVLKVVATDRDS-DLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP-VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILR-QENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLD--TAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNG----DIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVI 2913
            NDN+P F     + E+ E++ I  ++    A D DS N  +I Y +   +      +      DS      ++  + +DRE+ S Y L + A D                                    + +  LS  +K+ I I D ND  P+F   N T I+   E+     +++ +KA D D G NG + Y        D+       F ++ + G L + + LD E    Y  N+ ARD G     +++ + + ++D NDN     PK Y   V ++          +I      V  +D D G  G ++         I++   N + S    T  + + ++L+YE  +     +   D   E     + E  I I DINDN P F    Y   V EN     G  VL V A D D+  LN ++ Y +       F I+  +G I      DRE+++ Y L++ A D G P  +G+  V + + D NDN P F+      SY   ++EN PS   + T  A D DEG+N ++ +  L   + +F I  + G I T   LDRE  +V+  ++   D  I   + +SV++T+SV D NDN P+F     DST+  ++  +  + G  V    A+D D+G N+ + Y I   + RDQ     F ++ K G     + L+      D   Y + +   DQG     S A   +
Sbjct: 2021 NDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGD------VDSEFGIDSNGT---IRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIM---ENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENA---------SIGAMVLQVSATDVDEGANGRIRYS-------IVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQ----SYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKF-----DSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI---SGRDQ---HYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV 2692          

HSP 11 Score: 164.081 bits (414), Expect = 5.652e-40
Identity = 178/675 (26.37%), Postives = 290/675 (42.96%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSK-NFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVR-KKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKAT---VKVSVVDCNDNPPK-IYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL-KGSQKFI----------LVP-PNNREGSTWKINLV---ESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPS-YHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--------YFSIDPVTGTIRSKISFDREKRAS-YQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE-KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            NDN+P F+Q    + + E+   G ++    A D D   N  ++      +    F       + DS    ++L   +P+D E+++ Y LN+ A+D G PSLS  +   + ++D NDN PIF ++  +  +KE       I+ + A D DSG NG V Y  S       + + F I++ TG +     +D E +  +   V+A D    +    +T   V V V D NDN P  + +       K +  +G +T   +   V   D DS + GLV  ++  G Q+              P P  ++   +++ L    E++  E R+ E +I +      P    S              P FE  S    +V EN   G  +L V A       + +I Y + +++ +         F ID   G + +    DRE     Y++ V+A  LG   ++    V +T+ D+ND+ P F        +++ + E+      I T+ A DPD    G V +  +   + KF + P  G +  N  LDRE K+ +E  +RV D G+  Q      T+ V D NDN P F    +   S  I      G  V +I A D D G N+ L Y ++S  + D     +F ++ + G + L   L  +++  YIL +   D G P
Sbjct: 1378 NDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTF-------HIDSITGSLYLH--KPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQ---VHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITII----TPGSGGSESSV----------PQFEQRSKLSGSVYENEPIGTSILTVTA----HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDT----PFVYNVSEDLQIGHTISTLRAHDPD--TLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSD-GV--QYTEAYATIQVSDTNDNPPLF---EDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWAND-----VFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQP 2005          

HSP 12 Score: 161.77 bits (408), Expect = 3.522e-39
Identity = 160/563 (28.42%), Postives = 263/563 (46.71%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLEN-HEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREG-----STWKINLVESLDYEERNVERFIIVCHDRGEPQL--TSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRD-SDLNGKINYSIDSLSVSY-FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYF--QGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVL-YTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDN 2598
            N ++P FS     + + E+  +G+ I    A D+D+    ++ Y +   +E   F++       D     I ++  Q +D + +  Y+LN+   D G   LS    + I + D NDN P+F +  Y   + E++  G  +    A DKDS +N ++ Y F    +   R  F ++ S G +S + + DYE+ + YT  + A++  +    S A + V V+  N+  P+ +L+ V        +   + +      V  +D DSG  G V         ++LV  +N +G     +T  I +   LD E +N     ++  + G  +   T   +  I I+D ND     +H  Y  T+ E    G  V  V A D+D    N + +YSI + ++   F ID  TG I +    DRE+ ++Y L + A D G P Q+GSA V I + D NDN P F  +GLNG       I EN P+   I T+ A DPD   NG    Y  +    K   ++  + G++R+    DRE   + E  + V D G  +Q++   +T++V+D+NDN
Sbjct: 3223 NMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSV-------DERTGGIVIQ--QQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLP--SGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSME-SYANLYVHVLGVNEFYPQ-FLQPVFHFD----VSETSAVGTRVGAVQATDKDSGEDGRVY--------YLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKH-YYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNG------YISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN 3753          

HSP 13 Score: 159.844 bits (403), Expect = 1.290e-38
Identity = 197/728 (27.06%), Postives = 321/728 (44.09%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTI---EISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKIL-----DANDNQPIFENSTYIV-NVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTS-----EVRKKFHIDSSTGWLSISETLDYEK-VKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS-LSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKG-------------------------ILRQE-----------NSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQ-DKI-FFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            NDN+P F      I   + S S      +    A D DS +  +++Y + +    LF L         T    F + ++         Y L L +TD+   S     ++ I I+      +  + P FE  + +  +V E+E  G  IL + A    S E    + YF ++VT+     +V + F ID+  G LS +  LD E   + Y   V A   G     S+  V+V+V+D ND+PP+       D+     +     I    S +   DPD+  G +    + G   KF+L P      ST K+ L ++LD E ++     I   D    Q T ++    +  D NDN P+FE   Y   + EN Q G  V ++VA D D   N +++Y + S  +   FS++P TG +      D E+   Y L V A+D G+P+ S +  V   + D NDN P F  +    SY  E+ EN P    + T+ A+D D G NG + Y+  +     +F I  + G IRT + LDRE+++ +  +V   D                             RQE           ++V VT+ + D ND  P F I  N++  ++   ++   T+V  ++A+D DEG N ++DY +      D  Q D + F ++  +G + +  AL R+    Y+L +   D+G PP+ + +  +I+I +    S   +  +Y+
Sbjct: 1595 NDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVR---------YQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA-HLASAE----IEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFL-----DTPFVYNVSEDLQIGHTISTLRAHDPDT-LGSVTFLLMDGHDGKFLLEP------STGKLILNDTLDRETKSKYELRIRVSD--GVQYTEAYATIQVS-DTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPM----SYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSN-GTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVF-ISANETAIMENVAIN---TVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYS 2284          

HSP 14 Score: 150.984 bits (380), Expect = 6.114e-36
Identity = 149/597 (24.96%), Postives = 254/597 (42.55%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEG--PTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXX-XXXRDINDNSPIFEHPSYH--------------QTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTI--RSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKE------NGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVS------VTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            +DRE +  YNL ++A D+G P+ +    + I + D ND++P+FE S Y   + E   +G  +  + ATD+D+G N  V Y     ++    K F +D  TG +  +  LD E       ++ ARD G +  F+   +KV ++D ND  P    ++       TL E   P TI    +++  +D D G  G V   L  S + +       +  T ++     LD E+ +     ++  D+G P   S+     + + D+NDN P F +P ++              + VE+      ++L V A+D+D   N  I Y ++S     F +D  +G I  R         +  Y+L V ARD G+      A V I +  + +     Q   GG  Y F++ E      N   N  +G +  +  +   N  + Y  +     + F I    G I T + LDRE +A +  ++            S        V +++ID NDN P F +      ++ +      G  +      D+D G NS + Y  ++ N   Q     F +    G ++LQR +  +   +  +++M +D G
Sbjct:  452 LDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDI---LSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAP----QFSQREQNVTLGEDAPPQTI---VALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQF-YPRHYIYSLADDDDDIKLKKEVEKER----ILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGG--YEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYS-LTNNPNQQ-----FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAG 1025          

HSP 15 Score: 67.0106 bits (162), Expect = 1.820e-10
Identity = 61/208 (29.33%), Postives = 93/208 (44.71%), Query Frame = 1
Query: 2320 FEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENS--VSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLD-YQIISGNSRDQTQDKIFFMDQKNGD---IFLQRA--LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            FE+ E  P    +G I  +        +  Y F  P  +FT+ P  G ++TN  LDRE    H       D  +L  + +  + V + V+D NDN P F  P   S ++  S   T+GT +    A D D G N   D Y+I++GN  ++   ++      +GD   + L+    L R+  G Y L +   D G+PPR  Y    + I
Sbjct:   71 FEVLEGQPRGTTVGFIPTKP-------KFSYRFNEPPREFTLDPVTGEVKTNVVLDREGMRDH------YDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPEP---SIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKF--RLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTI 260          

HSP 16 Score: 62.003 bits (149), Expect = 6.255e-9
Identity = 64/226 (28.32%), Postives = 97/226 (42.92%), Query Frame = 1
Query: 2116 FSIDPVTGTIRSKISFDREK-RASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQV---------------LYTFLSPVEKFT-IHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA--GTLVARIEAIDKDEGPNSHLDYQI 2736
            F++DPVTG +++ +  DRE  R  Y L V +     P +     V I + D NDN+P F       S      E+  S   +    A D D G NG                 L T  +P    + +H     + T   LDRE++  ++ ++   D G   +   + V V+++D NDN P F     D +   +S  +TA  GT V  + A D D G NS + Y +
Sbjct:  103 FTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYPIE-----VRIKVLDVNDNSPEFP----EPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLH-----LETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIF-----DHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL 309          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332722)

HSP 1 Score: 230.72 bits (587), Expect = 2.808e-60
Identity = 186/613 (30.34%), Postives = 286/613 (46.66%), Query Frame = 1
Query: 1168 LKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLK--ATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNRE----GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP-VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQN 2973
            L L Q +DRE    +NL ++A     P       + I + D NDN P F+N+ Y  +V E+  S  +I L+K  ATD D+G NG + YY  SD T  ++  F ID  +GW+++  +LD E    Y F VIA D+G     +K  V + +VD NDN P   L     S     + G   IN     +++ DPD           K    F +V  + +     G + ++ + + LD E+       I+  D    + T+    EI ++DINDN+P    P YH +  E+   G  +++V A D   D   K+ + +       FSI   +G ++   + DRE    Y+L    +D  +  Q   + ++IT+ D NDN P F        Y   + E+   N +I  +HA D D G+N Q+ Y+ +    + F I    GIIR ++ LDRE  ++   +V+  D G+ +  +  +V V+++D NDN P F +      S KI    T GT V ++ A   D G N+ + Y I+SGN + +     F MD   GD+ L   L  +    Y L +   D G PP  + A   I I    DNS    Q L  +  N++
Sbjct: 2812 LILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAEN--SEKVISLVKVSATDADTGPNGDIRYYLESD-TENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLIN-----LLLIDPDIE---------KQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDF--DFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF----SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSM---RQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGK-----FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNED 3390          

HSP 2 Score: 217.238 bits (552), Expect = 3.966e-56
Identity = 194/660 (29.39%), Postives = 305/660 (46.21%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEH-ALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK-GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDN--SPIFEHPSYHQTVEENNQAGIVVLKVVATDRDS-DLNGKINYSI---DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQ-QLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            N + P F    + + I+ES+Q+G  +    A D D      + + + + ++ ++F + P+            L+++  +DRE  + Y LN+   D G P+ S    + I ILD NDN+P+ + +     + ES   G ++  L ATD DSG N  V Y  S + +      F ++++TG L +++ LD EK   Y  ++ A+D G+    S+A V V V D NDN P   ++      +  L  G        +++   D D G    +Q  LK  +Q   L   +   G+   I     LDYE + V   I+   D G+P LTS     I+I D+N+N  +P F+   Y   V+EN   G  V+ V A D D+ DLN KI YSI   D L +  F+++   G+I S    D E +  Y L++ A+D      S    V I + ++NDN P    L     Y   + E    N  I T+ A DPD      + Y  +S   V  F I    G+I+T + +LDREN+A H   V + D G     ++  + VSV+D NDN P F         V++    T    + ++ AID D G N  + Y I SG  +++     F +D + G I + + L   +   + + +   D G P +   A
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGE---------LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSD-----FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTV-----LAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGA---IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI--FAVND-QGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIP----LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF---DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNK-----FRIDSQRGHIHIAKPLDSDNE--FEIHIKAEDNGIPKKSQTA 1386          

HSP 3 Score: 214.542 bits (545), Expect = 2.782e-55
Identity = 192/650 (29.54%), Postives = 297/650 (45.69%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAF-SKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSS--HXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE--KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPR 2889
            NDN P F     +  ++E+ +    +    A D D+     I Y LE+    +  +      FD  I   ++ LL  +DRE  S YN  +IA D G P    K+ + IKI+D NDN P+F+     ++V E+ + G +++ L   D D  +  +  +  S D     + +F I  S G L I++ LD E++ +Y  ++IA    TD  F +KA V++ V D NDN P         S   ++  G T +      V   D D  +        KG+  F +     +E    K+    +LD E     ++ +V H +     T     E  I + DINDN PIF    Y  +V E+ Q   ++ KV A D+D  +N +I YS+   +  YF I   TG IR   S DRE  + + L+V A D G P     A V + I D NDN P F        Y  +I EN      +  ++A   D G+N  + Y  +S  E  KF +    G +  N  LD E    +  +++ ID G     N+  V +S++D NDN P F+    +   + ++     G+ +  ++A D+D   N  + Y I  G++  Q     F +D KNG I + R L R+ +  Y L++   DQG+P R
Sbjct: 2854 NDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNI------FDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDK----QAQFQIGKS-GELFIAKPLDREQLMFYNLSIIA----TDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVE-----VKAIDFDFQSKLRFYLSGKGADDFSI----GKESGILKV--ASALDRE--TTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEF----SMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFL---QNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ-----FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQR 3463          

HSP 4 Score: 195.667 bits (496), Expect = 1.425e-49
Identity = 197/649 (30.35%), Postives = 287/649 (44.22%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREG------STWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSID-SLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF--LSPVEKFTIHPDQ-GIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            NDN+P+  +P   I  +ESI IG  +    A+D D ++   + + L       F++  E            LK+   +DRE    Y L     D    +     +I I + D NDN PIF  + Y V+V E      LI  + A DKD G N  + Y     +  E    F I  STG + + ++LD E +  +   V A D G     S ATV V+++D NDNPP+  +   +         G T + K Y+  I    D G    V  D+     FI+    N +G      +T  + L  +LDYE        I   D G P L+++    I I DINDNSP F    Y   V E+   G  +L V ATD DSD+NG + Y+I+   ++  FSIDP  GTI      DRE  + Y L + A D G+P +  S  + I I D NDN P F   N    Y   ++EN     +  T    D DE  N    YTF   S  E      +Q G +RT  + +   +      VRV D G     +   V V +I+E+   P   I T    ++     D +G  + ++ A D+D+     L++ ++SG        K+F +    G I+   A++  D+G+Y L + VSD
Sbjct: 3061 NDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQS--KLRFYLSGKGADDFSIGKESG---------ILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKY----SLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHG-TEVCKVYATSI----DIG----VNADI---HYFIM--SGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSN----YSVVLQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPP---IVTPLEVTINSFEDDFSGAFIGKVHASDQDK--YDELNFSLVSGPDDMYQSSKLFNISNNTGKIY---AISNLDIGLYKLNVSVSD 3667          

HSP 5 Score: 181.8 bits (460), Expect = 2.320e-45
Identity = 188/667 (28.19%), Postives = 295/667 (44.23%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSG--TDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYF-QGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSH-LDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQ 2934
            NDN+P F  P++ + + E+   G  +   L +D D +   +  + +   + A F +      F          + +P+DRE +  YNL++IATD GK   + K  +EI + D NDN P      Y ++  ES   G  ++ +KA D D      + +Y S     +    F I   +G L ++  LD E    Y      +D    T   FS+  + ++V D NDN P   +     +  R  +     +N   + V   D D G    ++  L G              ST  I L +SLD E  ++    +   D G P+L S     + I DINDN P F    Y   + EN   G  V KV AT  D  +N  I+Y I S +    F +D  TG +    + D E    Y L++ A D G P  S +A V I+I D NDN+P F Q L     Y   + E+    + I  + A D D  +NG V Y       + +F+I P  G I  ++ LDRE  + +   ++  D+G  ++ NSV + ++++D NDN P F   ++ + SV +      G +    +  D DE PN+    + I SGN     +  +F ++Q +G +             +++++ V D G PP  S A  V+KI   +Q
Sbjct: 2961 NDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELF----------IAKPLDREQLMFYNLSIIATD-GK--FTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSK--LRFYLSGKGADD----FSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSE--IIITVNDINDNMPIFSM-----AQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYF----KISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNL-----YRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIF---SSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGN-----EGGLFRLEQ-DGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQ 3583          

HSP 6 Score: 145.976 bits (367), Expect = 1.892e-34
Identity = 159/583 (27.27%), Postives = 259/583 (44.43%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIAT----DKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGT-----DAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGG----LVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARD---LGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF--LSPVEKFTIHPDQGIIRTNQQLDREN-KAVHEFSVRVIDKGI-LRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            ++RE    Y + + A     D+   S   +  I IK+LD ND  P+F  + Y V + E       IL + A D D G NG + Y    D      + F I  +TG +++ + L Y +  ++   V+A D G+     +   SK  V +SV   N   P+I+ +  +          PT+    Y IV V+D D+G  G    L   D      F+L     ++    ++N    L+ ++  +    ++  D G P+  +     I I+  + N PIF    Y  ++ E     + V+++  +D D   N  +   I        F I+P +G + +    D EK++SY L+V A D   +G   QS SA V I++ D NDN P F+ +N     +  I EN  + + +  + A+D D G N  + Y+   L+ V  F I    GI++T   LD E  K  +E  +R  D G+  R++  + +++ V D NDN P+F      +   K++     GT V    AID D G        IIS    D  +D  F +D  +G + +   L +  +   ILK+  +D
Sbjct:  137 LNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMD-----SEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSV-------TPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLN-QQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQS-SAKVKISVQDMNDNDPIFENVNK----VISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAV-PFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF---ERVNCYGKVTKSAPMGTEVFVTSAIDFDAG-------DIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 7 Score: 141.354 bits (355), Expect = 4.570e-33
Identity = 166/662 (25.08%), Postives = 284/662 (42.90%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDA---NDNQPIF--ENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV--EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFV-------IPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKS 2895
            NDNSP F Q V  +++  S  +   I    A+D DS     I+Y +++ +          + F     +  + + +P+D +N   + +++ A D G P  S   ++ I ++     + N P+   + S  +V++ E++  G L+  + A D D+ +    ++Y  S+   +    F+I    G + +S+ LDYE  + Y   +   D GT  AF+   V+V  +D NDNPP    ++  D     + E    I +E  I+ +   D      +   L  +Q    +     +  +  + + + LD+E+      I+   D+G P   +  +  + + D ND+ P F        V E+   G  + +V A DRDS  N +I YSI + +V S F IDP  G I    + +  K   Y L V A DLG P  S    V I +T   ++ P F   N       EI EN P    +  + A       +  + +  +S    E F I+P  G+I  N  +D E+  V  F++ V    +  + +  ++ + ++D NDN P FV       +P + +    +  +  +      ++  D D G N  ++Y I+     D      F +D   G I L R L  +    Y   + VSD G P   S
Sbjct: 1293 NDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGK--------NKFRIDSQRGHIHIAKPLDSDN--EFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQ----LWYNISNGNDD--NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD-GTFTAFTNLLVQV--IDINDNPP----QFAKDVYHVNISEN---IEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNN----IAIEIFENLPIGTFVTQVTARS-----SSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKV--FNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIV-----DDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHS 1912          

HSP 8 Score: 140.584 bits (353), Expect = 7.769e-33
Identity = 172/683 (25.18%), Postives = 309/683 (45.24%), Query Frame = 1
Query:  982 PVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENH----EHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSG---KLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI----YLEYVTDSGKR-TLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL------SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA--GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            P++   I  S+ +  K    ++V ED + ++ +S  +E         ++T+  E  +F+   N   + ++  +D E +S +++++ ATD    SLSG   ++ + + I+D ND  P  E+  Y + + E+   G  IL + ATD DSG N  + YY  S       + F+ID + G L +   LDYE++KY+   V  +D G+ +  S++ V ++V D NDN P      Y   V+ +  R   +  P   +K+     +SD DS    +V  +   +           +  T  I+L   L++ +++     I   D      T+    +I +   N  SP+F+  +Y   V EN   G  ++ V A+D D      + Y I S  +   F ID  TG I SK++FDREK+  Y + +   D G   + G A++ + + D NDN PYF        Y   +     +N  I T+ A+D D   NG V +  +      +  +   I+   G I    + +      ++F VR  D+G  +  + V V++ +I+ + N     IPT + +SV +  +++   GT++ ++  I      N    + I +        D+  FM   +G++ LQ+ L R+    + L ++      P   +YA+ +I + +        +N  Y+
Sbjct: 2228 PLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATD----SLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKD-----ISDTDSLEYKIVYGNELQTYSI--------DKLTGVISLQNMLNFTDKSSTVLNISVSDGVH---TAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG--GKFGFASLKVIVVDVNDNVPYFL----LKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDAN-----IPTFEKSSVLLKIIESTPPGTVLTKLHMIG-----NYTFKFSIAA--------DQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYS 2866          

HSP 9 Score: 137.887 bits (346), Expect = 5.346e-32
Identity = 169/603 (28.03%), Postives = 268/603 (44.44%), Query Frame = 1
Query: 1141 FDSTINQIFLKLLQPI-DRENVSMYNLNLIATDKGKPSLSGKLK-----IEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKK----FHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVS-DPDSGNG-GLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHD---RGEPQLTSSHXX---XXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSL----SVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL--SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            FD  I+   LK    I DRE   +Y L + A       ++  ++     I+I +LD NDN P+F N  Y   V   +  G +I+ +KA D DS ENG V Y        E++K     F +D  +G LSI + ++    + Y   V A D       S+A ++V V+D   + P    ++ T S K  +        + YS + VS + +S  G  L+      SQ F +      + +T  I +V  LDYE+       I  HD   R    L+  + E    + I D+ND  P  E   Y+ T+ EN   G  +LK+ ATD DS  N K++Y I+S+    +   F ID   G +  K   D E+   + + V  +D G P+ S  +NV IT+ D NDN P F       SY  ++         +    A D D      + Y  +  + ++ ++I    G+I     L+  +K+    ++ V D G+        + +S++ EN   P F   T ++  V  + L   G  +  ++A D D G  ++L Y+I+S     +   KIF +DQ  G I  +    R+    Y++ + VSD G
Sbjct: 2077 FDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRY--------ELKKGNGELFKLDRKSGELSIKQHVEGHN-RNYELTVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDV--------EMYSALSVSIEAESPLGRSLIYTISSESQSFEI------DYNTGSIFVVNELDYEK-------ISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFV----EPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSD-GV--HTAYARLKISLLPENVYSPLFDQSTYEA-QVPENLLH--GHNIITVKASDGDFGTYANLYYEIVS-----EEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG 2632          

HSP 10 Score: 130.568 bits (327), Expect = 9.572e-30
Identity = 176/678 (25.96%), Postives = 282/678 (41.59%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLEN----HEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIV--SDPDSGNGGLVQCDLKGSQ--KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-----DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQ--------GIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVA--RIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            ND  P     +  + I E+   G +I    A D DS     +SY +E+    +   LF +       D T   ++LK   P+D E +  +++ +   D G PSLS +  + I + D NDN P F   +Y   V  + + G  + L KA DKD  +   + Y     V     + + ID  TG +S+   L++        N+   D G   A+++  +K+S++     P  +Y      S     +  P  +   ++I+ V  SD D G    +  ++   +  K  L+     + +T  I    + D E+++    ++   D G     +S   ++I+ D+NDN P F    Y   V    +A   +L V A D D   NG +++ I     D        I+  TG I  K   +     SYQ  V A D GEP       V I I + + N P F+      S + +I E+ P   ++  +H       + G   YTF     KF+I  DQ        G +   Q LDRE +  H   V      +        V + V DENDN P+F     D+T    S  + +  +++  ++ A D D GPN  + Y + S     Q    IF +D  +G I L  +L R+    Y  K++ +D G+P   +     IKI
Sbjct: 2335 NDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYI-------DVTDGNLYLK--TPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKI---VYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSD-GVHTAYAR--LKISLL-----PENVYSPLFDQSTYEAQV--PENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLI-----DQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFAS--LKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFE----KSSVLLKIIESTPPGTVLTKLH-------MIGN--YTF-----KFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKF-----DNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQ---NIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKI 2957          

HSP 11 Score: 117.472 bits (293), Expect = 7.747e-26
Identity = 158/575 (27.48%), Postives = 238/575 (41.39%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVD--EDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPK-----IYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKV----------VATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPA--QSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPD------EGINGQVLYTFLSPVEKFTIHPDQGIIRTN--QQLDRENKAVHEFSVRVIDKGILRQENSVSVTV-SVIDEN 2592
            NDN P F++ V  + ISE+I+  + I    A D  ED K F  +    +    ALF +       DS    + +   Q +D E  + + L +   D+G P      KI + + D ND+ P F        V ES   G  +  ++A D+DSG N  + Y   S +T  V   F ID + G ++++  L+  K++ Y   V A D G     S+  V + V    ++PPK     I +E   +    T +   T +    S  I  +  SGN          ++ F + P      ST  I +  ++DYE  +++ F +          +S     I I D NDN P F    Y   + E+   G  VLKV             D D  +NG + Y I D L+ ++F ID  TG I      D E  A Y   V   D+G+P    + +A+V I + + ND  P F       +      E    N  +  + A+D D      + ++G     F   +EK+T     GII T   + L+ EN   +   VR  D GI      V + V S ID N
Sbjct: 1500 NDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRI-------DSISGNVIVT--QRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQY---SIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFV---TQVTARSSSSIFFNIISGNI---------NESFRINP------STGVIVINGNIDYE--SIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFE----NVFVRQVSAKDADNDTLRFDIVDGNTNECF--QIEKYT-----GIITTRNFEILNNENDRDYALHVRASD-GIFSAILIVKIKVLSAIDSN 2030          

HSP 12 Score: 97.4413 bits (241), Expect = 1.189e-19
Identity = 119/435 (27.36%), Postives = 197/435 (45.29%), Query Frame = 1
Query: 1168 LKLLQPIDRENVSMYNLNLIATDKG-----KPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLIL-LLKATDKDSGENG----LVMYYFSSDVT-----SEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKIN-------LVESLDYEERNVERFIIVCHDRGE--PQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIR--SKISFDREKRASYQLSVFARDLGEPAQSGSANVL-ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEG 2391
            + LLQ +     S + L ++A D+G     +   + K K+ I +   N   P     T+      +  S  LI  +++  DKD+G NG    L +   + D T     +E + +++I+     L+    L+ +    Y   ++A D GT   F+  +V + +   + N P    E    S   T       IN     + VSDPD G   LV  ++ G            EG  ++IN         + LD E+++     +   D+     +  SS + +I ++D+NDN PIFE+ +   ++ ENN AG  V+K+ A DRDS  N  I+YSI +L+   F ID  +G ++  S + F+  KR +Y+L + A D G P +  +   L I + D NDN P F+ +N  G    ++ ++ P    +    A D D G
Sbjct:  238 ITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTF---SSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIE-----LNQFAHLNQQHF-IYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPET-----APINMPVIRLKVSDPDLGKNALVYLEIVGGN----------EGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKR-NYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYG----KVTKSAPMGTEVFVTSAIDFDAG 643          

HSP 13 Score: 77.411 bits (189), Expect = 1.148e-13
Identity = 92/345 (26.67%), Postives = 145/345 (42.03%), Query Frame = 1
Query: 1975 FEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS------YFSIDPVTG-----TIRSK---ISFDREKRASYQLSVFAR----DLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGIL-----RQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAI-DKDEGPNSHLD-YQIISGNSRDQTQDKIFFMD--QKNGDIFL---QRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            F H  Y+ T+ EN+  G    K V  +R + L   +N  +    +S      + + + + G      IR++   +  +REK   Y + V A     D    +    AN+ I + D+ND +P F        Y   I E+ P    I  + A+D D GING++ Y+ L   E F IHP  G I   QQL     +  E +V   D+G        Q +   V++SV   N   P     T  S +       T+  L+  I  + DKD G N ++   +I+ GN      D  F +   +   + ++   Q A   Q   +Y L ++  D G P R +Y +  I+I
Sbjct:   62 FSHSVYNVTIPENS-LGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQ----YTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVT------PTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNP-----DGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQI 390          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 230.72 bits (587), Expect = 2.854e-60
Identity = 186/613 (30.34%), Postives = 286/613 (46.66%), Query Frame = 1
Query: 1168 LKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLK--ATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNRE----GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP-VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQN 2973
            L L Q +DRE    +NL ++A     P       + I + D NDN P F+N+ Y  +V E+  S  +I L+K  ATD D+G NG + YY  SD T  ++  F ID  +GW+++  +LD E    Y F VIA D+G     +K  V + +VD NDN P   L     S     + G   IN     +++ DPD           K    F +V  + +     G + ++ + + LD E+       I+  D    + T+    EI ++DINDN+P    P YH +  E+   G  +++V A D   D   K+ + +       FSI   +G ++   + DRE    Y+L    +D  +  Q   + ++IT+ D NDN P F        Y   + E+   N +I  +HA D D G+N Q+ Y+ +    + F I    GIIR ++ LDRE  ++   +V+  D G+ +  +  +V V+++D NDN P F +      S KI    T GT V ++ A   D G N+ + Y I+SGN + +     F MD   GD+ L   L  +    Y L +   D G PP  + A   I I    DNS    Q L  +  N++
Sbjct: 2812 LILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAEN--SEKVISLVKVSATDADTGPNGDIRYYLESD-TENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLIN-----LLLIDPDIE---------KQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDF--DFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF----SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSM---RQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGK-----FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNED 3390          

HSP 2 Score: 217.238 bits (552), Expect = 4.100e-56
Identity = 194/660 (29.39%), Postives = 305/660 (46.21%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEH-ALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK-GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDN--SPIFEHPSYHQTVEENNQAGIVVLKVVATDRDS-DLNGKINYSI---DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQ-QLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            N + P F    + + I+ES+Q+G  +    A D D      + + + + ++ ++F + P+            L+++  +DRE  + Y LN+   D G P+ S    + I ILD NDN+P+ + +     + ES   G ++  L ATD DSG N  V Y  S + +      F ++++TG L +++ LD EK   Y  ++ A+D G+    S+A V V V D NDN P   ++      +  L  G        +++   D D G    +Q  LK  +Q   L   +   G+   I     LDYE + V   I+   D G+P LTS     I+I D+N+N  +P F+   Y   V+EN   G  V+ V A D D+ DLN KI YSI   D L +  F+++   G+I S    D E +  Y L++ A+D      S    V I + ++NDN P    L     Y   + E    N  I T+ A DPD      + Y  +S   V  F I    G+I+T + +LDREN+A H   V + D G     ++  + VSV+D NDN P F         V++    T    + ++ AID D G N  + Y I SG  +++     F +D + G I + + L   +   + + +   D G P +   A
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGE---------LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSD-----FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTV-----LAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGA---IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI--FAVND-QGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIP----LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF---DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNK-----FRIDSQRGHIHIAKPLDSDNE--FEIHIKAEDNGIPKKSQTA 1386          

HSP 3 Score: 214.157 bits (544), Expect = 2.876e-55
Identity = 192/650 (29.54%), Postives = 297/650 (45.69%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAF-SKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSS--HXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE--KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPR 2889
            NDN P F     +  ++E+ +    +    A D D+     I Y LE+    +  +      FD  I   ++ LL  +DRE  S YN  +IA D G P    K+ + IKI+D NDN P+F+     ++V E+ + G +++ L   D D  +  +  +  S D     + +F I  S G L I++ LD E++ +Y  ++IA    TD  F +KA V++ V D NDN P         S   ++  G T +      V   D D  +        KG+  F +     +E    K+    +LD E     ++ +V H +     T     E  I + DINDN PIF    Y  +V E+ Q   ++ KV A D+D  +N +I YS+   +  YF I   TG IR   S DRE  + + L+V A D G P     A V + I D NDN P F        Y  +I EN      +  ++A   D G+N  + Y  +S  E  KF +    G +  N  LD E    +  +++ ID G     N+  V +S++D NDN P F+    +   + ++     G+ +  ++A D+D   N  + Y I  G++  Q     F +D KNG I + R L R+ +  Y L++   DQG+P R
Sbjct: 2854 NDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNI------FDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDK----QAQFQIGKS-GELFIAKPLDREQLMFYNLSIIA----TDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVE-----VKAIDFDFQSKLRFYLSGKGADDFSI----GKESGILKV--ASALDRE--TTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQ----YSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFL---QNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ-----FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQR 3463          

HSP 4 Score: 195.667 bits (496), Expect = 1.377e-49
Identity = 197/649 (30.35%), Postives = 287/649 (44.22%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREG------STWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSID-SLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF--LSPVEKFTIHPDQ-GIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            NDN+P+  +P   I  +ESI IG  +    A+D D ++   + + L       F++  E            LK+   +DRE    Y L     D    +     +I I + D NDN PIF  + Y V+V E      LI  + A DKD G N  + Y     +  E    F I  STG + + ++LD E +  +   V A D G     S ATV V+++D NDNPP+  +   +         G T + K Y+  I    D G    V  D+     FI+    N +G      +T  + L  +LDYE        I   D G P L+++    I I DINDNSP F    Y   V E+   G  +L V ATD DSD+NG + Y+I+   ++  FSIDP  GTI      DRE  + Y L + A D G+P +  S  + I I D NDN P F   N    Y   ++EN     +  T    D DE  N    YTF   S  E      +Q G +RT  + +   +      VRV D G     +   V V +I+E+   P   I T    ++     D +G  + ++ A D+D+     L++ ++SG        K+F +    G I+   A++  D+G+Y L + VSD
Sbjct: 3061 NDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQS--KLRFYLSGKGADDFSIGKESG---------ILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKY----SLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHG-TEVCKVYATSI----DIG----VNADI---HYFIM--SGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSN----YSVVLQENRLLGYVFLTFKISDADETPN-TTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPP---IVTPLEVTINSFEDDFSGAFIGKVHASDQDK--YDELNFSLVSGPDDMYQSSKLFNISNNTGKIY---AISNLDIGLYKLNVSVSD 3667          

HSP 5 Score: 181.8 bits (460), Expect = 2.205e-45
Identity = 188/667 (28.19%), Postives = 295/667 (44.23%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSG--TDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYF-QGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSH-LDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQ 2934
            NDN+P F  P++ + + E+   G  +   L +D D +   +  + +   + A F +      F          + +P+DRE +  YNL++IATD GK   + K  +EI + D NDN P      Y ++  ES   G  ++ +KA D D      + +Y S     +    F I   +G L ++  LD E    Y      +D    T   FS+  + ++V D NDN P   +     +  R  +     +N   + V   D D G    ++  L G              ST  I L +SLD E  ++    +   D G P+L S     + I DINDN P F    Y   + EN   G  V KV AT  D  +N  I+Y I S +    F +D  TG +    + D E    Y L++ A D G P  S +A V I+I D NDN+P F Q L     Y   + E+    + I  + A D D  +NG V Y       + +F+I P  G I  ++ LDRE  + +   ++  D+G  ++ NSV + ++++D NDN P F   ++ + SV +      G +    +  D DE PN+    + I SGN     +  +F ++Q +G +             +++++ V D G PP  S A  V+KI   +Q
Sbjct: 2961 NDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELF----------IAKPLDREQLMFYNLSIIATD-GK--FTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSK--LRFYLSGKGADD----FSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSE--IIITVNDINDNMPIFSM-----AQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYF----KISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNL-----YRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIF---SSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGN-----EGGLFRLEQ-DGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQ 3583          

HSP 6 Score: 145.976 bits (367), Expect = 1.813e-34
Identity = 159/583 (27.27%), Postives = 260/583 (44.60%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIAT----DKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGT-----DAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGG----LVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS-YFSIDPVTGTIRSKISFDREKRASYQLSVFARD---LGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF--LSPVEKFTIHPDQGIIRTNQQLDREN-KAVHEFSVRVIDKGI-LRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            ++RE    Y + + A     D+   S   +  I IK+LD ND  P+F  + Y V + E       IL + A D D G NG + Y    D      + F I  +TG +++ + L Y +  ++   V+A D G+     +   SK  V +SV   N   P+I+ +  +          PT+    Y IV V+D D+G  G    L   D      F+L     ++    ++N    L+ ++  +    ++  D G P+  +     I I+  + N PIF    Y  ++ E     + V+++  +D D   N  +   I   +    F I+P +G + +    D EK++SY L+V A D   +G   QS SA V I++ D NDN P F+ +N     +  I EN  + + +  + A+D D G N  + Y+   L+ V  F I    GI++T   LD E  K  +E  +R  D G+  R++  + +++ V D NDN P+F      +   K++     GT V    AID D G        IIS    D  +D  F +D  +G + +   L +  +   ILK+  +D
Sbjct:  137 LNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMD-----SEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSV-------TPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLN-QQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQS-SAKVKISVQDMNDNDPIFENVNK----VISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAV-PFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF---ERVNCYGKVTKSAPMGTEVFVTSAIDFDAG-------DIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 7 Score: 141.354 bits (355), Expect = 4.805e-33
Identity = 166/662 (25.08%), Postives = 284/662 (42.90%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDA---NDNQPIF--ENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV--EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFV-------IPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKS 2895
            NDNSP F Q V  +++  S  +   I    A+D DS     I+Y +++ +          + F     +  + + +P+D +N   + +++ A D G P  S   ++ I ++     + N P+   + S  +V++ E++  G L+  + A D D+ +    ++Y  S+   +    F+I    G + +S+ LDYE  + Y   +   D GT  AF+   V+V  +D NDNPP    ++  D     + E    I +E  I+ +   D      +   L  +Q    +     +  +  + + + LD+E+      I+   D+G P   +  +  + + D ND+ P F        V E+   G  + +V A DRDS  N +I YSI + +V S F IDP  G I    + +  K   Y L V A DLG P  S    V I +T   ++ P F   N       EI EN P    +  + A       +  + +  +S    E F I+P  G+I  N  +D E+  V  F++ V    +  + +  ++ + ++D NDN P FV       +P + +    +  +  +      ++  D D G N  ++Y I+     D      F +D   G I L R L  +    Y   + VSD G P   S
Sbjct: 1293 NDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGK--------NKFRIDSQRGHIHIAKPLDSDN--EFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQ----LWYNISNGNDD--NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD-GTFTAFTNLLVQV--IDINDNPP----QFAKDVYHVNISEN---IEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNN----IAIEIFENLPIGTFVTQVTARS-----SSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKV--FNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIV-----DDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHS 1912          

HSP 8 Score: 140.584 bits (353), Expect = 7.446e-33
Identity = 173/683 (25.33%), Postives = 312/683 (45.68%), Query Frame = 1
Query:  982 PVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENH----EHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSG---KLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI----YLEYVTDSGKR-TLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL------SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA--GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            P++   I  S+ +  K    ++V ED + ++ +S  +E         ++T+  E  +F+   N   + ++  +D E +S +++++ ATD    SLSG   ++ + + I+D ND  P  E+  Y + + E+   G  IL + ATD DSG N  + YY  S       + F+ID + G L +   LDYE++KY+   V  +D G+ +  S++ V ++V D NDN P      Y   V+ +  R   +  P   +K+     +SD DS    +V     G++    +   + +  T  I+L   L++ +++     I   D      T+    +I +   N  SP+F+  +Y   V EN   G  ++ V A+D D      + Y I S  +   F ID  TG I SK++FDREK+  Y + +   D G   + G A++ + + D NDN PYF        Y   +     +N  I T+ A+D D   NG V +  +      +  +   I+   G I    + +      ++F VR  D+G  +  + V V++ +I+ + N     IPT + +SV +  +++   GT++ ++  I      N    + I +        D+  FM   +G++ LQ+ L R+    + L ++      P   +YA+ +I + +        +N  Y+
Sbjct: 2228 PLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATD----SLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKD-----ISDTDSLEYKIVY----GNE----LQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVH---TAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG--GKFGFASLKVIVVDVNDNVPYFL----LKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDAN-----IPTFEKSSVLLKIIESTPPGTVLTKLHMIG-----NYTFKFSIAA--------DQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYS 2866          

HSP 9 Score: 137.887 bits (346), Expect = 5.622e-32
Identity = 169/603 (28.03%), Postives = 268/603 (44.44%), Query Frame = 1
Query: 1141 FDSTINQIFLKLLQPI-DRENVSMYNLNLIATDKGKPSLSGKLK-----IEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKK----FHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVS-DPDSGNG-GLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHD---RGEPQLTSSHXX---XXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSL----SVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL--SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            FD  I+   LK    I DRE   +Y L + A       ++  ++     I+I +LD NDN P+F N  Y   V   +  G +I+ +KA D DS ENG V Y        E++K     F +D  +G LSI + ++    + Y   V A D       S+A ++V V+D   + P    ++ T S K  +        + YS + VS + +S  G  L+      SQ F +      + +T  I +V  LDYE+       I  HD   R    L+  + E    + I D+ND  P  E   Y+ T+ EN   G  +LK+ ATD DS  N K++Y I+S+    +   F ID   G +  K   D E+   + + V  +D G P+ S  +NV IT+ D NDN P F       SY  ++         +    A D D      + Y  +  + ++ ++I    G+I     L+  +K+    ++ V D G+        + +S++ EN   P F   T ++  V  + L   G  +  ++A D D G  ++L Y+I+S     +   KIF +DQ  G I  +    R+    Y++ + VSD G
Sbjct: 2077 FDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRY--------ELKKGNGELFKLDRKSGELSIKQHVEGHN-RNYELTVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDV--------EMYSALSVSIEAESPLGRSLIYTISSESQSFEI------DYNTGSIFVVNELDYEK-------ISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFV----EPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSD-GV--HTAYARLKISLLPENVYSPLFDQSTYEA-QVPENLLH--GHNIITVKASDGDFGTYANLYYEIVS-----EEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG 2632          

HSP 10 Score: 130.568 bits (327), Expect = 9.489e-30
Identity = 176/678 (25.96%), Postives = 282/678 (41.59%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLEN----HEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIV--SDPDSGNGGLVQCDLKGSQ--KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-----DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQ--------GIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVA--RIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            ND  P     +  + I E+   G +I    A D DS     +SY +E+    +   LF +       D T   ++LK   P+D E +  +++ +   D G PSLS +  + I + D NDN P F   +Y   V  + + G  + L KA DKD  +   + Y     V     + + ID  TG +S+   L++        N+   D G   A+++  +K+S++     P  +Y      S     +  P  +   ++I+ V  SD D G    +  ++   +  K  L+     + +T  I    + D E+++    ++   D G     +S   ++I+ D+NDN P F    Y   V    +A   +L V A D D   NG +++ I     D        I+  TG I  K   +     SYQ  V A D GEP       V I I + + N P F+      S + +I E+ P   ++  +H       + G   YTF     KF+I  DQ        G +   Q LDRE +  H   V      +        V + V DENDN P+F     D+T    S  + +  +++  ++ A D D GPN  + Y + S     Q    IF +D  +G I L  +L R+    Y  K++ +D G+P   +     IKI
Sbjct: 2335 NDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYI-------DVTDGNLYLK--TPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKI---VYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSD-GVHTAYAR--LKISLL-----PENVYSPLFDQSTYEAQV--PENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLI-----DQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFAS--LKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFE----KSSVLLKIIESTPPGTVLTKLH-------MIGN--YTF-----KFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKF-----DNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQ---NIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKI 2957          

HSP 11 Score: 117.857 bits (294), Expect = 7.616e-26
Identity = 158/575 (27.48%), Postives = 238/575 (41.39%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVD--EDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPK-----IYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKV----------VATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPA--QSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPD------EGINGQVLYTFLSPVEKFTIHPDQGIIRTN--QQLDRENKAVHEFSVRVIDKGILRQENSVSVTV-SVIDEN 2592
            NDN P F++ V  + ISE+I+  + I    A D  ED K F  +    +    ALF +       DS    + +   Q +D E  + + L +   D+G P      KI + + D ND+ P F        V ES   G  +  ++A D+DSG N  + Y   S +T  V   F ID + G ++++  L+  K++ Y   V A D G     S+  V + V    ++PPK     I +E   +    T +   T +    S  I  +  SGN          ++ F + P      ST  I +  ++DYE  +++ F +          +S     I I D NDN P F    Y   + E+   G  VLKV             D D  +NG + Y I D L+ ++F ID  TG I      D E  A Y   V   D+G+P    + +A+V I + + ND  P F       +      E    N  +  + A+D D      + ++G     F   +EK+T     GII T   + L+ EN   +   VR  D GI      V + V S ID N
Sbjct: 1500 NDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRI-------DSISGNVIVT--QRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQY---SIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFV---TQVTARSSSSIFFNIISGNI---------NESFRINP------STGVIVINGNIDYE--SIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFE----NVFVRQVSAKDADNDTLRFDIVDGNTNECF--QIEKYT-----GIITTRNFEILNNENDRDYALHVRASD-GIFSAILIVKIKVLSAIDSN 2030          

HSP 12 Score: 97.4413 bits (241), Expect = 1.178e-19
Identity = 119/435 (27.36%), Postives = 197/435 (45.29%), Query Frame = 1
Query: 1168 LKLLQPIDRENVSMYNLNLIATDKG-----KPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLIL-LLKATDKDSGENG----LVMYYFSSDVT-----SEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKIN-------LVESLDYEERNVERFIIVCHDRGE--PQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIR--SKISFDREKRASYQLSVFARDLGEPAQSGSANVL-ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEG 2391
            + LLQ +     S + L ++A D+G     +   + K K+ I +   N   P     T+      +  S  LI  +++  DKD+G NG    L +   + D T     +E + +++I+     L+    L+ +    Y   ++A D GT   F+  +V + +   + N P    E    S   T       IN     + VSDPD G   LV  ++ G            EG  ++IN         + LD E+++     +   D+     +  SS + +I ++D+NDN PIFE+ +   ++ ENN AG  V+K+ A DRDS  N  I+YSI +L+   F ID  +G ++  S + F+  KR +Y+L + A D G P +  +   L I + D NDN P F+ +N  G    ++ ++ P    +    A D D G
Sbjct:  238 ITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTF---SSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIE-----LNQFAHLNQQHF-IYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPET-----APINMPVIRLKVSDPDLGKNALVYLEIVGGN----------EGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKR-NYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYG----KVTKSAPMGTEVFVTSAIDFDAG 643          

HSP 13 Score: 77.411 bits (189), Expect = 1.187e-13
Identity = 92/345 (26.67%), Postives = 145/345 (42.03%), Query Frame = 1
Query: 1975 FEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS------YFSIDPVTG-----TIRSK---ISFDREKRASYQLSVFAR----DLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGIL-----RQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAI-DKDEGPNSHLD-YQIISGNSRDQTQDKIFFMD--QKNGDIFL---QRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            F H  Y+ T+ EN+  G    K V  +R + L   +N  +    +S      + + + + G      IR++   +  +REK   Y + V A     D    +    AN+ I + D+ND +P F        Y   I E+ P    I  + A+D D GING++ Y+ L   E F IHP  G I   QQL     +  E +V   D+G        Q +   V++SV   N   P     T  S +       T+  L+  I  + DKD G N ++   +I+ GN      D  F +   +   + ++   Q A   Q   +Y L ++  D G P R +Y +  I+I
Sbjct:   62 FSHSVYNVTIPENS-LGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQ----YTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVT------PTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNP-----DGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQI 390          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 350.517 bits (898), Expect = 3.030e-101
Identity = 256/747 (34.27%), Postives = 372/747 (49.80%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDIRVKK-PIDRESL--CGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNRE---GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI   + PIDRE+L  C + GK C    F  FE+ V   +               + +  +   RI++ DINDN+P F  PV T+ + E+  +GA   +PLA D+D++   +  Y L     A  LF L       +     I L  L   DRE    Y+L + A D G P       + + I DANDN P FE S+Y   V E+   GH +L +KA D D G NG + Y     +   V K   ID S+G + +   LD E++    F V+ARD G     SK  V + V D NDN P + +     VT S     I     +    ++V VSD D G   +V C + G   F L P ++        + +     LDYE     R  IV  D G P L+S++  ++ + D NDNSPIF    +     E NQ G  V++VVA+D DS  N ++ YSI  DS +   F IDP +G +R++   DRE +  Y+  V A D G P+  G+A V+I + D+NDN P F  L+G   Y F + EN P  + +G +  +D DEG N QV  +    V KF I    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN P    P+N S+ +++S +    ++V  +EA D D G N+ L Y I  GN  D     +F++   NG+I L + LTR+  G++ L + VSD+G P R + A
Sbjct:   55 YKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPC----FLEFEVSVTDLI--------------QNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSL---DRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAI-DPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFM-LSG---YSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSN-SSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHD-----LFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIA 769          

HSP 2 Score: 171.4 bits (433), Expect = 1.522e-42
Identity = 151/578 (26.12%), Postives = 246/578 (42.56%), Query Frame = 1
Query: 1276 IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK---FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            I++ D NDN P F +    ++V E+   G L  +  ATDKD+  NG+  Y  ++   +       +    G     L +  +LD E    Y   + A D G    +S A ++V + D NDN PK        S     +   + I      V  +D D G  G ++  L   Q    VP   R + S+  I +   LD EE N  +F +V  D+G    +S     I + D NDN+P  E        H      + E+   G  V  V  +D+D   N  +   +       F + P + +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDN+P F         +FE+   +EN P   ++  + A D D G N +++Y+ ++       F I P+ G +R    LDRE+K  +EF V   DKG+     + +V + V+D NDN+P+F++     +    S L+    L  V  +   D DEG N+ +   +     +       F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKF-----EKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLH--QAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVV--AGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFS------PTLFEVEFAEENQPGEKVVEVV-ASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML-----SGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGK-------FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINV 668          

HSP 3 Score: 119.783 bits (299), Expect = 1.212e-26
Identity = 112/365 (30.68%), Postives = 171/365 (46.85%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS--LSVSYFSIDPVTGTIRSKI-------SFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF---LSPVEKFT-IHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIP-----TNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRA--LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQ 2970
            +DINDN+P F  P    +V EN   G +    +ATD+D++ NG  +Y++ +   +V+ F +  V      K+       S DRE + SY L++ A D G P +  SA + + I D NDN P F+      SY  E+ EN P    +  + A D D G NG++ YT    + PV K   I    GII     LDRE     +F V   DKG   + +   V++ V D+NDN P   I      T+      IS     GT VA ++  DKDEG N+ +   +++G+   Q +             FLQ    L  + +  Y ++++  D GNP   S  +  +++    DNS   S TL  +++ +
Sbjct:  122 QDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQ-VAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFE----KSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC-VVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAE 480          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 350.903 bits (899), Expect = 3.344e-100
Identity = 256/747 (34.27%), Postives = 372/747 (49.80%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDIRVKK-PIDRESL--CGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNRE---GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI   + PIDRE+L  C + GK C    F  FE+ V   +               + +  +   RI++ DINDN+P F  PV T+ + E+  +GA   +PLA D+D++   +  Y L     A  LF L       +     I L  L   DRE    Y+L + A D G P       + + I DANDN P FE S+Y   V E+   GH +L +KA D D G NG + Y     +   V K   ID S+G + +   LD E++    F V+ARD G     SK  V + V D NDN P + +     VT S     I     +    ++V VSD D G   +V C + G   F L P ++        + +     LDYE     R  IV  D G P L+S++  ++ + D NDNSPIF    +     E NQ G  V++VVA+D DS  N ++ YSI  DS +   F IDP +G +R++   DRE +  Y+  V A D G P+  G+A V+I + D+NDN P F  L+G   Y F + EN P  + +G +  +D DEG N QV  +    V KF I    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN P    P+N S+ +++S +    ++V  +EA D D G N+ L Y I  GN  D     +F++   NG+I L + LTR+  G++ L + VSD+G P R + A
Sbjct:   55 YKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPC----FLEFEVSVTDLI--------------QNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSL---DRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAI-DPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFM-LSG---YSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSN-SSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHD-----LFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIA 769          

HSP 2 Score: 171.785 bits (434), Expect = 1.588e-42
Identity = 151/578 (26.12%), Postives = 246/578 (42.56%), Query Frame = 1
Query: 1276 IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK---FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            I++ D NDN P F +    ++V E+   G L  +  ATDKD+  NG+  Y  ++   +       +    G     L +  +LD E    Y   + A D G    +S A ++V + D NDN PK        S     +   + I      V  +D D G  G ++  L   Q    VP   R + S+  I +   LD EE N  +F +V  D+G    +S     I + D NDN+P  E        H      + E+   G  V  V  +D+D   N  +   +       F + P + +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDN+P F         +FE+   +EN P   ++  + A D D G N +++Y+ ++       F I P+ G +R    LDRE+K  +EF V   DKG+     + +V + V+D NDN+P+F++     +    S L+    L  V  +   D DEG N+ +   +       +     F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKF-----EKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLH--QAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVV--AGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFS------PTLFEVEFAEENQPGEKVVEVV-ASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML-----SGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSV-------EPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINV 668          

HSP 3 Score: 120.168 bits (300), Expect = 1.115e-26
Identity = 112/365 (30.68%), Postives = 171/365 (46.85%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS--LSVSYFSIDPVTGTIRSKI-------SFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF---LSPVEKFT-IHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIP-----TNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRA--LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQ 2970
            +DINDN+P F  P    +V EN   G +    +ATD+D++ NG  +Y++ +   +V+ F +  V      K+       S DRE + SY L++ A D G P +  SA + + I D NDN P F+      SY  E+ EN P    +  + A D D G NG++ YT    + PV K   I    GII     LDRE     +F V   DKG   + +   V++ V D+NDN P   I      T+      IS     GT VA ++  DKDEG N+ +   +++G+   Q +             FLQ    L  + +  Y ++++  D GNP   S  +  +++    DNS   S TL  +++ +
Sbjct:  122 QDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQ-VAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFE----KSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC-VVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAE 480          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 325.479 bits (833), Expect = 1.245e-92
Identity = 254/748 (33.96%), Postives = 364/748 (48.66%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDI-RVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPN---NREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV--SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLD---TAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI   +  IDRESL  D     + +P CF E +V +            +     +   +   RI+I+D NDN+P FS PV T+ I E+  +GA   +P+A D DS +  I  Y L     A  LF+L     + D  + Q+ +  L  +DRE    Y+LN+   D G P       + I I DANDN P FE S Y   + E+   GH +L +KA D D G NG V Y      +S V +   ID +TG + +  ++D E++    F V A+D+G  +  SKA V ++V D NDN P I +     VT       I     +    ++V VSD D G   +V C + G   F L   +   N     + +     LDYE     R  IV  D G P L+S++  ++ + D+NDN+P+F    Y     E NQ G  VL VVATD DS  N ++ YSI   SV    F I+P TG +R     DRE+   YQ  V A D G P+  G+A V++ + D+NDN P F  LNG   Y F ++EN P  + +G +   D DEG N +V  +      KF I      I +    DRE ++ + F ++ +D G   + + V +T++V+DENDN P    P N S      +LD   +  T V  +EA D D G NS LD+ I+ GN          F     G+I L +  T + +G++ L + V D+G PPR++ A
Sbjct:   63 YKLEVGAPYLRVDGKTGDIYTTENSIDRESL-KDCRNLFEGDP-CFLEFEVSI------------TDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSL-QVAQDSDEKLPQLIV--LGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFM-LNG---YSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSS----YKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHG------LFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTA 778          

HSP 2 Score: 166.777 bits (421), Expect = 4.275e-41
Identity = 154/580 (26.55%), Postives = 250/580 (43.10%), Query Frame = 1
Query: 1276 IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEG--PTTINKEYSIVIV--SDPDSGNGGLVQCDL-KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP--------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISF-------DREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLS---PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            I+ILD NDN P F +    +++ E+   G L  +  ATD+DSG NG+  Y  ++    E    F +      D     L +   LD E    Y  N+   D G+    S A +++++ D NDN PK          +R+  EG  P      +S++ V  +D D G  G V   L + S   + +   +R  +T  I +  S+D EE ++ +F +   D G    +S     I ++D NDN+P        +  H      + E+   G  V  V  +DRD   N  +   +             TG  R +  F       D E+   Y++ + A D G PA S + ++ + +TD NDN P F         ++E+   +EN P + ++  + A D D G N ++ Y+      P   F I+P+ G +R   QLDRE    ++F V   DKG+     + +V V V+D NDN+P+F++   +  S  +       + V  +   D DEG N+ +   +   N +       F +      I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  129 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTG--PEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKF---------ERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDR--NTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS------PTLYEVEFFEENQPGDKVLDVV-ATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFML---NGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGK-------FMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINV 678          

HSP 3 Score: 124.02 bits (310), Expect = 6.613e-28
Identity = 118/442 (26.70%), Postives = 194/442 (43.89%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK-GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHP--SYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSY 2316
            ISE + +G  + L    D D     +++  +       F L       +    + FL+    +D E +  Y + ++A D G P+LS    +++++ D NDN P+F  + Y V   E    G  +L + ATD DSG N  + Y  +     E    F I+ +TG + +   LD E++ +Y F V A D G  +    ATV V V+D NDN PK  L   + S +  +   P +      +V V+D D G    VQ  ++  + KF++      +  T+ I    S D E+ +   F +   D G+P  +S     I + D NDN+P    P  S ++ ++        V  V A D D  LN +++++I   +          G I     F  +    ++L V  +D G P +  +A V I + +   N  + +GL G   Y
Sbjct:  377 ISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGD--VPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE--GLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENM--PPLS---PVGMVTVNDHDEGENARVQLSVEPDNGKFMI------QNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEGLVGHSLY 803          

HSP 4 Score: 54.299 bits (129), Expect = 1.248e-6
Identity = 59/224 (26.34%), Postives = 91/224 (40.62%), Query Frame = 1
Query: 2317 IFEIKENGPSNAIIGTIHAED--PDEGINGQVLYTFLSPVEKFTIHPDQG-IIRTNQQLDRE-----------NKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGN------SRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNS 2928
            ++++ E  P N +IG++ ++   PD G     LY          +    G I  T   +DRE           +    EF V + D         +   + ++DENDN P+F  P     ++ I      G L A   A D+D G N   DY + +G       S    QD     D+K   + +   L R+    Y L + V D G+PPR+S A   I I ++
Sbjct:   34 LYQVTEEQPPNTLIGSLASDQGLPDTGH----LYKLEVGAPYLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPV---LTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDS----DEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDA 246          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 325.479 bits (833), Expect = 1.456e-92
Identity = 254/748 (33.96%), Postives = 364/748 (48.66%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDI-RVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPN---NREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV--SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLD---TAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI   +  IDRESL  D     + +P CF E +V +            +     +   +   RI+I+D NDN+P FS PV T+ I E+  +GA   +P+A D DS +  I  Y L     A  LF+L     + D  + Q+ +  L  +DRE    Y+LN+   D G P       + I I DANDN P FE S Y   + E+   GH +L +KA D D G NG V Y      +S V +   ID +TG + +  ++D E++    F V A+D+G  +  SKA V ++V D NDN P I +     VT       I     +    ++V VSD D G   +V C + G   F L   +   N     + +     LDYE     R  IV  D G P L+S++  ++ + D+NDN+P+F    Y     E NQ G  VL VVATD DS  N ++ YSI   SV    F I+P TG +R     DRE+   YQ  V A D G P+  G+A V++ + D+NDN P F  LNG   Y F ++EN P  + +G +   D DEG N +V  +      KF I      I +    DRE ++ + F ++ +D G   + + V +T++V+DENDN P    P N S      +LD   +  T V  +EA D D G NS LD+ I+ GN          F     G+I L +  T + +G++ L + V D+G PPR++ A
Sbjct:   61 YKLEVGAPYLRVDGKTGDIYTTENSIDRESL-KDCRNLFEGDP-CFLEFEVSI------------TDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSL-QVAQDSDEKLPQLIV--LGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFM-LNG---YSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSS----YKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHG------LFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTA 776          

HSP 2 Score: 166.777 bits (421), Expect = 3.652e-41
Identity = 154/580 (26.55%), Postives = 250/580 (43.10%), Query Frame = 1
Query: 1276 IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEG--PTTINKEYSIVIV--SDPDSGNGGLVQCDL-KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP--------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISF-------DREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLS---PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            I+ILD NDN P F +    +++ E+   G L  +  ATD+DSG NG+  Y  ++    E    F +      D     L +   LD E    Y  N+   D G+    S A +++++ D NDN PK          +R+  EG  P      +S++ V  +D D G  G V   L + S   + +   +R  +T  I +  S+D EE ++ +F +   D G    +S     I ++D NDN+P        +  H      + E+   G  V  V  +DRD   N  +   +             TG  R +  F       D E+   Y++ + A D G PA S + ++ + +TD NDN P F         ++E+   +EN P + ++  + A D D G N ++ Y+      P   F I+P+ G +R   QLDRE    ++F V   DKG+     + +V V V+D NDN+P+F++   +  S  +       + V  +   D DEG N+ +   +   N +       F +      I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  127 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTG--PEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKF---------ERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDR--NTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS------PTLYEVEFFEENQPGDKVLDVV-ATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFML---NGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGK-------FMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINV 676          

HSP 3 Score: 124.405 bits (311), Expect = 4.374e-28
Identity = 118/442 (26.70%), Postives = 194/442 (43.89%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK-GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHP--SYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSY 2316
            ISE + +G  + L    D D     +++  +       F L       +    + FL+    +D E +  Y + ++A D G P+LS    +++++ D NDN P+F  + Y V   E    G  +L + ATD DSG N  + Y  +     E    F I+ +TG + +   LD E++ +Y F V A D G  +    ATV V V+D NDN PK  L   + S +  +   P +      +V V+D D G    VQ  ++  + KF++      +  T+ I    S D E+ +   F +   D G+P  +S     I + D NDN+P    P  S ++ ++        V  V A D D  LN +++++I   +          G I     F  +    ++L V  +D G P +  +A V I + +   N  + +GL G   Y
Sbjct:  375 ISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGD--VPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE--GLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENM--PPLS---PVGMVTVNDHDEGENARVQLSVEPDNGKFMI------QNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEGLVGHSLY 801          

HSP 4 Score: 51.6026 bits (122), Expect = 9.883e-6
Identity = 59/221 (26.70%), Postives = 88/221 (39.82%), Query Frame = 1
Query: 2326 IKENGPSNAIIGTIHAED--PDEGINGQVLYTFLSPVEKFTIHPDQG-IIRTNQQLDRE-----------NKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGN------SRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNS 2928
            + E  P N +IG++ ++   PD G     LY          +    G I  T   +DRE           +    EF V + D         +   + ++DENDN P+F  P     ++ I      G L A   A D+D G N   DY + +G       S    QD     D+K   + +   L R+    Y L + V D G+PPR+S A   I I ++
Sbjct:   35 VTEEQPPNTLIGSLASDQGLPDTGH----LYKLEVGAPYLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPV---LTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDS----DEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDA 244          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 325.865 bits (834), Expect = 2.676e-92
Identity = 254/748 (33.96%), Postives = 364/748 (48.66%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDI-RVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPN---NREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV--SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLD---TAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI   +  IDRESL  D     + +P CF E +V +            +     +   +   RI+I+D NDN+P FS PV T+ I E+  +GA   +P+A D DS +  I  Y L     A  LF+L     + D  + Q+ +  L  +DRE    Y+LN+   D G P       + I I DANDN P FE S Y   + E+   GH +L +KA D D G NG V Y      +S V +   ID +TG + +  ++D E++    F V A+D+G  +  SKA V ++V D NDN P I +     VT       I     +    ++V VSD D G   +V C + G   F L   +   N     + +     LDYE     R  IV  D G P L+S++  ++ + D+NDN+P+F    Y     E NQ G  VL VVATD DS  N ++ YSI   SV    F I+P TG +R     DRE+   YQ  V A D G P+  G+A V++ + D+NDN P F  LNG   Y F ++EN P  + +G +   D DEG N +V  +      KF I      I +    DRE ++ + F ++ +D G   + + V +T++V+DENDN P    P N S      +LD   +  T V  +EA D D G NS LD+ I+ GN          F     G+I L +  T + +G++ L + V D+G PPR++ A
Sbjct:   86 YKLEVGAPYLRVDGKTGDIYTTENSIDRESLK-DCRNLFEGDP-CFLEFEVSI------------TDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSL-QVAQDSDEKLPQLIV--LGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFM-LNG---YSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSS----YKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHG------LFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTA 801          

HSP 2 Score: 166.777 bits (421), Expect = 4.633e-41
Identity = 154/580 (26.55%), Postives = 251/580 (43.28%), Query Frame = 1
Query: 1276 IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEG--PTTINKEYSIVIV--SDPDSGNGGLVQCDL-KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP--------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISF-------DREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLS---PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            I+ILD NDN P F +    +++ E+   G L  +  ATD+DSG NG+  Y  ++    E    F +      D     L +   LD E    Y  N+   D G+    S A +++++ D NDN PK          +R+  EG  P      +S++ V  +D D G  G V   L + S   + +   +R  +T  I +  S+D EE ++ +F +   D G    +S     I ++D NDN+P        +  H      + E+   G  V  V  +DRD   N  +   +             TG  R +  F       D E+   Y++ + A D G PA S + ++ + +TD NDN P F         ++E+   +EN P + ++  + A D D G N ++ Y+      P   F I+P+ G +R   QLDRE    ++F V   DKG+     + +V V V+D NDN+P+F++   +  S  +       + V  +   D DEG N+ +   +   N +   Q+  +        I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  152 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTG--PEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKF---------ERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDR--NTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS------PTLYEVEFFEENQPGDKVLDVV-ATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFML---NGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTY-------TILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINV 701          

HSP 3 Score: 124.02 bits (310), Expect = 7.305e-28
Identity = 118/442 (26.70%), Postives = 194/442 (43.89%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK-GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHP--SYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSY 2316
            ISE + +G  + L    D D     +++  +       F L       +    + FL+    +D E +  Y + ++A D G P+LS    +++++ D NDN P+F  + Y V   E    G  +L + ATD DSG N  + Y  +     E    F I+ +TG + +   LD E++ +Y F V A D G  +    ATV V V+D NDN PK  L   + S +  +   P +      +V V+D D G    VQ  ++  + KF++      +  T+ I    S D E+ +   F +   D G+P  +S     I + D NDN+P    P  S ++ ++        V  V A D D  LN +++++I   +          G I     F  +    ++L V  +D G P +  +A V I + +   N  + +GL G   Y
Sbjct:  400 ISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGD--VPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPE--GLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMP--PLS---PVGMVTVNDHDEGENARVQLSVEPDNGKFMI------QNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEGLVGHSLY 826          

HSP 4 Score: 51.9878 bits (123), Expect = 8.161e-6
Identity = 59/221 (26.70%), Postives = 88/221 (39.82%), Query Frame = 1
Query: 2326 IKENGPSNAIIGTIHAED--PDEGINGQVLYTFLSPVEKFTIHPDQG-IIRTNQQLDRE-----------NKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGN------SRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNS 2928
            + E  P N +IG++ ++   PD G     LY          +    G I  T   +DRE           +    EF V + D         +   + ++DENDN P+F  P     ++ I      G L A   A D+D G N   DY + +G       S    QD     D+K   + +   L R+    Y L + V D G+PPR+S A   I I ++
Sbjct:   60 VTEEQPPNTLIGSLASDQGLPDTGH----LYKLEVGAPYLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPV---LTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDS----DEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDA 269          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 335.109 bits (858), Expect = 1.762e-95
Identity = 251/751 (33.42%), Postives = 378/751 (50.33%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDI-RVKKPIDRESLCGDIGKCCDSEPF--CFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTL-IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWK---INLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDT---AGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L   + +LR+    GDI   +  IDRESL     +C + EP   CF E +V             S ++ +S    +   +I+I+DINDN+P+F+ PV T+ I E+  IG   P+P A D DS    + SY L     A  LF L + E    D    Q  L ++  +DRE    Y+L +   D G P+ +    + I ILD NDN P FE   Y   + E+   GH +L +KA D D G N  + Y F    +  VR+  H+D STG +++   +D E V    F+V+A+D G +   ++  V +++ D NDN P I +     VT  G    I     +    ++V VSD D G    V C + G   F L   ++    + K   +    +LDYE        IV  D G P L+S++  ++ + D+NDN+P+F          ENN    +V++V ATD DS  N +++YSI  D  +   FSI+P +G IR     DRE+R  Y   V A D G P+  G+A+V+IT+ D+NDN P F  LNG   Y F + EN P  + +G +   D D+G N  +  +      +F I    G I ++   DRE+++ + F ++ +D G   + + V VT++V+DENDN P  V+P+N    +   YL      GT V  + A D D G N+ LDY I SGN  +     +F +   NG++ L++A+ R+  G++ L + V+D+G P R   A
Sbjct:   99 YKLELGHPYLRVDGKTGDIYTTETSIDRESLR----ECQNLEPGEKCFLEFEV-------------SMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAE----DQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ-ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFM-LNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFE-----LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 186.808 bits (473), Expect = 3.920e-47
Identity = 162/586 (27.65%), Postives = 263/586 (44.88%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-----KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSY----HQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI--KENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-PVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            L  +I+I+D NDN P F +    +++ E+   G L  +  ATD+DSG NG+  Y     V  E +  F +      D     L +   LD E+   Y   +  +D GT A  S A +++S++D NDN PK   + Y          E P      +S++ V   DS  G   + D    Q     + +L    + + ST  I +   +D E+    +F +V  D+G    T+  +  I IRD NDN P+ E   +    HQ    N    + V   VA  + SD++  +N ++  +      F +  V+ T         +++  + D E    Y + + A D G P  S + ++ + +TD NDN P F         + E+   EN   N ++  + A D D G N Q+ Y+ L  P  +  F+I+PD G IR N  LDRE +  ++F V  +DKGI   + + SV ++V+D NDN+P+F++          S ++    L  V  +  ID D+G N+H+   +       + +   F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  160 LDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA--------ELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL----HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFS------QSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFML-----NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINV 713          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 334.724 bits (857), Expect = 1.974e-95
Identity = 251/751 (33.42%), Postives = 378/751 (50.33%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDI-RVKKPIDRESLCGDIGKCCDSEPF--CFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTL-IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWK---INLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDT---AGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L   + +LR+    GDI   +  IDRESL     +C + EP   CF E +V             S ++ +S    +   +I+I+DINDN+P+F+ PV T+ I E+  IG   P+P A D DS    + SY L     A  LF L + E    D    Q  L ++  +DRE    Y+L +   D G P+ +    + I ILD NDN P FE   Y   + E+   GH +L +KA D D G N  + Y F    +  VR+  H+D STG +++   +D E V    F+V+A+D G +   ++  V +++ D NDN P I +     VT  G    I     +    ++V VSD D G    V C + G   F L   ++    + K   +    +LDYE        IV  D G P L+S++  ++ + D+NDN+P+F          ENN    +V++V ATD DS  N +++YSI  D  +   FSI+P +G IR     DRE+R  Y   V A D G P+  G+A+V+IT+ D+NDN P F  LNG   Y F + EN P  + +G +   D D+G N  +  +      +F I    G I ++   DRE+++ + F ++ +D G   + + V VT++V+DENDN P  V+P+N    +   YL      GT V  + A D D G N+ LDY I SGN  +     +F +   NG++ L++A+ R+  G++ L + V+D+G P R   A
Sbjct:   99 YKLELGHPYLRVDGKTGDIYTTETSIDRESLR----ECQNLEPGEKCFLEFEV-------------SMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAE----DQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ-ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFM-LNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFE-----LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 186.422 bits (472), Expect = 4.251e-47
Identity = 162/586 (27.65%), Postives = 263/586 (44.88%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-----KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSY----HQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI--KENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-PVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            L  +I+I+D NDN P F +    +++ E+   G L  +  ATD+DSG NG+  Y     V  E +  F +      D     L +   LD E+   Y   +  +D GT A  S A +++S++D NDN PK   + Y          E P      +S++ V   DS  G   + D    Q     + +L    + + ST  I +   +D E+    +F +V  D+G    T+  +  I IRD NDN P+ E   +    HQ    N    + V   VA  + SD++  +N ++  +      F +  V+ T         +++  + D E    Y + + A D G P  S + ++ + +TD NDN P F         + E+   EN   N ++  + A D D G N Q+ Y+ L  P  +  F+I+PD G IR N  LDRE +  ++F V  +DKGI   + + SV ++V+D NDN+P+F++          S ++    L  V  +  ID D+G N+H+   +       + +   F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  160 LDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA--------ELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL----HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFS------QSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFML-----NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINV 713          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 334.339 bits (856), Expect = 1.292e-94
Identity = 251/751 (33.42%), Postives = 378/751 (50.33%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDI-RVKKPIDRESLCGDIGKCCDSEPF--CFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTL-IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWK---INLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDT---AGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L   + +LR+    GDI   +  IDRESL     +C + EP   CF E +V             S ++ +S    +   +I+I+DINDN+P+F+ PV T+ I E+  IG   P+P A D DS    + SY L     A  LF L + E    D    Q  L ++  +DRE    Y+L +   D G P+ +    + I ILD NDN P FE   Y   + E+   GH +L +KA D D G N  + Y F    +  VR+  H+D STG +++   +D E V    F+V+A+D G +   ++  V +++ D NDN P I +     VT  G    I     +    ++V VSD D G    V C + G   F L   ++    + K   +    +LDYE        IV  D G P L+S++  ++ + D+NDN+P+F          ENN    +V++V ATD DS  N +++YSI  D  +   FSI+P +G IR     DRE+R  Y   V A D G P+  G+A+V+IT+ D+NDN P F  LNG   Y F + EN P  + +G +   D D+G N  +  +      +F I    G I ++   DRE+++ + F ++ +D G   + + V VT++V+DENDN P  V+P+N    +   YL      GT V  + A D D G N+ LDY I SGN  +     +F +   NG++ L++A+ R+  G++ L + V+D+G P R   A
Sbjct:   99 YKLELGHPYLRVDGKTGDIYTTETSIDRESLR----ECQNLEPGEKCFLEFEV-------------SMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAE----DQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ-ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFM-LNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFE-----LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 186.422 bits (472), Expect = 5.703e-47
Identity = 162/586 (27.65%), Postives = 263/586 (44.88%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-----KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSY----HQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI--KENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-PVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            L  +I+I+D NDN P F +    +++ E+   G L  +  ATD+DSG NG+  Y     V  E +  F +      D     L +   LD E+   Y   +  +D GT A  S A +++S++D NDN PK   + Y          E P      +S++ V   DS  G   + D    Q     + +L    + + ST  I +   +D E+    +F +V  D+G    T+  +  I IRD NDN P+ E   +    HQ    N    + V   VA  + SD++  +N ++  +      F +  V+ T         +++  + D E    Y + + A D G P  S + ++ + +TD NDN P F         + E+   EN   N ++  + A D D G N Q+ Y+ L  P  +  F+I+PD G IR N  LDRE +  ++F V  +DKGI   + + SV ++V+D NDN+P+F++          S ++    L  V  +  ID D+G N+H+   +       + +   F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  160 LDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA--------ELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL----HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFS------QSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFML-----NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINV 713          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 334.339 bits (856), Expect = 3.492e-94
Identity = 251/751 (33.42%), Postives = 378/751 (50.33%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDI-RVKKPIDRESLCGDIGKCCDSEPF--CFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTL-IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWK---INLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDT---AGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L   + +LR+    GDI   +  IDRESL     +C + EP   CF E +V             S ++ +S    +   +I+I+DINDN+P+F+ PV T+ I E+  IG   P+P A D DS    + SY L     A  LF L + E    D    Q  L ++  +DRE    Y+L +   D G P+ +    + I ILD NDN P FE   Y   + E+   GH +L +KA D D G N  + Y F    +  VR+  H+D STG +++   +D E V    F+V+A+D G +   ++  V +++ D NDN P I +     VT  G    I     +    ++V VSD D G    V C + G   F L   ++    + K   +    +LDYE        IV  D G P L+S++  ++ + D+NDN+P+F          ENN    +V++V ATD DS  N +++YSI  D  +   FSI+P +G IR     DRE+R  Y   V A D G P+  G+A+V+IT+ D+NDN P F  LNG   Y F + EN P  + +G +   D D+G N  +  +      +F I    G I ++   DRE+++ + F ++ +D G   + + V VT++V+DENDN P  V+P+N    +   YL      GT V  + A D D G N+ LDY I SGN  +     +F +   NG++ L++A+ R+  G++ L + V+D+G P R   A
Sbjct:   91 YKLELGHPYLRVDGKTGDIYTTETSIDRESL----RECQNLEPGEKCFLEFEV-------------SMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAE----DQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ-ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFM-LNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFE-----LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 806          

HSP 2 Score: 186.808 bits (473), Expect = 4.686e-47
Identity = 162/586 (27.65%), Postives = 263/586 (44.88%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-----KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSY----HQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI--KENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-PVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            L  +I+I+D NDN P F +    +++ E+   G L  +  ATD+DSG NG+  Y     V  E +  F +      D     L +   LD E+   Y   +  +D GT A  S A +++S++D NDN PK   + Y          E P      +S++ V   DS  G   + D    Q     + +L    + + ST  I +   +D E+    +F +V  D+G    T+  +  I IRD NDN P+ E   +    HQ    N    + V   VA  + SD++  +N ++  +      F +  V+ T         +++  + D E    Y + + A D G P  S + ++ + +TD NDN P F         + E+   EN   N ++  + A D D G N Q+ Y+ L  P  +  F+I+PD G IR N  LDRE +  ++F V  +DKGI   + + SV ++V+D NDN+P+F++          S ++    L  V  +  ID D+G N+H+   +       + +   F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  152 LDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA--------ELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL----HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFS------QSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFML-----NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINV 705          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 333.954 bits (855), Expect = 5.404e-94
Identity = 250/751 (33.29%), Postives = 378/751 (50.33%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDI-RVKKPIDRESLCGDIGKCCDSEPF--CFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTL-IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWK---INLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDT---AGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L   + +LR+    GDI   +  IDRESL     +C + EP   CF E +V +             ++ +S    +   +I+I+DINDN+P+F+ PV T+ I E+  IG   P+P A D DS    + SY L     A  LF L + E    D    Q  L ++  +DRE    Y+L +   D G P+ +    + I ILD NDN P FE   Y   + E+   GH +L +KA D D G N  + Y F    +  VR+  H+D STG +++   +D E V    F+V+A+D G +   ++  V +++ D NDN P I +     VT  G    I     +    ++V VSD D G    V C + G   F L   ++    + K   +    +LDYE        IV  D G P L+S++  ++ + D+NDN+P+F          ENN    +V++V ATD DS  N +++YSI  D  +   FSI+P +G IR     DRE+R  Y   V A D G P+  G+A+V+IT+ D+NDN P F  LNG   Y F + EN P  + +G +   D D+G N  +  +      +F I    G I ++   DRE+++ + F ++ +D G   + + V VT++V+DENDN P  V+P+N    +   YL      GT V  + A D D G N+ LDY I SGN  +     +F +   NG++ L++A+ R+  G++ L + V+D+G P R   A
Sbjct:   99 YKLELGHPYLRVDGKTGDIYTTETSIDRESLR----ECQNLEPGEKCFLEFEVSM-------------TDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAE----DQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ-ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFM-LNG---YNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN----ISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFE-----LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 186.808 bits (473), Expect = 5.686e-47
Identity = 162/586 (27.65%), Postives = 263/586 (44.88%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-----KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSY----HQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI--KENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-PVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            L  +I+I+D NDN P F +    +++ E+   G L  +  ATD+DSG NG+  Y     V  E +  F +      D     L +   LD E+   Y   +  +D GT A  S A +++S++D NDN PK   + Y          E P      +S++ V   DS  G   + D    Q     + +L    + + ST  I +   +D E+    +F +V  D+G    T+  +  I IRD NDN P+ E   +    HQ    N    + V   VA  + SD++  +N ++  +      F +  V+ T         +++  + D E    Y + + A D G P  S + ++ + +TD NDN P F         + E+   EN   N ++  + A D D G N Q+ Y+ L  P  +  F+I+PD G IR N  LDRE +  ++F V  +DKGI   + + SV ++V+D NDN+P+F++          S ++    L  V  +  ID D+G N+H+   +       + +   F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  160 LDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA--------ELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL----HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFS------QSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFML-----NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINV 713          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 326.25 bits (835), Expect = 1.571e-92
Identity = 219/662 (33.08%), Postives = 338/662 (51.06%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYS------IVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            NDN+P+F+ PV T+ I E+  IG+  P+PLA D D+    + SY L+    A  LF L       D    Q  L ++  +DRE    Y+L +   D G P  +    + + +LD NDN P FE  TY   + E+   GH ++ +KA D D G N  + Y F       VR+   +D +TG +++   +D E +    F+V+A+D G     ++A V V+V D NDN P I +  +   G  T  +G   I+++ +      +V VSD D G    V C + G   F L   +     + K   +++   LDYE+       IV  D G P L+S++  ++ + D+NDN+P+F          ENN+ G VV +V A+D DS  N ++ YS++    +   F+I P  G IR K S DRE+R SY+L V A D G P+  G+A VL+ + D NDN P F  L+G   Y F + EN P+ + +G +   D D+G N +V  +       F I    G I ++   DRE ++ + F ++ +D G+  +   V VT++V+DENDN P    P+N S  + ++     G  V+++ A D D G N+ L Y I  GN        +F +   +G I L++ + R+  G++ L + VSD+G PPR   A
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGL---QVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ-APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGI---GLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM-LSG---YNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPY-----GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 645          

HSP 2 Score: 142.124 bits (357), Expect = 1.938e-33
Identity = 114/429 (26.57%), Postives = 192/429 (44.76%), Query Frame = 1
Query: 1690 TTINKEYSIVIVSDPDSGNGGLVQCDLKGSQK----FILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS---LSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQ----GLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGIN--------GQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            T I   + I + +D D+G  G+   +L+   +    F L    ++E    ++ ++ +LD E  +     I   D G P   SS    + + D NDN+P FE P+Y   + EN+  G  V++V A D D   N +I+Y+      +      +D  TG I  +   DRE  ++ + SV A+D G   +S  A V++T+ D NDN P  +    GL      +  I E+      +  +   D DEG N        G V +      E  +    +  ++T   LD E    +   +  +D G     ++ S+ V V+D NDN P F   T   T V     +  G +VA + A D D G N+ L Y +      +     +F +  +NG+I ++ +L R+    Y LK++ +D+G+P  +  A  ++ +
Sbjct:   20 TNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVF---TQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSL----EPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNV 441          

HSP 3 Score: 70.8626 bits (172), Expect = 1.320e-11
Identity = 60/228 (26.32%), Postives = 103/228 (45.18%), Query Frame = 1
Query: 2269 NDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK-----FTIHPDQG------IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            NDNTP F            I EN    ++     A D D G NG   Y   +  E        +  DQ       I+  N  LDRE    ++ +++V D G   + +S  + V+V+D NDN P+F  PT ++   ++S     G  V +++A D D+G N+ +DY     +   +   ++  +D+  G I +Q  + R+D+      ++  D+G  P+ + A  V+ +
Sbjct:    1 NDNTPNF----ASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGN--LDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEA---ELSENSPIGHSVIQVKANDSDQGANAEIDYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTV 216          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 325.479 bits (833), Expect = 1.777e-92
Identity = 219/662 (33.08%), Postives = 338/662 (51.06%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYS------IVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            NDN+P+F+ PV T+ I E+  IG+  P+PLA D D+    + SY L+    A  LF L       D    Q  L ++  +DRE    Y+L +   D G P  +    + + +LD NDN P FE  TY   + E+   GH ++ +KA D D G N  + Y F       VR+   +D +TG +++   +D E +    F+V+A+D G     ++A V V+V D NDN P I +  +   G  T  +G   I+++ +      +V VSD D G    V C + G   F L   +     + K   +++   LDYE+       IV  D G P L+S++  ++ + D+NDN+P+F          ENN+ G VV +V A+D DS  N ++ YS++    +   F+I P  G IR K S DRE+R SY+L V A D G P+  G+A VL+ + D NDN P F  L+G   Y F + EN P+ + +G +   D D+G N +V  +       F I    G I ++   DRE ++ + F ++ +D G+  +   V VT++V+DENDN P    P+N S  + ++     G  V+++ A D D G N+ L Y I  GN        +F +   +G I L++ + R+  G++ L + VSD+G PPR   A
Sbjct:  140 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGL---QVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ-APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGI---GLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM-LSG---YNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPY-----GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 784          

HSP 2 Score: 164.851 bits (416), Expect = 1.936e-40
Identity = 149/591 (25.21%), Postives = 250/591 (42.30%), Query Frame = 1
Query: 1240 GKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKE--YSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT-------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIK--ENGPSNAIIGTIHAEDPDEGINGQVLYTF-LSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            G P L   L+ +I++ D NDN P F +    + + E+   G L  +  ATD+D+G NG+  Y   +    E ++ F +      +     L +   LD E+   Y   +  +D G     S A ++V+V+D NDN PK          +R   E   + N    +S++ V   DS  G   + D    Q   +V    R + +T  I +   +D E+ +  RF ++  DRG    ++  +  + ++D+NDN+P  E        H      + E+      V  V  +DRD   N  +   +             TG+       +++    D EK   Y + + A D G P  S + ++ + + D NDN P F         I E+   EN     ++  + A D D G N +++Y+    P  +  FTI P+ G IR    LDRE +  +E  V   D+G    + + +V V+V+D NDN+P+F++     +    S ++    L  V  +  ID D+G N+ +   +   N         F +    G I    +  R+    Y  ++   D G PPR +Y    I +
Sbjct:  125 GSPRL---LEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAG--PEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKF---------ERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFT------QSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFML-----SGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD-------FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINV 683          

HSP 3 Score: 78.9518 bits (193), Expect = 4.610e-14
Identity = 77/296 (26.01%), Postives = 130/296 (43.92%), Query Frame = 1
Query: 2101 LSVSYFSIDPVTGTI-RSKISFDREKRASYQLSV--------FARDLGEPAQSGSANVL---ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK-----FTIHPDQG------IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +   Y  +D  TG I  ++ S DRE     Q  +        F   + +  Q+GS  +L   I + D NDNTP F            I EN    ++     A D D G NG   Y   +  E        +  DQ       I+  N  LDRE    ++ +++V D G   + +S  + V+V+D NDN P+F  PT ++   ++S     G  V +++A D D+G N+ +DY     +   +   ++  +D+  G I +Q  + R+D+      ++  D+G  P+ + A  V+ +
Sbjct:   72 VGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF----ASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGN--LDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEA---ELSENSPIGHSVIQVKANDSDQGANAEIDYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTV 355          

HSP 4 Score: 55.0694 bits (131), Expect = 9.260e-7
Identity = 60/214 (28.04%), Postives = 86/214 (40.19%), Query Frame = 1
Query: 2317 IFEIKENGPSNAIIGTIHAED--PDEGINGQVLYTFLSPVEKFTIHPDQG-IIRTNQQLDRE-----------NKAVHEFSVRVIDKGILRQENSVSV---TVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQ--KNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            ++++ E  P N +IG++ A+   PD G     LY          +    G I  T   +DRE           N  + EF V + D   L Q  S  +    + V D NDN P F  P     ++ I      G+L     A D+D GPN    Y++ +G    +        DQ  K   + +   L R+    Y L + V D GNPPR S A
Sbjct:   39 VYKVPEEQPPNTLIGSLAADYGLPDVGH----LYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITD---LVQNGSPRLLEGQIEVQDINDNTPNFASPV---ITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSA 242          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 325.479 bits (833), Expect = 1.777e-92
Identity = 219/662 (33.08%), Postives = 338/662 (51.06%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYS------IVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            NDN+P+F+ PV T+ I E+  IG+  P+PLA D D+    + SY L+    A  LF L       D    Q  L ++  +DRE    Y+L +   D G P  +    + + +LD NDN P FE  TY   + E+   GH ++ +KA D D G N  + Y F       VR+   +D +TG +++   +D E +    F+V+A+D G     ++A V V+V D NDN P I +  +   G  T  +G   I+++ +      +V VSD D G    V C + G   F L   +     + K   +++   LDYE+       IV  D G P L+S++  ++ + D+NDN+P+F          ENN+ G VV +V A+D DS  N ++ YS++    +   F+I P  G IR K S DRE+R SY+L V A D G P+  G+A VL+ + D NDN P F  L+G   Y F + EN P+ + +G +   D D+G N +V  +       F I    G I ++   DRE ++ + F ++ +D G+  +   V VT++V+DENDN P    P+N S  + ++     G  V+++ A D D G N+ L Y I  GN        +F +   +G I L++ + R+  G++ L + VSD+G PPR   A
Sbjct:  140 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGL---QVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ-APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGI---GLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM-LSG---YNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPY-----GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 784          

HSP 2 Score: 164.851 bits (416), Expect = 1.936e-40
Identity = 149/591 (25.21%), Postives = 250/591 (42.30%), Query Frame = 1
Query: 1240 GKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKE--YSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT-------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIK--ENGPSNAIIGTIHAEDPDEGINGQVLYTF-LSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            G P L   L+ +I++ D NDN P F +    + + E+   G L  +  ATD+D+G NG+  Y   +    E ++ F +      +     L +   LD E+   Y   +  +D G     S A ++V+V+D NDN PK          +R   E   + N    +S++ V   DS  G   + D    Q   +V    R + +T  I +   +D E+ +  RF ++  DRG    ++  +  + ++D+NDN+P  E        H      + E+      V  V  +DRD   N  +   +             TG+       +++    D EK   Y + + A D G P  S + ++ + + D NDN P F         I E+   EN     ++  + A D D G N +++Y+    P  +  FTI P+ G IR    LDRE +  +E  V   D+G    + + +V V+V+D NDN+P+F++     +    S ++    L  V  +  ID D+G N+ +   +   N         F +    G I    +  R+    Y  ++   D G PPR +Y    I +
Sbjct:  125 GSPRL---LEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAG--PEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKF---------ERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFT------QSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFML-----SGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD-------FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINV 683          

HSP 3 Score: 78.9518 bits (193), Expect = 4.610e-14
Identity = 77/296 (26.01%), Postives = 130/296 (43.92%), Query Frame = 1
Query: 2101 LSVSYFSIDPVTGTI-RSKISFDREKRASYQLSV--------FARDLGEPAQSGSANVL---ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK-----FTIHPDQG------IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +   Y  +D  TG I  ++ S DRE     Q  +        F   + +  Q+GS  +L   I + D NDNTP F            I EN    ++     A D D G NG   Y   +  E        +  DQ       I+  N  LDRE    ++ +++V D G   + +S  + V+V+D NDN P+F  PT ++   ++S     G  V +++A D D+G N+ +DY     +   +   ++  +D+  G I +Q  + R+D+      ++  D+G  P+ + A  V+ +
Sbjct:   72 VGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF----ASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGN--LDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEA---ELSENSPIGHSVIQVKANDSDQGANAEIDYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTV 355          

HSP 4 Score: 55.0694 bits (131), Expect = 9.260e-7
Identity = 60/214 (28.04%), Postives = 86/214 (40.19%), Query Frame = 1
Query: 2317 IFEIKENGPSNAIIGTIHAED--PDEGINGQVLYTFLSPVEKFTIHPDQG-IIRTNQQLDRE-----------NKAVHEFSVRVIDKGILRQENSVSV---TVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQ--KNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            ++++ E  P N +IG++ A+   PD G     LY          +    G I  T   +DRE           N  + EF V + D   L Q  S  +    + V D NDN P F  P     ++ I      G+L     A D+D GPN    Y++ +G    +        DQ  K   + +   L R+    Y L + V D GNPPR S A
Sbjct:   39 VYKVPEEQPPNTLIGSLAADYGLPDVGH----LYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITD---LVQNGSPRLLEGQIEVQDINDNTPNFASPV---ITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSA 242          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 321.242 bits (822), Expect = 2.752e-92
Identity = 219/709 (30.89%), Postives = 354/709 (49.93%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTL----IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTL-IEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC   G     E  CFFEL+V++                 +    +  I+I + D NDN+P F  PV  I I E+  I ++ P+P A D D+    +  Y L N + ++F L     PE   +   I Q      Q +DRE    Y + +   D G P  S    +++ + D NDN+P+F+     V++ E+   G  ++ L ATD D G N  + Y F + V    ++ F ++++TG +++  +LD E+   +   V+A D  +  A  +ATV ++V D NDNPP I L Y+      T+ +     +N + +++ VSD D+   G V C ++    F L    + +   + +     LDYE      F IV  D G+P L  +    + + D NDN PIF  P    +V ENN+ G+ +  + ATD DS  N  I Y +   + S+F +D  TG + +   F+RE++  +  +V ARD G P     A V++T+ D+NDN+P F        + F + EN P  + +G I   D D G N  V  + L+  E F + P  G+I++N   DRE ++ + F V+  D G   + ++  VT++V+D NDN P  + P ++++   +      G++VA + A+D D G N+ L Y I+SGN++      +F +D   G+I L+      D+G++ L + +SD G P
Sbjct:   92 IDREKLCA--GASYAEENECFFELEVVI---------------LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ-SVFGLDIVETPEGEKWPQLIVQ------QNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA--RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNK-----GLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 132.109 bits (331), Expect = 1.775e-30
Identity = 135/565 (23.89%), Postives = 233/565 (41.24%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGW--LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSID-SLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI+I + D NDN P+F +    +++ E+ +      +  ATD D+G NG+  Y   +  +              W  L + + LD E+   Y   +   D GT    S A ++V+V D NDN P      V          G + I         +D D G+   ++  + G+Q   + P   R      +T  I +  SLD EE  + +  ++  D       ++    I + D+NDN P      I    +    + E +     +  +  +D+D+D+NGK+   I+  +     ++      + +    D E    +   + A D G+P+ + +A V + + D+NDN P F            + EN      + TI A D D G N  ++Y        F +    G++  ++  +RE +    F+V   D G    ++  +V V+V+DENDN P+F   T++     +S      + V  I   D+D G N  +   I++ N         F +D  +G I    +  R+    Y   +  +D G PPR S A   I +
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLH-----ATDADIGSNAEIRY-IFGAQ---VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFN----QPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF---THNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNEN-------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINV 665          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 320.857 bits (821), Expect = 5.976e-90
Identity = 219/709 (30.89%), Postives = 354/709 (49.93%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTL----IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTL-IEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC   G     E  CFFEL+V++                 +    +  I+I + D NDN+P F  PV  I I E+  I ++ P+P A D D+    +  Y L N + ++F L     PE   +   I Q      Q +DRE    Y + +   D G P  S    +++ + D NDN+P+F+     V++ E+   G  ++ L ATD D G N  + Y F + V    ++ F ++++TG +++  +LD E+   +   V+A D  +  A  +ATV ++V D NDNPP I L Y+      T+ +     +N + +++ VSD D+   G V C ++    F L    + +   + +     LDYE      F IV  D G+P L  +    + + D NDN PIF  P    +V ENN+ G+ +  + ATD DS  N  I Y +   + S+F +D  TG + +   F+RE++  +  +V ARD G P     A V++T+ D+NDN+P F        + F + EN P  + +G I   D D G N  V  + L+  E F + P  G+I++N   DRE ++ + F V+  D G   + ++  VT++V+D NDN P  + P ++++   +      G++VA + A+D D G N+ L Y I+SGN++      +F +D   G+I L+      D+G++ L + +SD G P
Sbjct:   92 IDREKLCA--GASYAEENECFFELEVVI---------------LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ-SVFGLDIVETPEGEKWPQLIVQ------QNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA--RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNK-----GLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 133.265 bits (334), Expect = 1.118e-30
Identity = 136/567 (23.99%), Postives = 236/567 (41.62%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGW--LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSID-SLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFE--IKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI+I + D NDN P+F +    +++ E+ +      +  ATD D+G NG+  Y   +  +              W  L + + LD E+   Y   +   D GT    S A ++V+V D NDN P      V          G + I      +  +D D G+   ++  + G+Q   + P   R      +T  I +  SLD EE  + +  ++  D       ++    I + D+NDN P      I    +    + E +     +  +  +D+D+D+NGK+   I+  +     ++      + +    D E    +   + A D G+P+ + +A V + + D+NDN P F         + E  + EN      + TI A D D G N  ++Y        F +    G++  ++  +RE +    F+V   D G    ++  +V V+V+DENDN P+F   T++     +S      + V  I   D+D G N  +   I++ N         F +D  +G I    +  R+    Y   +  +D G PPR S A   I +
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQ-----LHATDADIGSNAEIRY-IFGAQ---VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFN------QPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF---THNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNEN-------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINV 665          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 3.047e-93
Identity = 229/710 (32.25%), Postives = 359/710 (50.56%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTL----IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTD--SGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC   G   D+   CF+E++V V                      +  IR  I DINDN+P F   V  I I E+  I ++  LP  +D D+    + +Y L   + ++F L     PE       I Q      + +DRE    Y + +   D G P  S    +++ + D NDN+P+F+ +   V++ E+   G  +  L ATD D GEN  + +YFS+ +++  +K FH++S+TG ++I E LD E+   +   V+A D G   A  +A V V+V D NDN P I + Y+ +  +G   L E    +N + +++ V+D D+ + G V C       F L P  + +   + +     LDYE        ++  D G+P L  S    I ++D NDN+P+F  P    +V ENN  G  + K+ A D DS  N +INY +   + S F++D  TG + +    DREK+  Y  +V A+D G P    +A VL+T+ DQNDN+P F        Y F + EN P +  +G I   DPD G N  V+ + L   + FTI P  G+I+ N   DRE +  + F V+  D G + + ++  VT++V+D NDN+P FV+P+++ +   +      GT+V  + AID D G N+ L Y ++ GN++      +F +DQ +G+I L+      D+G++ L +   D G P
Sbjct:   91 IDREKLCA--GIVVDAH--CFYEVEVAV---------------LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSRYALPATIDPDTGINGVQNYHLIKGQ-SIFGLDVIETPEGEKMPQLIVQ------KELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDGGLTPA--RAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSEN-APLNTKIALITVTDKDADHNGWVSCFTDHEVPFRLRPVFSNQ---FLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDAPSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFT----HNEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDANDDFTIDPQTGVIQPNISFDREKQESYTFYVKAEDGGRISRSSTAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTK-----GLFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQP 759          

HSP 2 Score: 139.813 bits (351), Expect = 6.557e-32
Identity = 134/482 (27.80%), Postives = 212/482 (43.98%), Query Frame = 1
Query: 1570 DAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL-KGSQKFILVPPNNREGSTWKINLVES-LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLG-EPAQSGSANVLITITDQNDNTP------YFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHP---DQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            D  F    ++  + D NDN P      +  S     I   + IN  Y++    DPD+G  G+    L KG   F L      EG      +V+  LD EE++     I   D G PQ +S+   ++ + D NDN P+F+      ++ EN   G  V ++ ATD D   N KI++     I +++   F ++  TG I  K   DRE+  +++L V A D G  PA+   A VL+ +TD NDN P          +NG       + EN P N  I  I   D D   NG V   F      F + P   +Q ++ T   LD E+   +   +   D G      S  + + V DENDN P F  P     S+ +   ++ GT + +I A+D D G N+ ++Y ++  ++  +     F +D + G +   + L R+    Y   ++  D G PP  + A  ++ + +    S    + +YN
Sbjct:  117 DEIFRLVKIRFLIEDINDNAPLFPATVINIS-----IPENSAINSRYALPATIDPDTGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDGGLTPAR---AMVLVNVTDINDNIPSIDIRYIINPING----TVVLSENAPLNTKIALITVTDKDADHNGWV-SCFTDHEVPFRLRPVFSNQFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPF---LSLSVPENNSPGTQLTKISAMDADSGRNAEINY-LLGFDAPSE-----FNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFTHNEYN 576          

HSP 3 Score: 122.094 bits (305), Expect = 1.816e-26
Identity = 148/573 (25.83%), Postives = 228/573 (39.79%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYY-------FSSDV--TSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXX-XRDINDNSP------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQV--LYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI   I D NDN P+F  +   +++ E+        L    D D+G NG+  Y+       F  DV  T E  K          L + + LD E+   Y   +   D G     S A ++VSV D NDN P      +  S     I     +    + +  +D D G    +          +     +   +T  I + E LD EE    + +++  D G   LT +    ++ + DINDN P      I    +    + EN      +  +  TD+D+D NG ++   D      F + PV      + +    D E    Y + + A D G+P  + S+ +LI + D+NDN P F            + EN      +  I A D D G N ++  L  F +P E F +    GI+   ++LDRE +  + F+V   D G+     + +V V+V+D+NDN P F    N+        L   GT V  I   D D G NS +   I+  N         F +D + G I    +  R+    Y   +   D G   R S A   I +
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSRYALPATIDPDTGINGVQNYHLIKGQSIFGLDVIETPEGEK-------MPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVS-----IPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDGG---LTPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFTD--HEVPFRLRPVFSNQFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFT----QPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDAPSE-FNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFT--HNEYNFYVPENLPRHGT-VGLITVTDPDYGENSAVILSILDANDD-------FTIDPQTGVIQPNISFDREKQESYTFYVKAEDGGRISRSSTAKVTINV 663          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 328.561 bits (841), Expect = 1.828e-92
Identity = 218/662 (32.93%), Postives = 341/662 (51.51%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYS------IVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS--YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            NDN+P+F+ PV T+ I E+  IG+  P+PLA D D+    + SY L+    A  LF L       D    Q  L ++  +DRE    Y+L +   D G P  +    + + +LD NDN P FE  +Y   + E+   GH ++ +KA D D G N  + Y F       VR+   +D +TG +++   +D E +    F+V+A+D GT+   ++A V V+V D NDN P I +  +   G  T  +G   I+++ +      +V VSD D G    V C + G   F L   +     + K   +++   LDYE+       IV  D G P L+S++  ++ + D+NDN+P+F          ENN+ G V+ ++ A+D DS  N ++ YS++    +   F+I P TG I+ K S DRE+R SY+L V A D G P+  G+A VL+ + D NDN P F  L+G   Y F + EN P+ + +G +   D D+G N QV  +       F I    G I ++   DRE ++ + F ++ +D G+  +   V VT++V+DENDN P    P+N S  + ++     G  V+++ A D D G N+ L Y I  GN        +F +   +G I L++ + R+  G++ L + VSD+G PPR   A
Sbjct:  162 NDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGL---QVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQ-APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGI---GLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM-LSG---YNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY-----GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTA 806          

HSP 2 Score: 161.384 bits (407), Expect = 1.689e-38
Identity = 148/591 (25.04%), Postives = 251/591 (42.47%), Query Frame = 1
Query: 1240 GKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKE--YSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT-------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIK--ENGPSNAIIGTIHAEDPDEGINGQVLYTF-LSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            G P L   L+ +I++ D NDN P F +    + + E+   G L  +  A+D+D+G NG+  Y   +    E ++ F +      +     L +   LD E+   Y   +  +D G+    S A ++V+V+D NDN PK          +R   E   + N    +S++ V   DS  G   + +    Q   +V    R + +T  I +   +D E+ +  RF ++  DRG    ++  +  + ++D+NDN+P  E        H      + E+      V  V  +DRD   N  +   +             TG+       +++    D EK   Y + + A D G P  S + ++ + + D NDN P F         + E+   EN     +I  I A D D G N +++Y+    P  K  FTI P+ G I+    LDRE +  +E  V   D+G    + + +V V+V+D NDN+P+F++     +    S ++    L  V  +  ID D+G N+ +   +   N         F +    G I    +  R+    Y  ++   D G PPR +Y    I +
Sbjct:  147 GSPRL---LEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAG--PEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKF---------ERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFT------QSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFML-----SGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGD-------FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINV 705          

HSP 3 Score: 75.8702 bits (185), Expect = 2.873e-12
Identity = 76/296 (25.68%), Postives = 128/296 (43.24%), Query Frame = 1
Query: 2101 LSVSYFSIDPVTGTI-RSKISFDREKRASYQLSV--------FARDLGEPAQSGSANVL---ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK-----FTIHPDQG------IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +   Y  +D  TG I  ++ S DRE     Q  +        F   + +  Q+GS  +L   I + D NDNTP F            I EN    ++     A D D G NG   Y   +  E        +  DQ       I+  N  LDRE    ++ +++V D G   + +S  + V+V+D NDN P+F  P   S   ++S     G  V +++A D D+G N+ ++Y     +   +   ++  +D+  G I +Q  + R+D+      ++  D+G  P+ + A  V+ +
Sbjct:   94 VGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF----ASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGN--LDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERP---SYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTV 377          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 321.627 bits (823), Expect = 3.408e-89
Identity = 219/709 (30.89%), Postives = 354/709 (49.93%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTL----IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTL-IEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC   G     E  CFFEL+V++                 +    +  I+I + D NDN+P F  PV  I I E+  I ++ P+P A D D+    +  Y L N + ++F L     PE   +   I Q      Q +DRE    Y + +   D G P  S    +++ + D NDN+P+F+     V++ E+   G  ++ L ATD D G N  + Y F + V    ++ F ++++TG +++  +LD E+   +   V+A D  +  A  +ATV ++V D NDNPP I L Y+      T+ +     +N + +++ VSD D+   G V C ++    F L    + +   + +     LDYE      F IV  D G+P L  +    + + D NDN PIF  P    +V ENN+ G+ +  + ATD DS  N  I Y +   + S+F +D  TG + +   FDRE++  +  +V ARD G P     A V++T+ D+NDN+P F        + F + EN P  + +G I   D D G N  V  + L+  + F + P  G+I++N   DRE ++ + F V+  D G   + ++  VT++V+D NDN P  + P ++++   +      G++VA + A+D D G N+ L Y I+SGN++      +F +D   G+I L+      D+G++ L + +SD G P
Sbjct:   92 IDREKLCA--GASYAEENECFFELEVVI---------------LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQ-SVFGLDIVETPEGEKWPQLIVQ------QNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA--RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNK-----GLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 134.806 bits (338), Expect = 3.207e-30
Identity = 137/567 (24.16%), Postives = 235/567 (41.45%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGW--LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSID-SLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFE--IKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI+I + D NDN P+F +    +++ E+ +      +  ATD D+G NG+  Y   +  +              W  L + + LD E+   Y   +   D GT    S A ++V+V D NDN P      V          G + I      +  +D D G+   ++  + G+Q   + P   R      +T  I +  SLD EE  + +  ++  D       ++    I + D+NDN P      I    +    + E +     +  +  +D+D+D+NGK+   I+  +     ++      + +    D E    +   + A D G+P+ + +A V + + D+NDN P F         + E  + EN      + TI A D D G N  ++Y        F +    G++  ++  DRE +    F+V   D G    ++  +V V+V+DENDN P+F   T++     +S      + V  I   D D G N  +   I++ N         F +D  +G I    +  R+    Y   +  +D G PPR S A   I +
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQ-----LHATDADIGSNAEIRY-IFGAQ---VAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFN------QPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF---THNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDN-------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINV 665          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 3.348e-88
Identity = 224/705 (31.77%), Postives = 349/705 (49.50%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGP-TTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC  I +    +  CF+E++V +                      +  IR  I DINDN+P F   V  I I E+  I +K  LP AVD D     + +Y L   ++     + E    D     I  K L   DRE    Y + +   D G P  S    +++ + D NDN P+F+ +   V++ E+   G  +  L ATD D GEN  + + FS+ V++  R+ FH++++TG ++I E LD E+   +   V+A D G   A  +A V V+V D NDN P I + Y+ +    T++      +N + +++ V+D D+ + G V C       F L P  + +   + +     LDYE        ++  D G+P L  S    I ++D NDN+P+F       ++ ENN  GI + KV ATD DS  N +INY +   +   FS+D  TG +      DREK   Y  ++ A+D G P  + +  V ++I DQNDN+P F        Y F + EN P +  +G I   DPD G N  V  + L   + FTI    G+IR N   DRE +  + F V+  D G + + +S  VT++V+D NDN+P F++P ++ +   +      GT+V ++ A+D D G N+ + Y I+ GN+RD     +F +DQ+ G+I L       D+G++ + +  +D G P
Sbjct:   91 IDREKLCAGIPR----DEHCFYEVEVAI---------------LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL---DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPA--RAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH----NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 142.51 bits (358), Expect = 1.308e-32
Identity = 131/478 (27.41%), Postives = 212/478 (44.35%), Query Frame = 1
Query: 1570 DAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQK-FILVPPNNREGSTWKINLVE-SLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQG---LNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHP---DQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            D  F    ++  + D NDN P      +  S     I   + IN +Y++    DPD G  G+   +L  SQ  F L      EG      +V+  LD EE++     +   D G PQ +S+   ++ + D NDN P+F+      ++ EN   G  V ++ ATD D   N KI++S    + +++   F ++  TG I  K   DRE+  +++L V A D G       A VL+ +TD NDN P       +N     +  + EN P N  I  I   D D   NG+V   F      F + P   +Q ++ T   LD E+   +   +   D G      S  + + V DENDN P F   T    +V I   ++ G  + ++ A D D GPN+ ++Y ++  ++  +     F +D++ G + + + L R+    Y+  ++  D G PP  S     + I +    S    + +YN
Sbjct:  117 DEIFRLVKIRFLIEDINDNAPLFPATVINIS-----IPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVT-CFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF---TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPE-----FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYN 576          

HSP 3 Score: 126.716 bits (317), Expect = 9.004e-28
Identity = 153/586 (26.11%), Postives = 234/586 (39.93%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMY-------YFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVI----VSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE-----HPSYHQTV-EENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYI-FEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFV-------IPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI   I D NDN P+F  +   +++ E+        L  A D D G NG+  Y        F  DV         I++  G     L + + LD E+   Y   V   D G     S A ++VSV D NDN P           K T IE     N      +     +D D G    +          I     +   +T  I + E LD EE    + +++  D G   + +     + + D+NDN P  +     +P     V  EN      +  +  TD+D+D NG++    D      F + PV      + +    D E    Y + + A D G+P  + SA + I + D+NDN P F       S++   I EN      +  + A D D G N ++ Y  L P    +F++    G++   ++LDRE +  + F++   D G+    ++V+V VS+ID+NDN P F        +P N         L   GT V  I   D D G NS +   I+     D+  D  F +D + G I    +  R+    Y   +   D G   R S A   I +
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDV---------IETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF---------KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT-----QSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---------LPRHGT-VGLITVTDPDYGDNSAVTLSIL-----DENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINV 663          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 4.088e-88
Identity = 224/705 (31.77%), Postives = 349/705 (49.50%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGP-TTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC  I +    +  CF+E++V +                      +  IR  I DINDN+P F   V  I I E+  I +K  LP AVD D     + +Y L   ++     + E    D     I  K L   DRE    Y + +   D G P  S    +++ + D NDN P+F+ +   V++ E+   G  +  L ATD D GEN  + + FS+ V++  R+ FH++++TG ++I E LD E+   +   V+A D G   A  +A V V+V D NDN P I + Y+ +    T++      +N + +++ V+D D+ + G V C       F L P  + +   + +     LDYE        ++  D G+P L  S    I ++D NDN+P+F       ++ ENN  GI + KV ATD DS  N +INY +   +   FS+D  TG +      DREK   Y  ++ A+D G P  + +  V ++I DQNDN+P F        Y F + EN P +  +G I   DPD G N  V  + L   + FTI    G+IR N   DRE +  + F V+  D G + + +S  VT++V+D NDN+P F++P ++ +   +      GT+V ++ A+D D G N+ + Y I+ GN+RD     +F +DQ+ G+I L       D+G++ + +  +D G P
Sbjct:   91 IDREKLCAGIPR----DEHCFYEVEVAI---------------LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL---DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPA--RAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH----NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 142.51 bits (358), Expect = 1.308e-32
Identity = 131/478 (27.41%), Postives = 212/478 (44.35%), Query Frame = 1
Query: 1570 DAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQK-FILVPPNNREGSTWKINLVE-SLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQG---LNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHP---DQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            D  F    ++  + D NDN P      +  S     I   + IN +Y++    DPD G  G+   +L  SQ  F L      EG      +V+  LD EE++     +   D G PQ +S+   ++ + D NDN P+F+      ++ EN   G  V ++ ATD D   N KI++S    + +++   F ++  TG I  K   DRE+  +++L V A D G       A VL+ +TD NDN P       +N     +  + EN P N  I  I   D D   NG+V   F      F + P   +Q ++ T   LD E+   +   +   D G      S  + + V DENDN P F   T    +V I   ++ G  + ++ A D D GPN+ ++Y ++  ++  +     F +D++ G + + + L R+    Y+  ++  D G PP  S     + I +    S    + +YN
Sbjct:  117 DEIFRLVKIRFLIEDINDNAPLFPATVINIS-----IPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVT-CFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF---TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPE-----FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYN 576          

HSP 3 Score: 126.716 bits (317), Expect = 1.005e-27
Identity = 153/586 (26.11%), Postives = 234/586 (39.93%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMY-------YFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVI----VSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE-----HPSYHQTV-EENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYI-FEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFV-------IPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI   I D NDN P+F  +   +++ E+        L  A D D G NG+  Y        F  DV         I++  G     L + + LD E+   Y   V   D G     S A ++VSV D NDN P           K T IE     N      +     +D D G    +          I     +   +T  I + E LD EE    + +++  D G   + +     + + D+NDN P  +     +P     V  EN      +  +  TD+D+D NG++    D      F + PV      + +    D E    Y + + A D G+P  + SA + I + D+NDN P F       S++   I EN      +  + A D D G N ++ Y  L P    +F++    G++   ++LDRE +  + F++   D G+    ++V+V VS+ID+NDN P F        +P N         L   GT V  I   D D G NS +   I+     D+  D  F +D + G I    +  R+    Y   +   D G   R S A   I +
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDV---------IETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVF---------KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT-----QSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---------LPRHGT-VGLITVTDPDYGDNSAVTLSIL-----DENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINV 663          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A2T7PLW9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_05694 PE=4 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 9.341e-100
Identity = 262/778 (33.68%), Postives = 397/778 (51.03%), Query Frame = 1
Query:  706 LKYSLNSKNDHLRIGD----IRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDS-KNFNIISYRL----ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSI------VIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGS--TWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL---SPVEKFTIHPDQGIIRTNQQLDRE-NKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPR---KSYANYVIKIDNSAQRSQTLNNMKYN 2967
            LKYS++++    +I +    IR  + +DRE  C +  K  D    C  E  V V          Y+    +   + I  + + + DINDN+P F  P+ ++ + ES  +G  +    A+D D+  N +I  Y+L    EN E  +       S+ D     + L L +P+DRE  S+Y L +IA D G P  SG + I I + D NDN P F    + +   ES   G  I+ L ATD D+G+NG V +YFSS  + ++  +F ID +TG + + E LD+EK +   F V ARD G+    S+A V ++V D NDN P+I +         TL  G  +I +   +      V VSD DSG  G + C++  S   +        GS   +KI L   LDYE  +     + C D G P   +S    I +RD NDN+P+F  P YH ++ ENN+ G  + +VVA D DS  NG + YS+     S F+IDP+TG +R+  SFDRE+++ Y L V ARD G PA + +A V + I DQND+  +F        + F ++E  P+  ++ T+   D D+   GQ+ ++FL   SP  +F I    G I T ++LDRE ++ V++F V V+D       +S SVTV V D ND+ P    P   + +V+I Y    G+++AR+EA D DEG N  L + + S  + D     +FFM+  +G++ L R L   +   Y L + V D G   +   ++  N V+ + N +  S   +   +N
Sbjct:   64 LKYSISTQGSSFKIDENTSTIRTAQVLDREHAC-EFNKPSDP---CELEFDVGV----------YTWEPNLYDLLMIVHVTVVLEDINDNAPLFPSPMVSLSVPESEPVGYMLLTSGAMDMDTGPNNSIQRYQLLPDKENFELQV------MSSVDGLSTDLGLVLRKPLDREVQSVYYLQVIAYDGGYPQRSGSVNITIYVQDVNDNPPKFSQVLFNITADESARVGVPIVRLTATDPDAGQNGQVSFYFSSRTSPKILDQFSIDENTGAIILREALDFEKERRLQFVVEARDHGSPPQQSQAAVIINVADVNDNAPQIEI---------TLPPGGASIPESLKVGSFIAHVSVSDADSGRNGELSCNVTNSHYRL----EQFSGSLYIYKILLQRRLDYEVAHRHVVNVTCTDAGSPPKRNSTSFVIEVRDENDNAPVFTKPEYHISIRENNEPGRFIFQVVAMDPDSYENGNVTYSLLENPSSAFTIDPLTGVLRALKSFDREEKSGYHLVVQARDRGTPALTSTAVVHVDIDDQNDSPTHF----AQPHFDFSVEERRPAGTVVDTLRVIDRDDMAVGQLQFSFLPESSPPPEFQIDVYTGTITTTRELDREGSENVYQFHVYVVDAENTLFNDSASVTVVVTDANDHAPVIAFPNKFNNTVRIPYNMPPGSIIARVEASDMDEGENGTLTFSVESSEAVD-----VFFMNGVSGELILTRRLEHNEAKTYRLMVTVQDSGYAIQMVSRTPLNVVVTLGNGSSLSPHADKASHN 799          

HSP 2 Score: 169.474 bits (428), Expect = 1.000e-38
Identity = 165/627 (26.32%), Postives = 268/627 (42.74%), Query Frame = 1
Query: 1093 ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYN-------LNL-IATDKGKPSLSGKLKI---EIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYY--------FSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPK---IYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT-----IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL-SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQ-DMGVYILKMMVSDQGN 2880
            E  +   +++  + S+F    N   ++  Q +DRE+   +N       L   +     +P+L   L I    + + D NDN P+F +    ++V ESE  G+++L   A D D+G N  +  Y        F   V S V       S+   L + + LD E    Y   VIA D G         + + V D NDNPPK   +      D   R        +      +  +DPD+G  G V           ++   + + +T  I L E+LD+E+    +F++   D G P   S     I + D+NDN+P  E   P    ++ E+ + G  +  V  +D DS  NG+++ ++ +   S++ ++  +G+     I  +   D E    + ++V   D G P +  S + +I + D+NDN P F        Y   I+EN      I  + A DPD   NG V Y+ L +P   FTI P  G++R  +  DRE K+ +   V+  D+G     ++  V V + D+ND+   F  P  D     +     AGT+V  +  ID+D+     L +  +  +S        F +D   G I   R L R+    VY   + V D  N
Sbjct:   59 EEFQKLKYSISTQGSSFKIDENTSTIRTAQVLDREHACEFNKPSDPCELEFDVGVYTWEPNLYDLLMIVHVTVVLEDINDNAPLFPSPMVSLSVPESEPVGYMLLTSGAMDMDTGPNNSIQRYQLLPDKENFELQVMSSVDGL----STDLGLVLRKPLDREVQSVYYLQVIAYDGGYPQRSGSVNITIYVQDVNDNPPKFSQVLFNITADESAR--------VGVPIVRLTATDPDAGQNGQVSFYFSSRTSPKILDQFSIDENTGAIILREALDFEKERRLQFVVEARDHGSPPQQSQAAVIINVADVNDNAPQIEITLPPGGASIPESLKVGSFIAHVSVSDADSGRNGELSCNVTN---SHYRLEQFSGSLYIYKILLQRRLDYEVAHRHVVNVTCTDAGSPPKRNSTSFVIEVRDENDNAPVFT----KPEYHISIRENNEPGRFIFQVVAMDPDSYENGNVTYSLLENPSSAFTIDPLTGVLRALKSFDREEKSGYHLVVQARDRGTPALTSTAVVHVDIDDQNDSPTHFAQPHFD---FSVEERRPAGTVVDTLRVIDRDDMAVGQLQFSFLPESSPPPE----FQIDVYTGTITTTRELDREGSENVYQFHVYVVDAEN 659          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A210QG07 (Protocadherin-11 X-linked OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13067 PE=4 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 1.340e-98
Identity = 239/660 (36.21%), Postives = 352/660 (53.33%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDS-KNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV-EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIIS---GNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            NDNSP F      + +SE +Q+G  I    A+D D+ +N +I SY L    + +F LI + S+     + I LK+   +DRE    Y L +IA+D+G P  +G +KI I + D NDN P F  + Y   + E++  G  IL++ ATD D+  N  + Y FSS V+ +V+ KF I+S++G +S+   LDYE+   Y F V+ RD G     + A+V V + D NDN P+I +     S   T I     + +  + V VSD DS   G  +C + G+   +     N     +KI +   LDYE        + C D+G PQ  ++    I ++D+NDN+P F    Y  T++E+N  G  V +V+ATD+DS  NG+++YS++    S+FSIDP  GTI + +S DRE R   +  V A D G+P  S S  V + + D NDNTP F        + F + EN      +GT+ AED D G N Q  + F+ P+   F ++ D G+I    +LDRE + ++ F+V V DKG  R+ ++  VTV V D+NDN P  V P N + +V + Y   AGTL++++EA D D+G NS L Y I +    NS D     +F M   +G + + R L   D   Y L + V D G    KSY N  + I
Sbjct:  138 NDNSPVFPASEVALTVSEGVQVGHVILTSGAIDRDTGQNNSIQSYELV-PSNEMFGLI-QASDLGGG-SDIGLKVRFKLDRETRDFYELKVIASDRGFPVRTGSVKINITVTDFNDNSPAFSRANYSTTIPENKAVGSTILIVSATDFDTANNAKLTYSFSSRVSQKVQHKFSINSTSGQISVIAPLDYEQDTQYQFQVVVRDQGQPPLSASASVTVDIQDLNDNAPQININL---SPAGTDISEAAAVGQYVASVAVSDRDSKANGNARCQVMGNNFRLEEIYTN----MYKILIQNKLDYETDKFHNVTVNCQDQGVPQQQNTTSFFIRVQDVNDNAPEFTKTKYQVTMQESNDPGAYVKEVIATDKDSGNNGRVSYSLEPDGQSFFSIDPTMGTISAIVSLDRELRPVIRFHVTATDQGDPQLSSSTVVEVILGDINDNTPTFTQQ----KFHFHVLENQDRGPKVGTLTAEDQDAGANSQFSFDFVPPIPADFRLNQDTGVITGYTKLDRELQKMYNFTVMVTDKGTPRRYSTAQVTVEVEDDNDNIPVIVHPNNFNNTVYLPYTVNAGTLISQVEAYDIDDGDNSRLRYYIDTIDPPNSGD-----VFSMGLFSGSLVVARKLQLYDADSYRLVLSVKDGGLNELKSYTNLNVII 778          

HSP 2 Score: 169.088 bits (427), Expect = 2.294e-38
Identity = 156/575 (27.13%), Postives = 255/575 (44.35%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYF---SSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLV------QCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP---IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKI-------NYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            + I++ + D NDN P+F  S   + V E    GH+IL   A D+D+G+N  +  Y    S+++   ++       S   L +   LD E   +Y   VIA D G         + ++V D NDN P       + +   T I     +     IV  +D D+ N   +      +   K   KF +        ++ +I+++  LDYE+    +F +V  D+G+P L++S    + I+D+NDN+P   I   P+    + E    G  V  V  +DRDS  NG         N+ ++ +  + + I      I++K+ ++ +K   + ++V  +D G P Q  + +  I + D NDN P F        Y   ++E+    A +  + A D D G NG+V Y+ L P  +  F+I P  G I     LDRE + V  F V   D+G  +  +S  V V + D NDN P F   T       +      G  V  + A D+D G NS   +  +     D      F ++Q  G I     L R+   +Y   +MV+D+G P R S A   +++++
Sbjct:  128 IPIQVTVDDVNDNSPVFPASEVALTVSEGVQVGHVILTSGAIDRDTGQNNSIQSYELVPSNEMFGLIQASDLGGGSDIGLKVRFKLDRETRDFYELKVIASDRGFPVRTGSVKINITVTDFNDNSPAF-----SRANYSTTIPENKAVGSTILIVSATDFDTANNAKLTYSFSSRVSQKVQHKFSI------NSTSGQISVIAPLDYEQDTQYQFQVVVRDQGQPPLSASASVTVDIQDLNDNAPQININLSPA-GTDISEAAAVGQYVASVAVSDRDSKANGNARCQVMGNNFRLEEIYTNMYKI-----LIQNKLDYETDKF--HNVTVNCQDQGVPQQQNTTSFFIRVQDVNDNAPEFTKT----KYQVTMQESNDPGAYVKEVIATDKDSGNNGRVSYS-LEPDGQSFFSIDPTMGTISAIVSLDRELRPVIRFHVTATDQGDPQLSSSTVVEVILGDINDNTPTF---TQQKFHFHVLENQDRGPKVGTLTAEDQDAGANSQFSFDFVPPIPAD------FRLNQDTGVITGYTKLDRELQKMYNFTVMVTDKGTPRRYSTAQVTVEVED 669          

HSP 3 Score: 120.553 bits (301), Expect = 1.703e-23
Identity = 107/350 (30.57%), Postives = 158/350 (45.14%), Query Frame = 1
Query: 1951 DINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSI----DPVTGT---IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV-----EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            D+NDNSP+F       TV E  Q G V+L   A DRD+  N  I       S   F +    D   G+   ++ +   DRE R  Y+L V A D G P ++GS  + IT+TD NDN+P F   N    Y   I EN    + I  + A D D   N ++ Y+F S V      KF+I+   G I     LD E    ++F V V D+G      S SVTV + D NDN P+  I  + +    IS     G  VA +   D+D   N +   Q++  N R    ++I+    K   I +Q  L  +    + + +   DQG P +++  ++ I++ +    +      KY
Sbjct:  136 DVNDNSPVFPASEVALTVSEGVQVGHVILTSGAIDRDTGQNNSIQSYELVPSNEMFGLIQASDLGGGSDIGLKVRFKLDRETRDFYELKVIASDRGFPVRTGSVKINITVTDFNDNSPAFSRAN----YSTTIPENKAVGSTILIVSATDFDTANNAKLTYSFSSRVSQKVQHKFSINSTSGQISVIAPLDYEQDTQYQFQVVVRDQGQPPLSASASVTVDIQDLNDNAPQININLSPA-GTDISEAAAVGQYVASVAVSDRDSKANGNARCQVMGNNFR---LEEIYTNMYK---ILIQNKLDYETDKFHNVTVNCQDQGVPQQQNTTSFFIRVQDVNDNAPEFTKTKY 474          

HSP 4 Score: 63.929 bits (154), Expect = 3.755e-6
Identity = 75/297 (25.25%), Postives = 127/297 (42.76%), Query Frame = 1
Query: 2107 VSYFSIDPVTGTIRSKISFDREKRASYQLS-VFARDLGEPAQSGSAN--------VLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVL-YTFLSPVEKFTI--HPDQGI-----IRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQ 2934
             S F I+  + ++ +K+  DRE     +++ +   ++    Q G+          + +T+ D NDN+P F            + E      +I T  A D D G N  +  Y  +   E F +    D G      ++   +LDRE +  +E  V   D+G   +  SV + ++V D NDN P F   +  + S  I      G+ +  + A D D   N+ L Y   S  S+ + Q K F ++  +G I +   L  +    Y  +++V DQG PP  + A+  + I    DN+ Q
Sbjct:   75 ASNFQINETSSSLLTKVVLDRETLCPDEVACILEFNVAVYKQLGTNQLDLHQIIPIQVTVDDVNDNSPVFPA----SEVALTVSEGVQVGHVILTSGAIDRDTGQNNSIQSYELVPSNEMFGLIQASDLGGGSDIGLKVRFKLDRETRDFYELKVIASDRGFPVRTGSVKINITVTDFNDNSPAF---SRANYSTTIPENKAVGSTILIVSATDFDTANNAKLTYSFSSRVSQ-KVQHK-FSINSTSGQISVIAPLDYEQDTQYQFQVVVRDQGQPPLSASASVTVDIQDLNDNAPQ 362          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A3N0Z7N3 (Protocadherin-1 OS=Anabarilius grahami OX=495550 GN=DPX16_10899 PE=4 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 3.682e-98
Identity = 255/747 (34.14%), Postives = 373/747 (49.93%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDIRVKK-PIDRESL--CGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNRE---GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI   + PIDRE+L  C + GK C    F  FE+ V   +               + +  +   RI++ DINDN+P F  PV T+ + E+  +G+   +PLA D+D++ + +  Y L     A  LF L       +     I L  L   DRE    Y+L + A D G P       + + I DANDN P FE S+Y   V E+   GH +L +KA D D G NG + Y     +   V K   ID S+G + +   LD E++    F V+ARD G     SK  V + V+D NDN P + +     VT S     I     +    ++V VSD D G   +V C + G   F L P ++        + +     LDYE     R  IV  D G P L+S++  ++ + D NDNSPIF    +     E NQ G  V+ VVA+D DS  N ++ YSI  DS +   F IDP +G +R++   DRE +  Y+  V A D G P+  G+A V+I + D+NDN P F  L+G   Y F + EN P  + +G +  +D DEG N QV  +    V KF I    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN P    P+N S+ +++S +    ++V  +EA D D G N+ L Y I  GN  D     +F++   NG+I L + LTR+  G++ L + VSD+G P R + A
Sbjct:   55 YKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPC----FLEFEVSVTDLI--------------QNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGSLFSIPLATDKDTERYGVADYTLMAGPEAVALFGLQVAEDRGEKLPQLIVLGSL---DRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPTFEKSSYEAEVAENSPIGHSVLQVKANDSDMGPNGEIEYTLHQAI-DPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVMDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVDVVASDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFM-LSG---YSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSN-SSFMRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHD-----LFYISPSNGEITLTKELTRKHSGLHRLVVKVSDRGKPSRHAIA 769          

HSP 2 Score: 167.548 bits (423), Expect = 6.329e-38
Identity = 150/578 (25.95%), Postives = 242/578 (41.87%), Query Frame = 1
Query: 1276 IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK---FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            I++ D NDN P F +    ++V E+   G L  +  ATDKD+   G+  Y   +   +       +    G     L +  +LD E    Y   + A D G    +S A ++V + D NDN P         S     +   + I      V  +D D G  G ++  L   Q    VP   R + S+  I +   LD EE N  +F +V  D+G    +S     I + D NDN+P  E        H      + E+   G  V  V  +DRD   N  +   +       F + P + +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDN+P F         +FE+   +EN P   ++  + A D D G N +++Y+ ++       F I P  G +R    LDRE+K  +EF V   DKG+     + +V + V+D NDN+P+F++     +    S L+    L  V  +   D DEG N+ +   +     +       F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGSLFSIPLATDKDTERYGVADYTLMAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPTF-----EKSSYEAEVAENSPIGHSVLQVKANDSDMGPNGEIEYTLH--QAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVMDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDRDEGENAVVTCVV--AGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFS------PTLFEVEFAEENQPGEKVVDVV-ASDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML-----SGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGK-------FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINV 668          

HSP 3 Score: 115.546 bits (288), Expect = 6.652e-22
Identity = 110/365 (30.14%), Postives = 170/365 (46.58%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKI-------SFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF---LSPVEKFT-IHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIP-----TNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRA--LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQ 2970
            +DINDN+P F  P    +V EN   G +    +ATD+D++  G  +Y++     +V+ F +  V      K+       S DRE + SY L++ A D G P +  SA + + I D NDN P F+      SY  E+ EN P    +  + A D D G NG++ YT    + PV K   I    GII     LDRE     +F V   DKG   + +   V++ V+D+NDN P   I      T+      IS     GT VA ++  D+DEG N+ +   +++G+   Q +             FLQ    L  + +  Y ++++  D GNP   S  +  +++    DNS   S TL  +++ +
Sbjct:  122 QDINDNTPQFPSPVLTLSVPENTHMGSLFSIPLATDKDTERYGVADYTLMAGPEAVALFGLQ-VAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPTFE----KSSYEAEVAENSPIGHSVLQVKANDSDMGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVMDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDRDEGENAVVTC-VVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAE 480          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: E7F743 (Protocadherin 1a OS=Danio rerio OX=7955 GN=pcdh1a PE=4 SV=2)

HSP 1 Score: 350.517 bits (898), Expect = 6.780e-98
Identity = 256/747 (34.27%), Postives = 372/747 (49.80%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDIRVKK-PIDRESL--CGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNRE---GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI   + PIDRE+L  C + GK C    F  FE+ V   +               + +  +   RI++ DINDN+P F  PV T+ + E+  +GA   +PLA D+D++   +  Y L     A  LF L       +     I L  L   DRE    Y+L + A D G P       + + I DANDN P FE S+Y   V E+   GH +L +KA D D G NG + Y     +   V K   ID S+G + +   LD E++    F V+ARD G     SK  V + V D NDN P + +     VT S     I     +    ++V VSD D G   +V C + G   F L P ++        + +     LDYE     R  IV  D G P L+S++  ++ + D NDNSPIF    +     E NQ G  V++VVA+D DS  N ++ YSI  DS +   F IDP +G +R++   DRE +  Y+  V A D G P+  G+A V+I + D+NDN P F  L+G   Y F + EN P  + +G +  +D DEG N QV  +    V KF I    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN P    P+N S+ +++S +    ++V  +EA D D G N+ L Y I  GN  D     +F++   NG+I L + LTR+  G++ L + VSD+G P R + A
Sbjct:   55 YKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPC----FLEFEVSVTDLI--------------QNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSL---DRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAI-DPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFM-LSG---YSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSN-SSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHD-----LFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIA 769          

HSP 2 Score: 171.4 bits (433), Expect = 3.406e-39
Identity = 151/578 (26.12%), Postives = 246/578 (42.56%), Query Frame = 1
Query: 1276 IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK---FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            I++ D NDN P F +    ++V E+   G L  +  ATDKD+  NG+  Y  ++   +       +    G     L +  +LD E    Y   + A D G    +S A ++V + D NDN PK        S     +   + I      V  +D D G  G ++  L   Q    VP   R + S+  I +   LD EE N  +F +V  D+G    +S     I + D NDN+P  E        H      + E+   G  V  V  +D+D   N  +   +       F + P + +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDN+P F         +FE+   +EN P   ++  + A D D G N +++Y+ ++       F I P+ G +R    LDRE+K  +EF V   DKG+     + +V + V+D NDN+P+F++     +    S L+    L  V  +   D DEG N+ +   +     +       F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKF-----EKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLH--QAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVV--AGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFS------PTLFEVEFAEENQPGEKVVEVV-ASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML-----SGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGK-------FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINV 668          

HSP 3 Score: 119.783 bits (299), Expect = 2.713e-23
Identity = 112/365 (30.68%), Postives = 171/365 (46.85%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS--LSVSYFSIDPVTGTIRSKI-------SFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF---LSPVEKFT-IHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIP-----TNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRA--LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQ 2970
            +DINDN+P F  P    +V EN   G +    +ATD+D++ NG  +Y++ +   +V+ F +  V      K+       S DRE + SY L++ A D G P +  SA + + I D NDN P F+      SY  E+ EN P    +  + A D D G NG++ YT    + PV K   I    GII     LDRE     +F V   DKG   + +   V++ V D+NDN P   I      T+      IS     GT VA ++  DKDEG N+ +   +++G+   Q +             FLQ    L  + +  Y ++++  D GNP   S  +  +++    DNS   S TL  +++ +
Sbjct:  122 QDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQ-VAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFE----KSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC-VVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAE 480          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: K1Q454 (Protocadherin-9 OS=Crassostrea gigas OX=29159 GN=CGI_10009300 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.094e-97
Identity = 245/727 (33.70%), Postives = 385/727 (52.96%), Query Frame = 1
Query:  748 GDIRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE---KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            G + V   IDRESL       C  +  C   L V+ R                 S      ++IKI+DINDNSP F +    + +SE   +G   P+  AVD D  +F++  YR+   E A F++  + +   S++ ++ LK  + +DRE    Y   ++A D G P+  G L + + +LD ND+QP+F  + Y + V E       IL L A D+D G NG V+Y  S     ++ K F +  ++G L + E+L +E  K Y   V A D       S+  V V+V D ++NPP+I ++ ++++ K  ++E  +  N   + V V DPD+G  G + C ++ S+KF L   N  E   +K+ + ++LD E ++  R  +VC D G P L +S    + + D ND+SPIF  PSY    +E+N  G  +++V A+D+D   N +I Y + S S   F IDP +G I ++   DRE+     L V A D G PA++G+ +V+I ITD NDN P FQ      S+ F I+EN P  + +G + A D DE  N ++ ++ L        F I P+ G IRT + LDRE  A ++FSV   D G   Q++SV +++ V+D NDN P F+ P++++++V ISY     T++A ++  D D+G NS + Y      +RD+    IF ++  +G + L + LT  ++G Y L ++  D+G PPR S     I +
Sbjct:  185 GSLSVGMRIDRESLSE-----CKFQTECLLNLDVICR--------------NSGSFYQKLELKIKILDINDNSPTFPEDSARLSVSEGSLVGTSFPIEGAVDRDGGHFSVNLYRVV-PETAPFSVQFQKNVDGSSLVRLILK--KTLDREQQKSYQFQIVAEDGGNPANVGSLVVFVDVLDINDHQPVFSQTHYNLTVDEDVAVNTTILTLTARDEDEGLNGDVIYSLSPRQDEKILKLFQVVPTSGSLQVKESLIFEPGKQYRIIVEASDRAKQPLMSQTQVTVNVRDTHNNPPRIKVDLLSNTDKAQILESASP-NAPIAHVTVDDPDTGYNGKINCSIQ-SEKFQLQKFNVLE---YKVVVAQALDREVQSEYRVTVVCQDEGNPPLNASSTFNVTVLDENDHSPIFTKPSYVVQTQEDNNIGASLIRVSASDKDIGKNAEITYRLQS-SKYNFLIDPRSGLISAQFRLDREETPLITLGVLAVDGGSPARTGTTSVIIKITDINDNKPEFQ----NQSFEFAIQENAPKYSSVGLLVATDKDE--NEKITFSLLPQYNGGIPFEILPN-GTIRTTEVLDRETIANYQFSVVATDSGSPPQQSSVKISIDVLDMNDNAPIFMFPSDNNSTVIISYQTLPHTVIAHLDTRDIDQGLNSTVTYV-----TRDRNYSHIFQLNSLSGRLILMKQLTTAEIGKYKLSIIAQDKGTPPRTSERTMTIVV 871          

HSP 2 Score: 167.162 bits (422), Expect = 9.052e-38
Identity = 148/555 (26.67%), Postives = 260/555 (46.85%), Query Frame = 1
Query: 1306 PIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTF--------NVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGL-VQCDLKGSQKFILVPPNNREGSTW-KINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI----DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP---VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            P+        NV E    G +I  + ATD +   N L M +     ++ +   FH++  +G LS+   +D E +    F        +VI R+SG  + + K  +K+ ++D NDN P     +  DS + ++ EG + +   + I    D D G+  + +   +  +  F +    N +GS+  ++ L ++LD E++   +F IV  D G P    S    + + DIND+ P+F    Y+ TV+E+      +L + A D D  LNG + YS+    D   +  F + P +G+++ K S   E    Y++ V A D  +        V + + D ++N P  +      +   +I E+   NA I  +  +DPD G NG++  +  S    ++KF +   + ++   Q LDRE ++ +  +V   D+G      S +  V+V+DEND+ P F  P   S  V+    +  G  + R+ A DKD G N+ + Y++       Q+    F +D ++G I  Q  L R++  +  L ++  D G+P R    + +IKI
Sbjct:  126 PVILGQILHYNVSEESPLGTMIGNI-ATDANITSNDLTMEFIFLSQSNPLTSLFHLEEKSGSLSVGMRIDRESLSECKFQTECLLNLDVICRNSG--SFYQKLELKIKILDINDNSPT----FPEDSARLSVSEG-SLVGTSFPIEGAVDRDGGHFSVNLYRVVPETAPFSVQFQKNVDGSSLVRLILKKTLDREQQKSYQFQIVAEDGGNPANVGSLVVFVDVLDINDHQPVFSQTHYNLTVDEDVAVNTTILTLTARDEDEGLNGDVIYSLSPRQDEKILKLFQVVPTSGSLQVKESLIFEPGKQYRIIVEASDRAKQPLMSQTQVTVNVRDTHNNPPRIKVDLLSNTDKAQILESASPNAPIAHVTVDDPDTGYNGKINCSIQSEKFQLQKFNVLEYKVVVA--QALDREVQSEYRVTVVCQDEGNPPLNASSTFNVTVLDENDHSPIFTKP---SYVVQTQEDNNIGASLIRVSASDKDIGKNAEITYRL-------QSSKYNFLIDPRSGLISAQFRLDREETPLITLGVLAVDGGSPARTGTTSVIIKI 660          

HSP 3 Score: 123.635 bits (309), Expect = 2.391e-24
Identity = 106/377 (28.12%), Postives = 170/377 (45.09%), Query Frame = 1
Query: 1174 LLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQK--FILVPPNNREGSTWKI------NLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQT---VEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSY-FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQ 2268
            + Q +DRE  S Y + ++  D+G P L+      + +LD ND+ PIF   +Y+V  +E    G  ++ + A+DKD G+N  + Y   S      +  F ID  +G +S    LD E+    T  V+A D G+ A     +V + + D NDN P    E+   S +  + E       +YS V         G LV  D   ++K  F L+P  N  G  ++I         E LD E     +F +V  D G P   SS +  I + D+NDN+PIF  PS + +   +        V+  +   D D  LN  + Y     + S+ F ++ ++G +         +   Y+LS+ A+D G P ++    + I +T Q
Sbjct:  521 VAQALDREVQSEYRVTVVCQDEGNPPLNASSTFNVTVLDENDHSPIFTKPSYVVQTQEDNNIGASLIRVSASDKDIGKNAEITYRLQSS-----KYNFLIDPRSGLISAQFRLDREETPLITLGVLAVDGGSPARTGTTSVIIKITDINDNKP----EFQNQSFEFAIQENA----PKYSSV---------GLLVATDKDENEKITFSLLPQYN-GGIPFEILPNGTIRTTEVLDRETIANYQFSVVATDSGSPPQQSSVKISIDVLDMNDNAPIFMFPSDNNSTVIISYQTLPHTVIAHLDTRDIDQGLNSTVTYVTRDRNYSHIFQLNSLSGRLILMKQLTTAEIGKYKLSIIAQDKGTPPRTSERTMTIVVTSQ 874          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 344.354 bits (882), Expect = 2.818e-99
Identity = 254/750 (33.87%), Postives = 376/750 (50.13%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDIRVKK-PIDRESL--CGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLEN--HEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEY------SIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    G+I   + PIDRE+L  C   GK C    F  FE+ V   +               + +  +   RI++ DINDN+P F  PV T+ + E+  +GA   +P A D D++   ++ Y L       ALF+L  + +N D       L +L  +DRE    Y+L + A D G PS      + + I DANDN P FE S+Y   V E+   G+ +L +KA D D G NG + Y      +  V K   I+ STG +S+   LD E++  + F+VIARD G     S   V + V D NDN P + +  +   G RT  +G   I+++       ++V VSD D G   +V C + G   F L P  +      K   +++   LDYE     R  IV  D G P L+S++   + + D NDNSPIF  P +     E NQ G  VL V+A D DS  N ++ YSI  DS +   F IDP +G +R++   DRE +  Y+  V A D G P+  G+A V+I + D+NDN P F       SY F + EN P  + +G +   D D+G N QV  +    V  F +    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN P    P+N S   ++S L    ++V  +EA D D G N+ L Y I  GN  +     +F++   +G+I L + LTR+  G++ L + VSD+G P R + A
Sbjct:   55 YKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPC----FLEFEVSVTDLI--------------QNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSL--QMAN-DRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQ-ASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGI---GLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML----SSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFR-RLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHE-----LFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIA 769          

HSP 2 Score: 172.17 bits (435), Expect = 6.448e-43
Identity = 166/645 (25.74%), Postives = 276/645 (42.79%), Query Frame = 1
Query: 1132 WSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSL--------------SGKL-KIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKE--YSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK---FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIIS--GNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +   D    +IF   + PIDRE +    +      KGKP                S +L +  I++ D NDN P F +    ++V+E+   G    + +ATD+D+  NG++ Y  S+   +       + +  G     L +   LD E    Y   + A D GT + +S A ++V + D NDN P+          +++  E   + N    YS++ V   DS  G   + +    Q    VP   + E ST  I++   LD EE +  +F ++  D+G    +S+    I + D NDN+P  E        H      + E+   G  V  V  +D+D   N  +   +       F + P   +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDN+P F         +FE+   +EN P   ++  I A D D G N +++Y+ ++       F I P  G +R    LDRE+K  +EF V   DKG+     + +V + V+D NDN+P+F++     +S   S L+    L  V  +  +D D+G N+ +   +    GN         F +    G I    +  R+    Y  ++   D G PPR SY    I +
Sbjct:   63 YLRVDGKTGEIFTTEI-PIDRETLKDCRI------KGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQF---------EKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVV--AGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFS------PPLFEVEFAEENQPGEKVLDVI-ALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML-----SSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGN---------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINV 668          

HSP 3 Score: 137.502 bits (345), Expect = 3.916e-32
Identity = 134/471 (28.45%), Postives = 200/471 (42.46%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGI--VVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQ 2403
            ISE + +G  + L    D+D     +++  +       F L P   +      + FL+   P+D E +  Y + ++A D G P+LS    + +++ D NDN PIF    + V   E    G  +L + A D DSG N  ++Y   +D  S  R  F ID S+G +     LD E  + Y F V A D G  +    ATV + V+D NDN PK  L     S   +++E    ++    +V V D D G    VQ  ++      +V     +  T  I    S D E+ +   F +   D GEP  +S     I + D NDN+P+   PS       +  A    VV  V A D D   N ++ YSI   +    F I P  G I+      R+    ++L V   D G+P++   A V I + +   N    +GL G   Y             + T  A DPD G+  Q
Sbjct:  367 ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGD--VPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIAD--SSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLS----SYSFSVLENMPPLSP-VGMVTVLDMDKGENAQVQLSVEPDVGNFVV-----QNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISNVSLVEGLVGHSLY-----------TPLDTDIAGDPDYGLAAQ 812          

HSP 4 Score: 120.939 bits (302), Expect = 5.216e-27
Identity = 113/372 (30.38%), Postives = 174/372 (46.77%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS--LSVSYFSIDPVT--GTIRSKI----SFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS---PVEK-FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVI-----PTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGD--------IFLQRA--LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQ 2970
            +DINDN+P F  P    +V+EN   G       ATDRD++ NG + Y + +   + + FS+      G    ++    + DRE + SY L++ A D G P++  SA + + ITD NDN P F+      SY  E+ EN P    +  + A D D G NG++ YT      PV K   I    GII     LDRE  +  +F V   DKG   + ++  V++ V D+NDN P   I      T+      IS     GT VA ++  DKDEG N+ +   +++G+        + F  +  GD         FLQ    L  + +  Y ++++  D GNP   S  +  +++    DNS   S  L  +++ +
Sbjct:  122 QDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFE----KSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC-VVAGD--------VPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAE 480          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 343.969 bits (881), Expect = 1.006e-97
Identity = 254/750 (33.87%), Postives = 376/750 (50.13%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDIRVKK-PIDRESL--CGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLEN--HEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEY------SIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    G+I   + PIDRE+L  C   GK C    F  FE+ V   +               + +  +   RI++ DINDN+P F  PV T+ + E+  +GA   +P A D D++   ++ Y L       ALF+L  + +N D       L +L  +DRE    Y+L + A D G PS      + + I DANDN P FE S+Y   V E+   G+ +L +KA D D G NG + Y      +  V K   I+ STG +S+   LD E++  + F+VIARD G     S   V + V D NDN P + +  +   G RT  +G   I+++       ++V VSD D G   +V C + G   F L P  +      K   +++   LDYE     R  IV  D G P L+S++   + + D NDNSPIF  P +     E NQ G  VL V+A D DS  N ++ YSI  DS +   F IDP +G +R++   DRE +  Y+  V A D G P+  G+A V+I + D+NDN P F       SY F + EN P  + +G +   D D+G N QV  +    V  F +    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN P    P+N S   ++S L    ++V  +EA D D G N+ L Y I  GN  +     +F++   +G+I L + LTR+  G++ L + VSD+G P R + A
Sbjct:   91 YKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPC----FLEFEVSVTDLI--------------QNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSL--QMAN-DRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQ-ASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGI---GLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML----SSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFR-RLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHE-----LFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIA 805          

HSP 2 Score: 172.94 bits (437), Expect = 5.793e-43
Identity = 166/645 (25.74%), Postives = 276/645 (42.79%), Query Frame = 1
Query: 1132 WSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSL--------------SGKL-KIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKE--YSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK---FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIIS--GNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +   D    +IF   + PIDRE +    +      KGKP                S +L +  I++ D NDN P F +    ++V+E+   G    + +ATD+D+  NG++ Y  S+   +       + +  G     L +   LD E    Y   + A D GT + +S A ++V + D NDN P+          +++  E   + N    YS++ V   DS  G   + +    Q    VP   + E ST  I++   LD EE +  +F ++  D+G    +S+    I + D NDN+P  E        H      + E+   G  V  V  +D+D   N  +   +       F + P   +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDN+P F         +FE+   +EN P   ++  I A D D G N +++Y+ ++       F I P  G +R    LDRE+K  +EF V   DKG+     + +V + V+D NDN+P+F++     +S   S L+    L  V  +  +D D+G N+ +   +    GN         F +    G I    +  R+    Y  ++   D G PPR SY    I +
Sbjct:   99 YLRVDGKTGEIFTTEI-PIDRETLKDCRI------KGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQF---------EKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVV--AGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFS------PPLFEVEFAEENQPGEKVLDVI-ALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFML-----SSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGN---------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINV 704          

HSP 3 Score: 137.502 bits (345), Expect = 5.278e-32
Identity = 134/471 (28.45%), Postives = 200/471 (42.46%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGI--VVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQ 2403
            ISE + +G  + L    D+D     +++  +       F L P   +      + FL+   P+D E +  Y + ++A D G P+LS    + +++ D NDN PIF    + V   E    G  +L + A D DSG N  ++Y   +D  S  R  F ID S+G +     LD E  + Y F V A D G  +    ATV + V+D NDN PK  L   + S    ++E    ++    +V V D D G    VQ  ++      +V     +  T  I    S D E+ +   F +   D GEP  +S     I + D NDN+P+   PS       +  A    VV  V A D D   N ++ YSI   +    F I P  G I+      R+    ++L V   D G+P++   A V I + +   N    +GL G   Y             + T  A DPD G+  Q
Sbjct:  403 ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGD--VPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIAD--SSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFS----VLENMPPLSP-VGMVTVLDMDKGENAQVQLSVEPDVGNFVV-----QNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISNVSLVEGLVGHSLY-----------TPLDTDIAGDPDYGLAAQ 848          

HSP 4 Score: 121.324 bits (303), Expect = 4.434e-27
Identity = 113/372 (30.38%), Postives = 174/372 (46.77%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS--LSVSYFSIDPVT--GTIRSKI----SFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS---PVEK-FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVI-----PTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGD--------IFLQRA--LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQ 2970
            +DINDN+P F  P    +V+EN   G       ATDRD++ NG + Y + +   + + FS+      G    ++    + DRE + SY L++ A D G P++  SA + + ITD NDN P F+      SY  E+ EN P    +  + A D D G NG++ YT      PV K   I    GII     LDRE  +  +F V   DKG   + ++  V++ V D+NDN P   I      T+      IS     GT VA ++  DKDEG N+ +   +++G+        + F  +  GD         FLQ    L  + +  Y ++++  D GNP   S  +  +++    DNS   S  L  +++ +
Sbjct:  158 QDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFE----KSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC-VVAGD--------VPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAE 516          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 329.331 bits (843), Expect = 6.456e-94
Identity = 247/745 (33.15%), Postives = 371/745 (49.80%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDIRVKK-PIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI     PIDRE+L  D     + +P CF E +V +            +     S   +   RI+I D NDN+P F  P+  + I E+  +GA   +P+A+D+D+ +  I  Y+L +   A  LF+L     N D  + Q+ +  L  +DRE    Y+L++   D G P       + I I D NDN P FE S Y   + E+   G  +L +KA D D G NG V Y F    +  V++  HID +TG + +  ++D E+V    F+V ARD+G  A  SKA V ++V D NDN P I +     V        +     +    ++V VSD D G   +V C + G   F L   +  + ++ +   +++   LDYE     R  IV  D G P L+S++  ++ + D+NDN+P+F    Y     E NQ G  VL VVATD DS  N ++ YSI  DS +   F I+P TG +R     DRE +  Y+  V A D G P+  G+A V++ + D+NDN P F  LNG   Y F + EN P  + +G +   D D+G N  V  +      KF I    G I ++   DRE ++ + F ++ +D G   + + V +T++V+DENDN P    P+N S    +  L +  T V +++A D D G N+ L Y I  GN        +F +   +G+I L +  TR+  G++ L + VSD+G P R + A
Sbjct:   65 YKLEVGGPYLRVDGKTGDIYTTDVPIDRETLK-DCRNLFEGDP-CFLEFEVSI------------TDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSL-QVADNTDEKVPQLIV--LGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQP-SPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFM-LNG---YSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKF-LQPLTSPDTRVEKVDAEDIDTGLNAELVYSITGGNPH-----GLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTA 781          

HSP 2 Score: 177.948 bits (450), Expect = 1.198e-44
Identity = 167/635 (26.30%), Postives = 268/635 (42.20%), Query Frame = 1
Query: 1183 PIDRENVS-----------MYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI------DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGP----TTINKEYSIVIVSDPDSGNGGLVQCDLKGS----QKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP--------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLN--------GKINYSIDSLSVS-------YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK---FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            PIDRE +                 +  TD  K S    ++  I+I D NDN P F +    + + E+   G    +  A DKD+G NG+  Y  +S   S+    F +      D     L +   LD E+   Y  ++   D GT   +S A +++++ D NDN PK          +R+  EG     T + +    V  +D D G  G V           Q+ + +  N     T  I +  S+D EE  + +F +   D G    +S     I ++D NDN+P        +  H      V E+   G  V  V  +D+D   N        G + + + S S S       YF        +++    D E+   Y++ + A D G PA S + ++ + +TD NDN P F         ++E+   +EN P + ++  + A D D G N ++LY+ ++       F I+P+ G +R   QLDRE K  +EF V   DKG+   + + +V V V+D NDN+P+F++          S L+    L  V  +  ID D+G N+H+   +   N +       F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:   89 PIDRETLKDCRNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSG--SDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKF---------ERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHN-----TGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYF--------LQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS------PSLYEVDFAEENQPGDKVLDVV-ATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFML-----NGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGK-------FVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINV 680          

HSP 3 Score: 138.658 bits (348), Expect = 1.671e-32
Identity = 125/443 (28.22%), Postives = 203/443 (45.82%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHP--SYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSY 2316
            +SE + +G  + L    D+D     +++  +       F L    ++  ++  + FL+   P+D E +  Y + ++A D G P+LS    +++++ D NDN P+F  S Y V+  E    G  +L + ATD DSG N  ++Y   +D  S  +  F I+ +TG + +   LD E  + Y F+V A D G  +    ATV V V+D NDN PK  L   + S    ++E    ++    +V V D D G    VQ  ++    KF++      +  T  I    S D E+ +   F +   D G+P  +S     I + D NDN+P    P  S ++ ++        V KV A D D+ LN ++ YSI   +    F I    G I     F R+    ++L V   D G+P++  +A V I + +   N    + L G   Y
Sbjct:  379 VSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGD--VPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITD--SATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFS----VLENMPPLSP-VGMVTVIDADKGENAHVQLSVEPENGKFVI------QNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTSPDTRVEKVDAEDIDTGLNAELVYSITGGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFVNETISNVTLVESLVGHSLY 806          

HSP 4 Score: 51.6026 bits (122), Expect = 7.145e-6
Identity = 57/229 (24.89%), Postives = 98/229 (42.79%), Query Frame = 1
Query: 2308 GSYIFEIKENGPSNAIIGTIHAED--PDEG-------------INGQV--LYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRD-----QTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNS 2928
             S  ++++E  P N ++G++ A+   PD G             ++G+   +YT   P+++ T+       +  + L   +    EF V + D         +   + + DENDN P+F  P  +    + +Y+   G   +   A+DKD G N   DY++ SG+        Q  D     D+K   + +   L R+    Y L + V D G PPR S A   I I ++
Sbjct:   33 ASITYQLREEQPPNTLVGSLAADQGLPDTGHLYKLEVGGPYLRVDGKTGDIYTTDVPIDRETL-------KDCRNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYV---GAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADN---TDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDT 248          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 328.176 bits (840), Expect = 3.288e-93
Identity = 232/708 (32.77%), Postives = 346/708 (48.87%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENH--EHALFTL-IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRT-LIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC  +     +E  CF+E++V V                      +  IR  I DINDN+P F   V  I I E+  I  + P+P A D D     I  Y L     E  L  +  PE   +   I Q      Q +DRE    + + +   D G P  S    +++ + D NDN+P+F++S   VNV E+   G  +  L ATD D G N  + + FS+ ++   ++ F IDSSTG +++ + LD E    +   V+A D    A  S+ATV V+V D NDN P I   Y+ +    T L+     +N + +++ V+D D+   G V C       F L P  N +   + +     LDYE        IV  D G+P L +S    I I+D NDN+P+F  P    ++ ENN  G  ++K+ ATD DS  N  I YS+   +   F+IDP +G +      DREK+  Y  +V ARD G      +  V + + DQNDN+P F        Y F + EN P    +G I   D D G N  V  + ++  + F I P  G+I+ N   DRE ++ + F V+ +D G+++  +   VT++V+D NDN P FVIP+++ +   + +    G++V R+ AID D G N+ L Y II G+ R      +F +D+  G+I LQ  +   D G++ L + V D G P
Sbjct:  131 IDRERLCSGVF----NEKRCFYEIEVAV---------------LPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQ------QNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQ---FLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTH----AEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPR-----GLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 799          

HSP 2 Score: 143.665 bits (361), Expect = 5.006e-34
Identity = 152/576 (26.39%), Postives = 229/576 (39.76%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGW--LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTG---TIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFV-------IPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI   I D NDN P+F+++   +++ E+    +   +  A D D G NG+  Y     V+              W  L + + LD E    +   +   D G     S A ++V+V D NDN P        DS     +     +    + +  +D D G+   +           + P   R    + ST  I + + LD E   V + I++  D       S     + + D+NDN P      I    +    + EN      +  +  TDRD+DLNGK+    D      F + PV      + +    D E    Y + + A D G+P  + SA VLI I D+NDN P F            I EN      +  I A D D G N  ++Y+ L P   + F I P  GI+  +++LDRE +  + F+V   D G    +++V+V + V D+NDN P F        +P N         L   GT V  I   D D G N+ +   II+G          F +D K G I       R+    Y   +   D G     SYA   I +
Sbjct:  163 VKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRP-----VFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQ----ISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSA--TPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTD--HDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFP----QPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYS-LGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPEN---------LPLYGT-VGLITVTDADAGDNAIVTLSIINGKDN-------FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINV 703          

HSP 3 Score: 138.658 bits (348), Expect = 1.659e-32
Identity = 134/479 (27.97%), Postives = 209/479 (43.63%), Query Frame = 1
Query: 1570 DAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL-KGSQKFILVPPNNREGSTWKINLVE-SLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQG---LNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQV-LYT-FLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVI--DKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            D  F    ++  + D NDN P      +  S     I   T IN  Y +    DPD G  G+   +L K   +F L      EG  W   +V+ +LD E ++     I   D G P  +S+   ++ + D+NDN P+F+       V EN   G  V ++ ATD D   N +I++S    I   +  +F+ID  TG I  K   DRE    ++L V A D    A    A V++ +TD NDN P       +N     +  + EN P N  I  I   D D  +NG+V  YT    P     +  DQ ++ T   LD E     E++++++  D G      S  V + + DENDN P F  P      + I   +  GT + +I A D D G N+ + Y +   ++ D      F +D ++G + + + L R+    Y   ++  D G+ P +S     + + +    S    + +YN
Sbjct:  157 DEIFRLVKIRFLIEDINDNAPLFQSTVINIS-----IPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVL-LSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYE--TTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQP---EIQLSIPENNDPGTQLIKITATDADSGSNALIIYSL-GPDAPDG-----FNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYN 616          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 328.561 bits (841), Expect = 1.393e-92
Identity = 232/709 (32.72%), Postives = 345/709 (48.66%), Query Frame = 1
Query:  772 IDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTL----IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRT-LIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            IDRE LC  +     +E  CF+E++V V                      +  IR  I DINDN+P F   V  I I E+  I  + P+P A D D     I  Y L       F L     PE   +   I Q      Q +DRE    + + +   D G P  S    +++ + D NDN+P+F++S   VNV E+   G  +  L ATD D G N  + + FS+ ++   ++ F IDSSTG +++ + LD E    +   V+A D    A  S+ATV V+V D NDN P I   Y+ +    T L+     +N + +++ V+D D+   G V C       F L P  N +   + +     LDYE        IV  D G+P L +S    I I+D NDN+P+F  P    ++ ENN  G  ++K+ ATD DS  N  I YS+   +   F+IDP +G +      DREK+  Y  +V ARD G      +  V + + DQNDN+P F        Y F + EN P    +G I   D D G N  V  + ++  + F I P  G+I+ N   DRE ++ + F V+ +D G+++  +   VT++V+D NDN P FVIP+++ +   + +    G++V R+ AID D G N+ L Y II G+ R      +F +D+  G+I LQ  +   D G++ L + V D G P
Sbjct:   91 IDRERLCSGVF----NEKRCFYEIEVAV---------------LPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQ------QNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQ---FLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTH----AEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPR-----GLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 760          

HSP 2 Score: 139.043 bits (349), Expect = 1.441e-32
Identity = 157/582 (26.98%), Postives = 236/582 (40.55%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTG--W--LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTG---TIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGT----IHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFV-------IPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI   I D NDN P+F+++   +++ E+    +   +  A D D G NG+  Y        E      I++  G  W  L + + LD E    +   +   D G     S A ++V+V D NDN P        DS     +     +    + +  +D D G+   +           + P   R    + ST  I + + LD E   V + I++  D       S     + + D+NDN P      I    +    + EN      +  +  TDRD+DLNGK+    D      F + PV      + +    D E    Y + + A D G+P  + SA VLI I D+NDN P F           EI+ + P N   GT    I A D D G N  ++Y+ L P   + F I P  GI+  +++LDRE +  + F+V   D G    +++V+V + V D+NDN P F        +P N         L   GT V  I   D D G N+ +   II+G          F +D K G I       R+    Y   +   D G     SYA   I +
Sbjct:  123 VKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDI-IETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRP-----VFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQ----ISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTD--HDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQP--------EIQLSIPENNDPGTQLIKITATDADSGSNALIIYS-LGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPEN---------LPLYGT-VGLITVTDADAGDNAIVTLSIINGKDN-------FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINV 664          

HSP 3 Score: 138.272 bits (347), Expect = 2.845e-32
Identity = 134/480 (27.92%), Postives = 210/480 (43.75%), Query Frame = 1
Query: 1570 DAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK--GSQKFILVPPNNREGSTWKINLVE-SLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQG---LNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQV-LYT-FLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVI--DKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            D  F    ++  + D NDN P      +  S     I   T IN  Y +    DPD G  G+   +L   G+ +F L      EG  W   +V+ +LD E ++     I   D G P  +S+   ++ + D+NDN P+F+       V EN   G  V ++ ATD D   N +I++S    I   +  +F+ID  TG I  K   DRE    ++L V A D    A    A V++ +TD NDN P       +N     +  + EN P N  I  I   D D  +NG+V  YT    P     +  DQ ++ T   LD E     E++++++  D G      S  V + + DENDN P F  P      + I   +  GT + +I A D D G N+ + Y +   ++ D      F +D ++G + + + L R+    Y   ++  D G+ P +S     + + +    S    + +YN
Sbjct:  117 DEIFRLVKIRFLIEDINDNAPLFQSTVINIS-----IPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVL-LSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYE--TTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQP---EIQLSIPENNDPGTQLIKITATDADSGSNALIIYSL-GPDAPDG-----FNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYN 577          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 313.923 bits (803), Expect = 3.030e-90
Identity = 222/687 (32.31%), Postives = 336/687 (48.91%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTI----------------NQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIF-ENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTS-EVRKKFHIDSSTGWLSI--SETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPP-----KIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPS--------YHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-----VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGS--YIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIH----PDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVA-RIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGN 2880
            ND++P F  P   + ISES  +G ++PLP A+D D+   +I  YR+         L P +S  +S                  ++  L+L + +DRE V  Y L L   D G P LSG + + I ++DANDN P+F +  T  V + E    G  ++ L+A D D+G NG + Y F + +TS   +   H+D +TG +++  +E LD E +  +   V+ARD G  +  +  TV V + D NDN P      +  EY+ D G + +   P+       ++ VSDPD G+ G V   L+      L  PN  +   + +     LDYEE       ++  DRG P+L+      I + DINDN+P+F +P+        Y  ++ EN  AG VVL ++ATD DS  NG I +++  L+        FS++  TG +      DREKR  Y+LSV A D G P +   A V +T+ D+NDN P F G++   +  Y F ++E       +GT+   D DEG N +V    +       I        G++RT   LDRE++  +E SVR +D G      S  V+++V D NDN P    P  + T   +     AG LV   + A D D G N    Y+II GN +      IF ++  +G + L R ++  D G++ L + V D+G 
Sbjct:  138 NDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGP-FSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPS--GTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQ---FLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPK-----GIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGG 813          

HSP 2 Score: 107.842 bits (268), Expect = 9.463e-24
Identity = 100/362 (27.62%), Postives = 153/362 (42.27%), Query Frame = 1
Query: 1948 RDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVT------------------------GTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF----LSPVEKFTIHPD--QGI--IRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF-VIPTNDS----TSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQI-ISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            RDIND++P F  P  + ++ E+   G  V    A D D+  N   +Y I + S     + P +                          +  +   DRE   SY+L ++  D G P  SGS  + I + D NDN P F         I E  + G S   +  + A DPD G NG + Y+F     S   +  +H D   G+  +R  ++LDRE   VH   V   D G L +  SV+VTV + D+NDN P F VI           VKI     +GT V  I   D D G +  +D ++     +   + +K+ F+ +        R L  ++   Y + ++ +D+G P      N +I +
Sbjct:  135 RDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTS---VVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTT------RLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISV 487          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 293.508 bits (750), Expect = 6.898e-83
Identity = 225/743 (30.28%), Postives = 360/743 (48.45%), Query Frame = 1
Query:  742 RIGDI-RVKKPIDRESLCG--DIGKCCDS---------EPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQI-------FLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEV-----RKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYL-EYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGS----QKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            R G++    + +DRE+LCG  D G  C           +P  FF+L + VR+                           + DINDN+P F+ PV T+ + E+   G + P+  A D DS+   +  Y L   + A        S F+ ++ +        +L + + +DRE   +Y +NL A D G P  SG   + I + D NDN P+F+ +   V + E+   G  ++ L A+D+D+G N  V+Y   +           ++ F +D ++G ++++  L+ E+   Y   ++A D G +   + ATV V+V D NDN P I + + V        I   + +N   +++ VSDPD G  G V C +       Q   L  PN      + +   E+LDYE +N     I   D G   L+ +    I + D NDN+P+F  P+Y  +V ENN  G  ++ V ATDRD D N ++ Y +   + + F +DP TG I      DREK+A+Y  ++ A+D G P   G+A V++ + D NDN P F        + F + EN P ++ +G +   D DEG NG+V  + L    +  F+I P+ G+IR+N   DRE +  +   V+  D G   + ++V V + V+D NDN P  ++P +++T   +      GT+V  + A+D D   N+ L Y I+ GN  +     +F +D   G+I L   LT    G++ L + VSD G
Sbjct:   91 RTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKL-IEVRI--------------------------NVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATV------SAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQ-----YLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFS----LAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHN-----LFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 163.696 bits (413), Expect = 5.224e-41
Identity = 123/396 (31.06%), Postives = 195/396 (49.24%), Query Frame = 1
Query: 1156 NQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE----YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGS---QKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQT---VEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGS-ANVLITITDQNDNTPYFQGLNGG 2307
            NQ  L+  + +D E  + Y + + A D G  SLS  + + IK+LD+NDN P+F   TY V+V E+ + G  ++ + ATD+D  +N  ++Y+   D  +     FH+D  TG +S++E LD EK   Y+F ++A+D G       ATV V+V+D NDN P+  L     YV ++  +         +    +V V+D D G  G V+  + G+   Q F + P    E    + N+    D E+R+     +   D GEP  +S+ +  I + DINDNSPI   P  + T   V      G +V +V A D D+++N ++ Y I   +  + F IDPV G I             ++L V   D+G   Q  + A V + + +  +N  Y + L  G
Sbjct:  441 NQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPT----MFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPK---------HSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDP----ESGMIRSNV--GFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLENATYIEWLIAG 817          

HSP 3 Score: 140.584 bits (353), Expect = 8.189e-34
Identity = 152/577 (26.34%), Postives = 258/577 (44.71%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMY-YFSSDVTSEVRKKFHI-DSSTG----WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGP--TTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR-----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTV------EENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT----IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +++ I + D NDN P F      V+V E+  +G    +  A D DS  NG+  Y    SD  +    +  + +++ G    +L + ++LD E+ + Y  N+ A D G+      A ++++V D NDN P      V D  +   +E P  + +      +  SD D+G+   V   L  S          +     + ++  + +   L+ EE  V R II+  D+G   + ++    + + D+NDNSP  E       V       E +   + V  +  +D D   NG +   I +  V  F +  +T      + ++ + D E +  Y + + A D G  + S + +V I + D NDN P F       +Y   + EN      + T+ A D D   N +++Y FL P     F + P+ GII   +QLDRE KA + F++   D+GI   E + +V V+V+D NDN PRF +   D     ++      + V  +   D DEG N  +   I+  ++R     ++F +D ++G I       R+    Y+L++  +D G P R S    VI +
Sbjct:  137 IEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSP------VFDQAEVN-VEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVP-FQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFT----EPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVY-FLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFD---FYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNR-----QLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHV 692          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 253.062 bits (645), Expect = 4.506e-70
Identity = 199/658 (30.24%), Postives = 299/658 (45.44%), Query Frame = 1
Query:  673 SNYFEIINNDDLKYSLNSKNDHLRIGDIRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDS-GKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS-----IDSLSVS-YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQG---LNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQ--LDRENKAV-HEFSVRVIDKGILRQENSVSVTVSVIDENDNE 2601
            S +F ++  DD       + D    G +  ++ IDRE  CG         P C     VL  +P    ++ ++  E +                ND++P F++    +EISES+ +G ++PL  A D D     + +Y L+ +E   F L        +   ++ +K    +DRE    Y L L A D G P  SG   + I +LD+NDN P+F  ++  V V+E    G ++L L ATD D G NG V+Y FSS V +EVR+ F +D  TG LS+   LD+E    Y  ++ ARD G  +  +   V V V D NDN P+I L+++  S G    +           +V VSD DS   GLV C L+G   F L+P  +     + +    SLD E+      ++   D G P   ++ +  + + D NDN P F   +Y  ++ ENN  G  V  V A D D++ NG I Y+     +   SVS Y SI+P +G I +    D E   S    V ARD G P    +A V + I D+NDN P        NG G  +  +  +     ++  + A D D   NG++ Y  +   E+  F I+   G + TN     D    A  H   V V D+G      + ++ + V    D +
Sbjct:   61 SRHFRLMRRDDFSLVHVEEAD----GTVSAREVIDREQQCG-------QAPSCVIRFDVLCTLPRGLFQLVHAEVELLDI--------------NDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENER--FGLALRARTDGAKYAELVVK--SRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRD----DYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTG--VVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDGD 683          

HSP 2 Score: 146.747 bits (369), Expect = 8.156e-36
Identity = 131/510 (25.69%), Postives = 224/510 (43.92%), Query Frame = 1
Query: 1468 HIDSSTGWLSISETLDYEK---------VKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPP-----KIYLEYVTDS---GKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES-LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQG---LNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            H++ + G +S  E +D E+         +++     + R       F     +V ++D ND+ P     ++++E +++S   G R  +EG              D D G   L    L  +++F L      +G+ +   +V+S LD E+       +   D G+P  + +    I + D NDNSP+F   S + TV E+   G V+L + ATD D   NG++ YS    +D+     F +DP TG +  K   D E  + Y++S+ ARD+G  +      VL+ + D NDN P  +    +   G  +F + E     + +G +   D D   NG V       P  K   + D  ++ TN  LDRE  A +   +   D G   +  +   TV ++DENDNEPRF   T +++ ++    ++ G  V  + A D D   N  + Y ++       +      ++  +G I+  R L  + M     ++   D G PP  + A   ++I
Sbjct:   76 HVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPR-----GLFQLVHAEVELLDINDHAPDFARSEMHVE-ISESVALGTRVPLEG------------ARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVF-VSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLEN---NSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRI 563          

HSP 3 Score: 144.821 bits (364), Expect = 2.787e-35
Identity = 159/602 (26.41%), Postives = 251/602 (41.69%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSST-GWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPT------TINKEYSIVIVSDPDSGNGGLV------QCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQT------VEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTG--TIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL------SPVEKF-TIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPT--NDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGV---YILKMMVSDQGNPPRKSYANYVIKI------DNSAQRSQTLN 2952
            +  E+++LD ND+ P F  S   V + ES   G  + L  A D D G N L  Y+   +    +  +   D +    L +   LD E+   YT  + A D G         V+++V+D NDN P     +   S   T+ E  T      T+N        +D D G  G V        D +  + F L P       T K++L   LD+E  +     I   D G   + +  +  + + DINDN+P  +     Q+      V E       V  V  +D DS  NG +   +      +F + P      + +  S DRE+ A Y L + A D G P +  +    + + D+NDN P F       +Y   + EN    A + T+ A D D   NG + Y  +      + V  + +I+P  G I   + LD E      F V+  D G+     + +V+V ++DENDN P    P   N +  V++      G LV  + A D D   N  L Y+I+ GN R+     +F +++  G++F   A           + L +MV D+G+P   + A   I++      D+ A  +Q L+
Sbjct:  120 VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPV----FAQTSCNVTVREDATPGTVLLTLN-------ATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDP------KTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHP--HFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHR----STYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERN-----LFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDGDDGADETQPLD 693          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.506 bits (615), Expect = 2.179e-64
Identity = 194/650 (29.85%), Postives = 316/650 (48.62%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKV------KYYTFNVIARDSGTDAAFS-KATVKVSVVDCNDNPPK----IYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQ--KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF---LSPVEKFTIHPDQGIIRTNQQLDRE-NKAVHEFSVRVIDKGI---LRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYL-DTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQ 2832
            N+++P F +    + I+E   + ++     A D+DS     + Y + E +    F + P+         Q++++    +DRE    Y+L + A D G   LS  + + + +LD NDN+P+F +S+Y+ +  E +  G L+  ++ATD D+G NG V Y F      + +  F +DS TG ++     D E +        ++F+V+A D G       +ATV+V V D NDNPP+    +Y   V++S              +   V  SD D G NG L     +G++  KF +      + ST +I L+ SLD EE      ++   D G   L +S    + + D NDN P F          E+ + G +++ + A+D D+  +G + Y+I + +  + F+ID  TG++      D E +  Y+L+V A D G P +S +  +++ + D NDN P F      G     I EN P    + T+ A DPD  +NG++ Y+      P   FTI P+ G I T  ++DRE    + E +VR  DK I    R+    +VTV V DENDN PRFV P    T++ +  L   AG++V  ++A D DE  N+ + Y +  G++       +F +D++ G I     L R+
Sbjct:  752 NNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPD--------GQLYVRY--ELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF-----EKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNL---------TQLLRVTASDVDEGVNGALRYAINEGNEGGKFTV------DASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFL----PGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTP----TAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAA-----ILFRLDRRTGIIETSTELDRE 1358          

HSP 2 Score: 208.379 bits (529), Expect = 3.220e-54
Identity = 170/548 (31.02%), Postives = 255/548 (46.53%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAK-----IPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQI--FLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSG--TDAAFSKATVKVSVV--DCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGS------TWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSL-SVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKEN--GPSNAIIGTIHAEDPDEGINGQVLY--TFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVID 2532
            NDNSP FS+   + +++E      K     I   LA D DS  F  ++Y L   E +      +W++    ++ +   L + +P+DRE+ + Y L   ATD G   L+   ++ + +LDANDN P  +N +    V E    G  +L + ATD D G N  + +  SS    +   +F +  + G LS++  LD E+  +Y   V   D      A  S A V+VS++  D NDN P         S +  L    + +    + V   DPDSG    V+  L    +          G       T ++ LV  LD E R      ++  D+G P LTS+    + + D NDN+P F    Y   + E+   G  VL++ A D D   NG++ Y I S      F +DPV GT+      DRE+ ASY+L+V ARD G PA+S +A+V +T++D ND +P FQ       Y    +EN  GP   I+  + A D D G +GQV Y     +    F++ PD G +   + LDRE +  H   +   D
Sbjct: 1611 NDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDS------DWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISS---GDPEGRFAV-GNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSA-VRVSLILTDVNDNAPAFT------SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQ----LSPYTVHARENTQGPPVLILQVV-ARDDDLGSSGQVTYAAAGGNDGGAFSVSPD-GHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 3 Score: 206.068 bits (523), Expect = 1.549e-53
Identity = 180/591 (30.46%), Postives = 258/591 (43.65%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTL-IEGPTTINKEYSIVIVSDPDSGNGGLVQCDL---KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREK------RASYQLSVFARDLGEPAQ-SGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE--KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +DRE  ++Y L + A D G         + I + DA D  P F    Y   V E+   G L+  + A+  D   N  V Y     V+ + R  F I+ S G +  +  +D E+  +Y   V+A   G      +A+V V V D N++ P      V D     + I     +N  +  V  +D DSG  G V+ ++    G +KF + P         ++ +   LD E R      +   D G   L+SS    + + D+NDN P+F   SY     E  + G +V  V ATD D+  NG + YS +   V+ F +D  TG I S   FDRE        AS+  SV A D G P      A V + + D NDN P F        Y   + E+  +   +  + A D DEG+NG + Y      E  KFT+    G I     LDRE  A +   V   D G      S +V V V+DENDN PRF   T    SV        G L+  + A D+D GP+  + Y I++GN+        F +D+  G +FL R L  +   +Y L +   D G PPR S    V+ +
Sbjct:  616 LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNAN--VTYLI---VSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAP------VFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFP-------DGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN-FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQF----AKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF---TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTH-----ATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHV 1172          

HSP 4 Score: 203.371 bits (516), Expect = 1.149e-52
Identity = 191/663 (28.81%), Postives = 297/663 (44.80%), Query Frame = 1
Query:  955 NDNSP-----HFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFN--IISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKP-SLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIY-LEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNRE-----GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKS 2895
            NDN P     +     ++  + ES   G    L    D DS   N  +    +  +E   F L     +         LK+   +DRE + MYNL ++A+D GKP + S    + + + D ND+ P F  S Y   + E   +G  +  + A D DSG N  + Y   S V+      F +D STG ++    +D E       N+ A+D G     +  ++ V+++D ND PP     +YV  + + +L  G   ++     V  +D D G  G V+ +         +P   RE       T K+  ++SLD EE      ++   DRG P L S+ +  +++ D+NDN P+F    Y  ++ EN   G  V  V ATD D   NG + Y + +   + F ++ VTG + +++S DRE+RA YQL V A D G       A V IT+ D  D  P F        Y F + EN     ++G++ A   D  +N  V Y  +S  ++  F+I    G I T   +DRE +A ++  V V + G +  E SVSV V   D N++ P F      S  V I+  +   +    + A DKD G N  + Y+I  GN  ++      F    +G ++++  L R+    Y L +   D G  P  S
Sbjct:  219 NDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVL-----HAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRY---SIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSL-PGLFVVS-----VSAADSDLGENGTVRYNFDPD-----MPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTF----ARDDYSFVVFENVAPGTLVGSVSASTLD--LNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRV-VANSGGVAGEASVSVLVH--DVNNHAPVF---DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK------FGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSS 844          

HSP 5 Score: 202.601 bits (514), Expect = 1.880e-52
Identity = 195/690 (28.26%), Postives = 306/690 (44.35%), Query Frame = 1
Query:  955 NDNSPHFSQP-VKTIEISESIQIGAKIPLPLAVDED--SKNFNIISYRL--ENHEHALFTLIPEWSNFDSTINQIFLKLLQ--PIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKE-SEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDS--GNGGLVQCDLKGSQK--FILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXX-XRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV-----EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            NDN+P F +P V  +   E   +G ++ L  AVD D      N  +Y++   N E  L    P          + FL L    P+DRE    Y L + A D G P   G+L++ + + DANDN P FE   Y  +V E S +   L  LL       G   L + +               D  TG +S  + LD+E  + YT ++ A D G      +AT  + ++D NDN P I   Y+  + +   ++         ++V V+D DS   NG L    + G+++  F+L  P        K+     LD E   +    I+  D G+P   S+    ++ + D+ND++P F   +Y   + E   AG  V  V A D DS LN K+ YSI S + + +FS+D  TG + +    DRE  +S  L++ A+D G   ++   ++ +T+ D ND  P F        Y+    EN      + ++ A D D G NG V Y F   +     E F +    G + T + LDRE    +   V+  D+G     ++  VTV V D NDN P F  P     S+  +  +  GT V  + A D D G N  + YQ+ +G++        F ++   G +  + +L R++  VY L++   D G+   +S A   I + ++     T     Y+
Sbjct:   17 NDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRP-------VTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLLH-----RGRGPLAVPF---------------DPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKV--ASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTK----YVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YPVQYFASILEN--EPGGTAVTTVTATDPDRGANGTVRYQLTAGDA------ARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYS 664          

HSP 6 Score: 202.216 bits (513), Expect = 2.171e-52
Identity = 179/584 (30.65%), Postives = 264/584 (45.21%), Query Frame = 1
Query: 1243 KPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE-YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-------KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGE--PAQSGSA-NVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-----------PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            +P +S   ++EI + D NDN P+F      + V+E+   G +I  L ATD D G+N LV Y     V S     F +D+++G L  S  LD E+   Y   V A D GT A  + A + V+V D NDN P+     Y  D  +    +G TT       V+  D DSG  G V   L  S+        F L P       T  +N+   LD E R          D G   L ++    + + D NDN+P  ++ S    V E+   G  +L++ ATD D  +N ++ +SI S      F++    G +    + DRE+++ Y L V   D     PA+  SA  V + +TD NDN P F       +      E+ P  A++ T+ A DPD G N  V Y   +               F ++   G +R  ++LDRE +  +  +V  +DKG     ++ ++ V+V D NDN PRF  P  +  +  I+  +  GT V R+ A D DEG N  L Y I SG   D T D  F +D   G + + R L R+    Y L +   D G P R   A+  + + +
Sbjct: 1493 RPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTY----SVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD-GTHA--TDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTT-RAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHP------VTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVG-NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALA-----PEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRF--PRREYEAA-IAEDEPPGTEVLRLSAWDPDEGANGELRYDIASG---DPTGD--FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSD 2046          

HSP 7 Score: 145.206 bits (365), Expect = 6.956e-35
Identity = 131/471 (27.81%), Postives = 213/471 (45.22%), Query Frame = 1
Query: 1594 VKVSVVDCNDNPP-----KIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCD-LKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAG-----IVVLKVVATDRDSDLNGKINYSI----DS-LSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKG---ILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDT-AGTLVARIEAIDKDEGPNSHLDYQIIS----GNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNS 2928
            V++SV D NDNPP     ++ LE   ++G+  +I            +  +D D G   LV    L GS+   +V     + ++  +     LD EER      +   D       +     + +RD NDNSP F   +Y   V E+          V+  V+A D DS   G++ Y++    DS  +   F + PVTG +      DRE RA Y L   A D G    + +A + + + D NDN P  Q      S   E+ E+ P    +  I A D DEG+N ++ ++  S  P  +F +  D G +   + LDRE ++ +   VRV D+      R  ++V V++ + D NDN P F  P +      ++  D+  G +VA ++A+D D G NS+++Y + +    G          F ++   G++ L R L R+    Y L ++  D+G PP  S A   + + ++
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVI----------FTLSATDADQGQNALVTYSVLSGSEGAFVV-----DAASGVLRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQN----DSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGND-GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRS-----ALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDA 1942          

HSP 8 Score: 95.9005 bits (237), Expect = 6.096e-20
Identity = 95/341 (27.86%), Postives = 145/341 (42.52%), Query Frame = 1
Query: 1951 DINDNSPIFEHPSYHQTV-EENNQAGIVVLKVVATDRDSDLNGKIN---YSIDSLSVSYFSIDPVTGTIRSKI------SFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEP--RFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDE-GPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRA--LTRQDMGVYILKMMVSDQGNP-PRKSYANYVIKIDN 2925
            D+NDN+P F  P   +   +E+   G  VL   A DRD   NG +N   Y I S +     + P   T R+ +        DRE   SY L+V A D G P + G   V +T+ D NDN P F+      +Y   + E+ P  A +               +L+    P+      P  G++ T Q LD E +  +  S+R  D G        +  + ++D NDN+P  RFV     + S  +      GT+ A +   D D    N  L   I+ GN R      +       G   L+ A  L R+ + +Y L ++ SD G P  R + A+ V+ +++
Sbjct:   15 DVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNG-VNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFE----KPAYRASVAEDSPVGAAL-------------RDLLHRGRGPL-AVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHF---VLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVND 333          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.246 bits (565), Expect = 1.843e-58
Identity = 189/677 (27.92%), Postives = 301/677 (44.46%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGK-PSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTIN------KEYSIVIVSDPDSGNGGLVQCDLKGSQKF---ILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA--GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQD---------MGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            NDN P F        + E   IG+ + L  A D D+    IISYRL   +   F++ P      +T +         +DRE    Y L + A D G  P LS    + + + D ND+ P F N+ Y+     S  +G  +  + A D D+G NG + +  S   ++     F +D   G +  +  L   +    T  V   D G     +  TV V   D  + P                  GP + +         +I +V+   S   G V   L           V P + E     +++  +LD+E ++    ++   D G P  ++  + E+ + DINDN+P F    +   V EN     +V+ + A D+DS +NG+++YSI D    + F ++P +G IRS  + DRE  ASY+L+V A D G P Q  +  VLI++TD+NDN+P F  +     +   ++E+      +  +   D DEG N  + ++ L P   F+IHP  G I  +++L+RE+++ +   VR  D        S  VT+ V D NDN PRF       T+  I + + +    LVAR+ A D D+G N  + + +     R QT++  F + + +G+I   R L  +D         +  Y   +   D+G PP  S A   I I
Sbjct:   20 NDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGD-GHFSVNPSTGQIITTAS---------LDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASA----GFSVDPRRGVIHAARALQGPR-DDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFP--------------RFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGE-----VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-----FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPA---WTVSTDVTIVVDDVNDNAPRF-----GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFM-----RSQTEN--FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINI 641          

HSP 2 Score: 187.963 bits (476), Expect = 5.719e-48
Identity = 159/556 (28.60%), Postives = 240/556 (43.17%), Query Frame = 1
Query: 1237 KGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSG-TDAAFSKATVKVSVVDCNDNPPKI----YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQK--FILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS--VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
             G+P L+G   + + + D NDN P F  +     V E    G  + L+ ATD D+G N ++ Y             F ++ STG +  + +LD E  + Y   V A D G T    S AT+ V+V D ND+ P+     Y+ Y   S                  V   D D+G  G ++  L GS    F + P   R G       ++      R+     +   D G P  ++     +  RD  +  P F       +  E+   G  +  V A  R S   G ++Y + S       F++DP +G +    + D E +  Y+L V ARD G P  S    + + + D NDN P F        +  ++ EN P   I+  + A D D GINGQV Y+ +       F ++P+ G IR+   LDREN A +E +V+  D+G   Q  +V V +SV DENDN PRF        S  +      G  V R+  +D DEGPN+ + + ++            F +    G+I + R L R+D   Y +K+  SD
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG-----DGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAP---------AGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDP---RRGVIHAARALQG----PRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSR----FWAKVPENTPPRTIV-VLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF----TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD-------PSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD 516          

HSP 3 Score: 182.185 bits (461), Expect = 3.612e-46
Identity = 180/693 (25.97%), Postives = 292/693 (42.14%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPI---------DRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL--SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILR--QENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSH-LDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTL--NNMKYNQNQHA 2982
            NDN+P F Q    IE  E  +  A +    A D D             +    F +  +  NF    +   +  ++P+            N++ Y+  + A D+G+P LS    + I I+  N N P F    Y   V  +  +G  IL + A D D   NG + Y   S V     ++F +D+  G+L +  +L  +    ++  V ARD G     S+AT  +SV + N   P+     +  S       G        + V  +D D+G NG +V     G    +     +   ++  + LV  LDYE   +    +   D G    T      I + D+NDN P+     Y+  + EN  +G  VL + A D DS  N    YS+D      F ++  TG + ++   D E + +Y+L+V A +  +     +A V + IT  N+  P F        Y F + E+ P  A +G++ A D D GI+G V Y     S  + F+++   G I  + QLDRE +A     V   + G +R    + V V V++ D ND  P F   ++     ++S   + GT V  + A D D  P      + I SGN+      + F ++   G I +   L R+ + +Y L ++  D G PP       V+ +++       L  ++ K  +NQ A
Sbjct:  533 NDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGA----------NGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAY---SVVGGNASRRFDVDAG-GFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAG-----SSLARVTATDTDAGVNGAIVYSIASGDGSGLF----DISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQRE----YNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVF---SSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNA-----GRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVTENQPA 1189          

HSP 4 Score: 147.902 bits (372), Expect = 9.517e-36
Identity = 147/558 (26.34%), Postives = 241/558 (43.19%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPK-IYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQL--TSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGK-INYSIDSLSVS-YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGIN-GQVLYTFLS--PVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDN 2598
            N  +P F+ P   + + E+   G+ +    A D D+     I Y + + + +          FD +     + L+  +D E   +YNL++ A D G  + +    + I + D NDN P+   S Y   + E+  SG  +L++ A D DS  N + MY    D  +++   F ++  TG L+    LDYE  + Y   V A +      +S A V V +   N+  P+ +  EY        ++     +      V  +D D+G  G V   L G  +      N   G   +I +   LD E        ++  + G  +          + I D ND  P+F    YH  V E    G  V+ V A D DS    +  ++ I S +    FSI+  TG I      DRE    Y L+V A D+GEP  +G+  V++ + D NDN P+        +   ++ EN P+   +  + A DPD   N G   +  L   P  +  F++    G+++T + +DRE K      V + D G     ++V++ +SV+D+NDN
Sbjct:  749 NQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGL--------FDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLD-DGEADL---FVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREY------NFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTG---EIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLL------TSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 5 Score: 131.724 bits (330), Expect = 7.865e-31
Identity = 124/463 (26.78%), Postives = 197/463 (42.55%), Query Frame = 1
Query: 1588 ATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGE-PQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV---EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLN 2952
             TV V V D NDN P+     +     R  +     I  + ++V  +D D+G   ++   L+G      V P     ST +I    SLD E R      +   D G  P L+SS    + + D+ND++P F +  Y      +  AG  V  V A D D+  NG + +S+   + + FS+DP  G I +  +  +  R    L+V   D G P +S    V +   D  +  P F      G   F  +E+ P    I  + A        G V Y   S     + F + P  G +  ++ LD E +  +E  V   D G       + + V V+D NDN P F   ++     K+       T+V  + A+DKD G N  +DY II GN        +F ++  +G+I     L R+++  Y L +  +D+G+P +      +I +    DNS + +Q  +
Sbjct:   10 GTVTVLVEDENDNLPRFGAAEL-----RAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNP-----STGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAP----GPRSFSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEF---SSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGN-----IGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFS 445          

HSP 6 Score: 80.8777 bits (198), Expect = 2.615e-15
Identity = 60/225 (26.67%), Postives = 104/225 (46.22%), Query Frame = 1
Query:  958 DNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSK-NFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNP 1629
            ++ P FS  +    +SE+  +G  +    A D DS   +   S+ +++              F    +   + +  P+DRE+V +YNL ++A D G+P  +G   + + + D NDN P    S+    V E++ +G  +L L+A D D   N    Y F    +    + +   SS+G L  +  +D E+   +   V   D+G+    S  T+ +SV+D NDNP
Sbjct: 1065 NDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAG--------RAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSS--AKVTENQPAGMTVLNLEAGDPDLPPN-KGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP 1278          

HSP 7 Score: 51.6026 bits (122), Expect = 1.721e-6
Identity = 45/161 (27.95%), Postives = 66/161 (40.99%), Query Frame = 1
Query: 1126 PEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSV 1608
            P W  + S  +   LK  +PIDRE    ++L +   D G P L+  + + + +LD NDN     +    VN   S   G  I  ++  D D      +   F+ D+TS     F    +T  L IS+    E      F +  R  G+D   S AT    V
Sbjct: 1219 PAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPD------ISDRFNCDLTSGPFNVFSFQPNTCRL-ISQPRSAEG----RFELSVR--GSDGKHSPATTTARV 1366          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 276.174 bits (705), Expect = 4.344e-75
Identity = 210/656 (32.01%), Postives = 323/656 (49.24%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEH-ALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYV-TDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREG-------STWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK----FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGN 2880
            NDN P F     T+ I ES+ +    P+  A D D+ N   + Y + + ++ A F+L        ST+  I  K   P+DRE    Y LN+ ATD+G P+L G   I I ILD ND+ P+F  ++Y+ ++ E+   G  IL + A D+DSG NG + Y    D   +    F +DSSTG +   + LD+E    YTFNVIA D G  +    ATV ++V+D NDN P++ + Y+   +G + +    + IN   + ++V+D DS      Q +LK       +   + EG         + I L + LD E        +   D+G P  ++     I + D+NDNSP F   +Y   + E  Q G  VL++ ATD D   NG ++YSI   + + +F +D  +G + +    DRE+ +S  +++ A+D G   ++GS  V +TI D NDN P F       SY   I E     A +  + A D D G NG++ Y   S   +    F ++   G++ T  QLDRE K+++ F+V   D G  +  +SV V +++ D NDN P F  P     S+  +  +  G L+ ++ A D DEG N+ + Y II GN+        F +D   G I    +L  +    + L +   D GN
Sbjct:   89 NDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKK---PLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAI-QSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNS--QTELK-------ITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFM----KSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVEYFASIMEN--EPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGN-----FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGN 718          

HSP 2 Score: 264.618 bits (675), Expect = 1.978e-71
Identity = 190/582 (32.65%), Postives = 289/582 (49.66%), Query Frame = 1
Query: 1165 FLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFI--LVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS-IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKS 2895
            F++L +P+DRE V  YNL L  TDKG PS S    + I + D NDN P F ++ Y  N+ E   +G  +L L ATD D G+NG V Y  +          F +D  +G ++ ++ LD E+V   T  + A+D G+       TV V+++D NDN P+    ++  S K T+ EG  +I      V  +D DSG+ G +  ++  S   +  L   N + G  W       LD E +++  F ++  D G+PQL SS + E+ I DINDN+P+F    Y  ++ EN   G  +L+V ATD D   N  I+Y  I   +   FSID  TG I +  S D E    + L + A+D G    + +A V +T+ ++ DN P F        Y F + EN P   ++G ++A   D+  NG + Y  +S  P   F +    GII+ N  +DRE KA +  +V      +       +V + V+D NDN P+F   +  S  V I      G +V    A+D D G N  + YQ+ S        + + +++  +G I L R LT  D   Y ++++ SD G+PP+ S
Sbjct:  376 FIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITG---GNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPR----FMKSSYKGTISEG-ASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWT---KSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPG-KLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFL----YEMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQF---STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS------NAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHS 930          

HSP 3 Score: 191.045 bits (484), Expect = 8.075e-49
Identity = 173/585 (29.57%), Postives = 269/585 (45.98%), Query Frame = 1
Query: 1204 SMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE--YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS-YFSIDPVTGTIRSKISFDREK----RASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK-FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKG-ILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLD--TAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVY--ILKMMVSDQGNPPRKSYANYVIKI 2919
            +MYN   I  DK          + + + D NDN P+F  + Y + V E  + G  +  +KA D D G+N     +F S V+     KF I+SSTG L +S+TLD E    Y   V A D+     +S A ++++V D ND  P ++ E  Y  +  +  LI G   IN        SD D G  GL++  +       L    + E +T ++ + +SLD+E   +    I   D G   L+S+    + + D+NDN+P+F       TV EN   G  V +  A+DRD+  N  I +S+ S + S  FS++  T  I +  + D E     R S+QL V A D G P  S   ++ + +TD+NDN+P F         +        S+  + TI AEDPD   NG+V Y+ +S     F +HP  G ++   Q+  +N  +++ +++  D G   RQ  +V   VSV  E    P    PT  S   + S  +   AGT V  + A       N +++Y + S +S+       F + +  G +   R + R+ MG    ++   V  QG   R S A   I +
Sbjct: 1131 AMYNDTTIKRDKAI--------VIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNA---KFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP-VFPESDYTVNITEDALI-GSLVINLN-----ASDKDIGQNGLIKYSISNGN---LAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF---------VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQI-PDNPTIYQLTIQASDGGQPSRQTQTV---VSVFKEG---PIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGG-----FEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITV 1673          

HSP 4 Score: 190.274 bits (482), Expect = 1.403e-48
Identity = 162/564 (28.72%), Postives = 264/564 (46.81%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFD-----STINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSI--VIVSDPDSGNGGLVQCDLKG---SQKFILVPPNNREGSTWKINLVESLDYEE----RNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDREN-KAVHEFSVRVIDK-GILRQENSVSVTVSVIDEN 2592
            NDN+P FS+ V  I +SE    G+ +    A+D D           E      F  +   +  D     S+  +  L L + +DRE  S YNL + ATD    +L    KIEI + D+ND +P+F  S Y VN+ E  + G L++ L A+DKD G+NGL+ Y  S+     +   F ++S+TG L ++++LD+E  + Y   + A+D G     S   V V+V+D NDN P    + VT + +         +N  + +     SD D+G    +   +     S+ F +        +T +I  + ++D E     R+  + +++  D+G P+L++     + + D NDNSP F  P         N     V+ + A D D + NGK+ YSI S +  YF++ P TG ++  I    +    YQL++ A D G+P++     V +         P F   +  GS    + EN  +   + T+ A  P   +NG + Y   S   K  F +    G+++T + +DRE   A     V  +DK G   + +S +VT++V D N
Sbjct: 1153 NDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDAD-----------EGDNAKFFYSLVSGTGMDKFFINSSTGE--LHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN---GNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRE-------NVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSV------NSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN-----VMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQ-MIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGS----VTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 5 Score: 169.088 bits (427), Expect = 5.190e-42
Identity = 186/673 (27.64%), Postives = 280/673 (41.60%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTW------KINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRE--------NKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNS 2928
            NDN+P F  PV+        +   K+    A D D     +ISY +    +          NF    +   +  L  +D E    ++L + A D G    +    + + +L+  DN P+F    Y   V E+   G L+  + AT KD  +NG + Y     V+ +    F +DS+ G + I+  +D E+   Y   VIAR        ++ATV + V+D NDN P+     V      T + G    N         D D+G  GLV+  L           +N EG  W       I L   L   +       ++  D G P   S+    I +  IN + P F   SY   V  +         VVA D+DS  NG++ YSI        F I P  G +  + S  +  + SY L V A D G P+ S S  V I I D ND+   F       ++ F + EN     ++GT+ A   D      ++Y+ +S    F +    G I T  +LDRE        N  + +      D  I R +  V VTV+  D NDN P F   +    ++ +S L   G+ V RI+A+D DEG N+   Y ++SG   D+     FF++   G++ L + L R+    Y L +  +D  N    S A   I + +S
Sbjct:  631 NDNAPVF-YPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNN--------GNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAI---VSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAA-----AVDLDAGKNGLVRYQLT----------SNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLS-IN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFP-GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFV----NNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVT--DLNDNAPVF---SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDK-----FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDS 1257          

HSP 6 Score: 164.081 bits (414), Expect = 1.666e-40
Identity = 174/636 (27.36%), Postives = 272/636 (42.77%), Query Frame = 1
Query: 1042 LAVDEDS-KNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKV------KYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE-YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL---KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAV----HEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKS 2895
            +AVD+DS KN  +     + +E  LF + P    +      I   LLQ +       Y+L + ATD G PS S  + + I I D+ND++ +F N+T+   V E+   G L+  L A   D      ++Y   S ++SE    F +D  +G ++    LD E++        Y     A  + T     KA V V+V D NDN P      Y     + +L   P    K        D D G+       L    G  KF +        ST +++L ++LD E  +    ++   D     L S+ + EI + D ND  P+F    Y   + E+   G +V+ + A+D+D   NG I YSI + ++ + F ++  TG +    S D E    Y+L++ A+D G    S + NV + + D NDN P F            ++EN  +   +G   A D D G N  + ++  S  P + F+++     I T   +D E         +  V   D+G  +     S+TV V DENDN P FV P   +    ++        V  I A D D   N  + Y IISGN      +  F +    G + +   +      +Y L +  SD G P R++
Sbjct:  969 VAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLY------IRKSLLQALKGS----YDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVY---SLISSE--SHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAM------DADEGDNAKFFYSLVSGTGMDKFFI------NSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQ----PVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN--------VMTITAEDPDRNSNGKVTYSIISGN------NGYFNLHPSTGQLQMIHQIPDNPT-IYQLTIQASDGGQPSRQT 1558          

HSP 7 Score: 122.865 bits (307), Expect = 7.094e-28
Identity = 112/358 (31.28%), Postives = 167/358 (46.65%), Query Frame = 1
Query: 1951 DINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSL-SVSYFSIDPV---TGT---IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF----LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVI----PTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIF--LQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQN 2973
            DINDN P F    Y   + E+           ATD D+  NG ++Y+I S  + + FS+      TG+   + +K   DRE    YQL++ A D G PA  G   + ITI D+ND+ P F       SY+  I EN      I  + A D D G NG + Y      +     F +    G+IRT Q LD E K  + F+V   D G+  + +  +VT++V+D NDN P+  I    P N   +++ S      T +A I   DKD   NS  + +I +G+  D+   K+ F+    G  F  LQ+ L R+ +  Y L + V+D+G P R +    +I + +    S    +  Y  N
Sbjct:   87 DINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFT----QNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIR-SENSLINTNIAYILVTDKDSNTNSQTELKITNGD--DEGCFKVEFL----GFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTAN 433          

HSP 8 Score: 58.9214 bits (141), Expect = 1.858e-8
Identity = 55/206 (26.70%), Postives = 85/206 (41.26%), Query Frame = 1
Query: 2284 YFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISG-NSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSY 2898
            +   ++ G SY F ++E  P    +G +      EG          SP ++F  + + G+I T  ++DRE        +R ++         +SV V V D NDNEPRF  PT   T ++I       T      A D D G N  +DY I SG N+   +             +  ++ L R+    Y L +  +D+G P    Y
Sbjct:    2 FAASVSAGSSYTFHVQEEQPPGTYVGKVDGASAFEG----------SP-KQFGFNSNTGVISTTARIDRETTTQISLQLRTLNP----SNQPISVQVQVDDINDNEPRF--PTLYYT-LRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGY 189          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 272.707 bits (696), Expect = 6.333e-74
Identity = 206/641 (32.14%), Postives = 315/641 (49.14%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            NDN+P F+  V    + E + +G+ +    AVD D      +SY L + + + FT+       DS   Q  ++     DRE  + Y + L A D G PS SG+  +EI+ILD NDN+P+F ++ Y  +V E    G  ++ + A+DKD+G N  + Y F+S  T+     F +D+ TG +++S +LD+E+   Y   +   D G+      + + ++V D NDNPP       + S  ++ ++  T    + S    +D DS  NG LV   +KG+   +       +GST  I++ +S DYE +      +   DRG P    + +  I I D+ND+SP+F   +Y + + E+   G  V+ V ATD DS   G++ Y + S +V   F+ID  +G+IR     DRE   SY L V ARD G  ++S S  V I + D NDN+P FQ     G Y+F + E+      IG + A D D+  NG V Y      + F+I+   G+I    QLD E K  +  +V   D G   + +   V V V D NDN P+F       T   +     AG  V  + A D D G N  + Y I+SGN     ++  F MD+  G+I  +  L R+ +  Y L +   D
Sbjct:  162 NDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTV-------DS---QGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHA---FTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP-----VFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVFT----IDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQ-----GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCT---VGENLAAGVAVCYVTATDADSGANGKISYSILSGN-----ENMAFAMDRFTGEITTRVPLDRETIASYSLTINADD 764          

HSP 2 Score: 268.085 bits (684), Expect = 1.698e-72
Identity = 220/773 (28.46%), Postives = 342/773 (44.24%), Query Frame = 1
Query:  697 NDDLKYSLNSKNDHLRI------GDIRVKKPIDRESLCG-DIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKIN-------LVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            N  + YS+ S N+++        G+I  + P+DRE++    +    D      F     V +                           I D NDN P F+ P +   ISE    G ++    A D D      ++Y +   ++   F L P             L +   +DRE +  Y L + A+D G P  S    I + +LD NDN P FE S +   ++E       +L +K  DKD G NG +    S     E    F IDS TG++     LDYE    Y   V ARD G+ +  + A VK+++++ NDN P           + T I     IN    +V ++  DS    L          F +V  N   GS++KI+       + + LD E       ++   + G    +  +   I + D+NDN+P+F   SY +++ EN   G  V KV ATDRD   N K+ Y +     S F ++P TG + +K   DRE +ASY L V A D G+P+QS  A + +TI D NDN+P F        Y   + EN  + + I  + A DPD G NG+V Y+ +S      F I    G I     +DRE  A +  ++   D G+    ++  V ++V DENDN P F    ++ TS  I    + G+ VA + A D+DEG N+ + Y I+ G++        F ++  NG + +++ + R+ +  Y L +  SD+G+P   S     + +++        N+  Y
Sbjct:  717 NGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNI--------------------------SIADENDNQPTFTGPSR-FNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSG---------ILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSG----EGSDNFTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSF-----VSPAQVTSIPEDVAINTH--VVKLNATDSDGTPLT---------FDIVEGN--AGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFS----QSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFA---SNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDT------SAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSY 1417          

HSP 3 Score: 243.817 bits (621), Expect = 6.813e-65
Identity = 200/661 (30.26%), Postives = 307/661 (46.44%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSK-NFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSY-FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE--KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            NDN P FS       + E+   G ++    A D DS  N  ++   ++ ++  +FT+       D +     + + +  D EN + Y+L + A D+G P      ++ I I D ND+ P+F  S Y   + ES + G  ++ + ATD DSG  G + Y     ++  V+  F+ID+++G + +S  LD E    Y+  V ARD G+ +  S   V +++ D NDN P     YV        +   ++   +   V  +D D  + G V+  L  +     +       ST  I L   LDYE++      +   D G P  +S    ++++ D+NDN P F    Y  TV EN  AG+ V  V ATD DS  NGKI+YSI S + +  F++D  TG I +++  DRE  ASY L++ A D        +  V I+I D+NDN P F G +      F I E+ P+   +G + A D D G NG V Y  +S  +   F + P  GI+     LDRE    +   V+  D G  +Q  + S+ VSV+D NDN PRF        S +I    +  + V +++  DKDEG N  +    +SG   D       F     G +  +  L  +    Y L +   D G+P + + A   I I N
Sbjct:  370 NDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVFTI-------DGSTG--IISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL---ISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVF------RVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSI-----NTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSR-----FNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRF---EKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLS-LSGEGSDN------FTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIIN 989          

HSP 4 Score: 241.891 bits (616), Expect = 2.416e-64
Identity = 202/660 (30.61%), Postives = 311/660 (47.12%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL--ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS-YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAG--TLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            NDNSP FSQ   T+ ++E+   G+ I   LA D D+     ++Y +   NH +A           DST  +I   ++  +DRE ++ YNL + A D G P       + I + D NDN PIF ++     + E    G  + ++ ATD+D G N  V Y      TS     F I++  G L++ + ++ E V  YT  + A D G+    S   + V V D NDNPP    +    S +    +  + +      V   D D G   +++  +           N+  G    I     LD+EE++     +   D    + T+     I + ++ND +P F   +Y  +V EN+     V+KV A+DRDS   G ++YSI     S  FSID  +G I +    DRE  + Y + V   D G P  S    V I I D+NDN+P F       SY   I EN   ++    + A D DEG N ++ Y  LS  + F I    G+I   Q LDRENK+ ++ +++  D G   Q +S+++ V+VID ND+ P       +S+S++ S  +     T V RI A D D G N+ L + ++S   +      +F +D   GDI  +  L R+   VY L++ V+D+GNP   S A+ +I +
Sbjct: 1197 NDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAF--------RIDSTTGRI--TVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS----AFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLT-----VAADDSDVGANAVLRYSIISGNDEKRFKINSTSG---VIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSS----SYSSSILENSAPSSFSFKLAATDADEGTNARITYN-LSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLI-----NSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHK-----SVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDV 1814          

HSP 5 Score: 234.572 bits (597), Expect = 4.073e-62
Identity = 194/661 (29.35%), Postives = 298/661 (45.08%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSK--NFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSI-VIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP--VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            NDN P F  P +   I E + I   +    A D D     F+I+    E +  + F  I + S          + + + +DRE  + Y L + AT+ G    S      I++LD NDN P+F   +Y  ++ E+   G  +  + ATD+D GEN  V Y  S   TS    KF ++ +TG ++    LD E    Y+  V A D G  +  + A + +++ D NDN P+          K TL     T N    + V+ SDPD+G NG +    + G+           + +T +I +V  +D E        I   D G P   S+    I + D NDNSPIF        ++E    G  V  V ATDRD   N ++ YSI     S F+I+ + G +  K   +RE   +Y L++ A D G P  +    + + + D NDN P F       SYI  ++EN   +  + T+ A+D D G N  + Y+ +S    ++F I+   G+I T   LD E K+ +   V   D     + N   VT+ VI+ ND  P F   T  + +  +       T V ++ A D+D      L Y I+ G   D+     F +DQ++G I     L R+ + +Y +++ V+D GNPP  +     IKI
Sbjct:  991 NDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIV----EGNAGSSFK-IDQSSGL--------ISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTS----KFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQF------SQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAF----RIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQ----SYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAF---TQQNYTASVRENSPTSTSVVKVSASDRDSF--GSLSYSIVGGKDSDK-----FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKI 1607          

HSP 6 Score: 202.986 bits (515), Expect = 2.063e-52
Identity = 173/599 (28.88%), Postives = 281/599 (46.91%), Query Frame = 1
Query: 1090 LENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSY-FSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGT-IHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            ++ ++  +FT+       DS+   I     +  DRE+ S Y L ++A D       G+  + I + D NDN P F  ++Y+ N++E+  +   + ++ ATD+DSG N  + Y   S        KF ++S TG +     LD+E    YT  + A D G    F      ++V D NDN P   L          +  G  +I ++ + V   D D G N  L    + G   +  V       S   I    + D E +   +  +   D G P  +     EI I D+NDN P+F    Y  +V+E+   G  ++ V A+D+D+  N  + YS  S + ++ F++D VTG +    S D E+R+SY L +   D G P  + ++++LI + D NDN P F       +Y   +KEN P+    GT + A D D   NG +++  +   +   FTI    GII   +  D ENK  ++ +V+  D+G+  + ++  VT+ + D ND+ P F  P+N S  +  S +   G+ V  + A D D GP   L+Y++ISGN +       F +D  +G I +   L R+    Y L++   D
Sbjct:    4 MDGNDQGMFTI-------DSSTGSI-TTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQ-VAIVTATDRDSGTNAAITYSLFSG-----ENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFD-GKHTTFVPL---ITVDDVNDNAPFFALSVYKTGVYEDVAVG--SIVRQLTAV---DLDVGINARLSYSLVSGDTSYFTV------DSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS----PSAYQSRVKENTPA----GTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFS-PSNYSKQIPESTV--IGSTVVTVTATDLDSGPRGRLEYRLISGNVK-----GAFNIDANSGSIRVSSELDRETTPSYSLQVEARD 557          

HSP 7 Score: 179.874 bits (455), Expect = 2.767e-45
Identity = 153/507 (30.18%), Postives = 244/507 (48.13%), Query Frame = 1
Query: 1465 FHIDSSTGWLSIS-ETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYL-EYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQ 2970
            F IDSSTG ++ +    D E    Y   V+A+D+       +  V + V D NDN P+  L  YV +  + T    P     + +IV  +D DSG N  +      G  KF++   N++ G   +I  V  LD+E ++     I   D       ++    I + D+NDN+P F    Y   V E+   G +V ++ A D D  +N +++YS+ S   SYF++D   G IR+K +FDRE +ASYQ+++ A+D G P++SG A V I I D NDN P F        Y   + E+    A + T+ A D D G N  + Y+F S      FT+    G++  ++ LD E ++ +   + V D+G     ++  + ++V D NDN P F  P+   + VK +    AGT   ++ A D+D   N  L + II GN      D +F +D   G I + ++   ++   Y L +   D+G P +   A   I I++    S   +   Y++
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENT----PA---AQVAIVTATDRDSGTNAAITYSLFSGENKFMM---NSKTG---EIRTVTPLDHETKDSYTMRISAFDGKH----TTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDS-QGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFS----SAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS-PSAYQSRVKENT--PAGT---QVSATDRDSSTNGALVFGIIKGN-----DDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSK 485          

HSP 8 Score: 152.91 bits (385), Expect = 5.072e-37
Identity = 118/402 (29.35%), Postives = 194/402 (48.26%), Query Frame = 1
Query: 1183 PIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS-LSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPD 2385
            P+D E  S Y L + ATD      + K  + I++++ ND  P F    Y  +V+E+  +   ++ + A+D+DS   G + Y   S V  +   KF ID  +G +S ++ LD E V  Y   V   D+G     +   V + ++D NDN PK    + + S   +++E     +  + +   +D D G    +  +L  +  F++        S+  I L + LD E ++     I   D G P   SS    + + DIND+ P+    S   +V EN      V++++A+D D+ LN ++ +S+ S    S F++D  TG I +K+  DRE++A Y L +   D G P+ S  A+V+I + D++DN P FQ       Y   I E+ P  A I  + A D D
Sbjct: 1474 PLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSF--GSLSY---SIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPK----FDSSSYSSSILENSAPSSFSFKLA-ATDADEGTNARITYNLSRNDAFMI------GASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTE----YNVTISESLPRGASIVQVTARDID 1852          

HSP 9 Score: 122.479 bits (306), Expect = 8.707e-28
Identity = 113/374 (30.21%), Postives = 173/374 (46.26%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTIN--KEYSI--VIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRD 2061
            ND +P F+Q   T  + E+      +    A D DS  F  +SY +   + +    I + S   ST + +        DRE VS+Y + +  TD G P LS    + IKILD NDN P F++S+Y  ++ E+         L ATD D G N  + Y  S +        F I +S+G +++++ LD E    Y   + ARD GT    S  T++V+V+D ND+ P I           + + G    N  KE  +  ++ SD D+G N  L    L    K +    N    +T  I+    LD E++ V    I   D+G P L+S  +  I + D +DN P F+   Y+ T+ E+   G  +++V A D D
Sbjct: 1508 NDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSIDQRSGIISTADVL--------DRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN------DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLI---------NSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDN----TTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 258.07 bits (658), Expect = 3.576e-69
Identity = 210/647 (32.46%), Postives = 307/647 (47.45%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLE-NHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGP--TTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIV-CHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS-LSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISY-LDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            NDN P F     ++E  E+ +IG  I    A+D DS  F I  + +E  +   +F          S      + L + +DRE    Y L + A D G      K  + I +LD ND  PIF  + Y   ++E   +  +I  + A  +D G N  V+Y  S   T  +     + +STG L +   +D+EK+      V A+D GT   F  A V ++V+D NDN P+        +    L+  P  T I   +  V V D DSG  G V   L  +   +     N + +T  ++L + +DY        + V   D G P  +S+   E+ + D+ND SP+F + SY   V E       +++VVATD DS  NG+I+Y+ DS +  S F +    G I  K   DRE    Y L V A D G P +S SA+V + + D NDN P+FQ      SY F +KEN P    +G + A D DEG NG V Y F + V +F +    G I T+Q LDRE KA + FS+   D G   + +   VTV V D ND  P+F   + +  SV ++  L    +L+  I   D  +GPNS + Y I++G        K F ++Q  G + L   L R+    +IL ++ SD+G
Sbjct:  593 NDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVF----------SVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIV----LINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF-------NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLF----NLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRN-GGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQ----ASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKF---SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAG-------PKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKG 1199          

HSP 2 Score: 249.595 bits (636), Expect = 1.449e-66
Identity = 191/577 (33.10%), Postives = 295/577 (51.13%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAF-SKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKG-----SQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS-----YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA--GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            +DRE +  Y LN+ A+D G P+  G L++ I + D NDN+P F N +Y   + E+   G  IL + A+DKD G N  + Y  S +  S+ +  F I  +TG +  +  LDYE  + Y   V A D G+     S A V++ V+D NDN P I++ Y T  G   + E   TI  + + V VSD DSG  G V   L+G     S KF ++   N E     I + +SLD E  +      VC D+G+P  T+     I + D+ND +P F+  +Y   V EN     +V  V A D+D   N ++ Y+I + + S     +F+IDP +G I +    DRE+     L+V   D G P  S + +V++ +TD NDN PYF       SY   + EN PS + +  + A+DPD G N  +LY+ L+P   F + P +G++  ++ LD E ++ + F V   D G   +  + +V VS+ D NDN+P F     D +S  + Y +    G  + +++AID+D    +   + I  GN+     D++F +D  +G I L + L R+    Y+L +   D G
Sbjct:  130 VDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQY--SIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSY-TLGGSYQVTEN-ATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVL---NDES---IIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFN----QSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVF-----DPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNA-----DEVFSVD-GSGLITLAKLLDRETQDNYLLTVKAVDGG 679          

HSP 3 Score: 218.779 bits (556), Expect = 3.846e-57
Identity = 207/685 (30.22%), Postives = 317/685 (46.28%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDST--INQI--FLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLK-IEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSG---TDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGS----TWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS-LSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE--KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            NDN P F        + E + IG+ +   LAVD D  +   + Y++ N             N D T  IN+    +  L+ +D E  + Y L + ATD GK       + + I + DANDN+P F+ +  I  + E+      +  +KA D DSG N  + Y   S      R  F I+S TG +  +  +D E++  Y+  V A D      D  ++ AT+K+ + D NDN PK    +V+ +    + + P   N + + +   DPD+G GG V+        + +V P+  + S    T  + L+ SLDYE+       I   D G P LTS     +++ D+NDN P F    +  TV EN   G  V+KV A DRDS  N ++ YSI S + +  FSID  +G I +    DREK+ +Y L+V A  +  P +  S +V I + D+NDN P F           ++ EN P+  +I T+  +D D G N +VLY+ +S      FTI    G + T  +LDRE KA ++ SV+  D          ++T+ + D+NDN P F      ST   IS L   GT +  + A DKD G N ++ Y +    S D     ++ +D + G ++            Y    +  DQG  P+ +     IKI++    +       Y
Sbjct: 1218 NDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVN------------GNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDS---QSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPK----FVSRNLTYVMEDEP--FNFQVTSITALDPDTGQGGNVE--------YRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFIS----PVVTLKVPENSPAR-LIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSST---ISELTPPGTSILNLTASDKDSGSNGNIVYTL----SNDTY--GVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPY 1859          

HSP 4 Score: 206.453 bits (524), Expect = 2.203e-53
Identity = 183/631 (29.00%), Postives = 279/631 (44.22%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKE--SEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPP------KIYLEYVTDSGKRTLIEGPTTINKEYSI----------------VIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVE-----RFI---IVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLN-GKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIP-TNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGV--YILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            +D E+   + L+L+AT +G  SL+G + ++I ++D NDN P F  S  +  + E         ++ + ATD DSG NG V Y   S  T      F IDS+TG ++ ++ LD E    +   +   DSG     +   VKV V D NDNPP      ++ +   T +G        T  +KE  +                V  +D DSG+   ++            P  N +   +KI+    +    R ++      FI   +   D+G P         + +R I    P FE PSY   V EN   G  VL V  TD  + L  G+I+Y+I++   +YF I   +G I      D E +  + L V A D   P++     V I ++D ND  P F    G   Y+ +  E  P   I+  + A D D G NG+V +   S  +K  F I    G+IRT + LD E    H  SVR  D+G       VSVT+ V+D NDN P F +P  ND   ++   L++    +  I A D+D G N+ L + +I G     T   +F +D+ +G +        ++  V  Y L +  +D GNPP  S    ++ + +  +   + N M Y
Sbjct: 2025 LDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTY---SIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSF---------PITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPP----QRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIEN--SNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVF----GQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSR---LYEINATDRDSGANARLSFTVIGG-----TGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDY 2625          

HSP 5 Score: 203.756 bits (517), Expect = 1.574e-52
Identity = 190/693 (27.42%), Postives = 301/693 (43.43%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQK---------FILVPPNNRE----GSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-PVEKFTIHPDQGIIRTNQQLDRENKA-VHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQHATY 2988
            ND +P F +      + E+  +   + +  AVD+D  + + + Y + N   +   L   W   D +   I       +DRE +    L ++  D+G P LS    + + + D+NDN P F  S+Y  ++ E+  SG  ++ L A D D GEN L++Y   +  T      F +D   G ++ S TLD+E    YTF V A D G  +    ATV VS+ D NDN P               +  P++ + EY        ++   G   C LK   +         FI+   N  E      +  I L + LD E ++     +   D G     +     I + D+ND  PIF    Y+ T++E++QA  V+  V A  RD   N ++ YSI   +     +   TGT+  +   D EK  S  L+V A+D G P   G ANV I + D NDN+P F       S +  + E+ P      T+   D D G+ G+V ++ LS P   F +  + G +   + +D  N A  +   V+  D G   + ++  + + V+D ND  P F    N S +  +       + +  + A D D G N  + Y        D   D   F  +  G IF++  L R+D+  Y LK++  D G P R S A+  + +D+        NN  + Q  +A +
Sbjct:  383 NDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYL--HWFAIDPSSGMI--TTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNT-----PFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSC--NATVHVSLTDLNDNQP---------------VFDPSSYSVEYF-------ENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFN----SSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVF---GNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAF------DSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVND-----NNPHFQQASYAFF 1024          

HSP 6 Score: 191.815 bits (486), Expect = 8.170e-49
Identity = 193/669 (28.85%), Postives = 299/669 (44.69%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNI-ISYRLENHEHALFTLIPEWSNFDSTINQI--FLKLLQPIDRENVSMYNLNLIATDKG-KPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSG-TDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRG---EPQLTSSHXXXXXXRDINDNSPIF--EHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE--KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            ND SP FS+   ++ ++E + +G+ +   +A D+D +  N  I+Y +     A             ++NQ+   L L+ P+DRE    + L+++A+DKG   SL     IEI +LD NDN P+F N T    V E    G ++  + A D D G+NG V Y     V       F I+ +TG +S    LD+E    Y   V A D G      S   V + V D NDN P      +      T I     IN   + +   D DSG    +   +           N+  G    I     +D EE +     +   D+    + +L ++   +III+D+NDN+P F   + +Y   V E+      V  + A D D+   G + Y I S     FS+D  TG ++   S D E    Y L + A DLG P  +      + + D NDN P F        +I  + EN P+   +  + A D D G N ++ Y+  S VE  KF+I    G+I TN  LDRE K  +  +V         + +S SV ++V+D NDN P+F+ P     ++K+   ++   L+  +   D D G N+ + Y I+SGN+     D  F + +  G++     L R+    Y L +   D   P   ++AN  I I++
Sbjct: 1113 NDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAF------------SLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKI---VNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPII-----TWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETG---LIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY---VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFT----RDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPV---VTLKVPE-NSPARLIYTLTVQDLDYGNNTKVLYSIMSGNT-----DGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIED 1742          

HSP 7 Score: 159.458 bits (402), Expect = 5.808e-39
Identity = 175/661 (26.48%), Postives = 281/661 (42.51%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVT-----DSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREG------STWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDP--DEGINGQVLYTF---LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGI--LRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQR--ALTRQDMGVYILKMMVSDQG 2877
            NDN+P F     T  + E      ++    A+D D+     + YR+         + P+   F   +    LKL+  +D E+V  Y L++ ATD G P L+      + ++D NDN P F    +I  V E++ +G  ++ + A D+DSG N  + Y   S V  +   KF ID  +G +  +  LD EK   Y   V A         S  +V+++V+D NDNPPK     VT     +S  R +          Y++  V D D GN   V   +            N +G      ST +++    LD E +   +  +   D   P  T+     I I D NDN P+F+   Y  T+ E    G  +L + A+D+DS  NG I Y++ + +   +SID  TG + S   F+   +  Y     A+D G+  +     V I I D+N++ P F        Y   I  N  ++A++  + A D   D+  NG+V Y      +    F +  + G +RT+       +  H   +   D G   LR    V + +  I   D+ PRF+  T     V I      G+ +  + A       ++ + Y IISGN     + + F++D   G I +    AL  +    + L ++ + QG
Sbjct: 1432 NDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGGNVEYRI---------VSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMD---KFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLI----------YTLT-VQDLDYGNNTKVLYSIMSG---------NTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKT----PYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNI--QDDPPRFLNQT--PARVSIPENSKVGSYITTVRA---RASSDAQVTYSIISGN-----KGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQG 2043          

HSP 8 Score: 147.902 bits (372), Expect = 1.798e-35
Identity = 169/596 (28.36%), Postives = 257/596 (43.12%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENST---YIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWL-------SISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIV--SDPDSGNGGLVQCDLKG---SQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEP-QLTSSHXXXXXXRDINDNSPIFEHPSY----HQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSI--DPVT--GTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK------FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDT--AGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            +DRE VS YNL ++       S +    + + + D NDN P F   T    +V   + +    LI    A D D G N    Y   S     V K      + G L       + S  +D E++  Y  N+ A D G  A      + ++V D NDN P+     V+ SG       P  I+   SI+ V  SD D G    +Q  ++     Q    + P     +T  I     LDYE +     ++   D+G   QL+SS    I + D+NDN+P+  H SY       V EN   G  V +V  +D DS  NG++N +++     YFS+  D +     I    S DRE    + L     D G+P ++   +  I + D ND  P F       +Y   + EN   N ++  ++A D D G N +++YT  +  E       F I P  G+I T   LDRE       +V V D+G     ++ SV V++ D NDN+P F     + +S   S  +   +G+ V ++ A D D G NS + Y I++ N+        FF+D + G +   R L  +    Y  ++  +D G
Sbjct:   20 LDREKVSAYNLTIVEFSTPPKSYT----VLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLI----AVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPE--FSNVSYSGTI-----PENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHP-----TTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVI-HVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGD-GYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFD----RHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYF-----NQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP-------FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG 577          

HSP 9 Score: 109.383 bits (272), Expect = 1.061e-23
Identity = 104/399 (26.07%), Postives = 175/399 (43.86%), Query Frame = 1
Query:  967 PHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNI--ISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGS--QKFILVPPNNREGSTWKINLVESLDYEERNVERF--IIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTI 2145
            P F  P    ++ E+  +G  + L + V +++    +  ISY +EN  +           F        + + +P+D E    + L + A D   PS   ++ + I + D ND +P+F  S Y+    E    G +++ + A DKDSG NG V +   S    + +  F ID  TG +     LD+E +K +  +V A D G+    +  +V + V+D NDNPP   +    D   + L   P  +N     +  +D DSG    +   + G   Q   L+     + S W    + + DYE   V ++   I   D G P L+S+    + + D ++  P F    Y   V  N + G  V +V ATDRDS   G++ +   + + +   ++  TG I
Sbjct: 2302 PKFELPSYFGKVPENAMMGTSV-LTVRVTDNAAGLPLGRISYNIENSNY-----------FRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQS---GDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDV--QVLENLP--LNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLI----DKFSGWLTTNI-TFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTGII 2676          

HSP 10 Score: 79.7221 bits (195), Expect = 1.055e-14
Identity = 71/272 (26.10%), Postives = 123/272 (45.22%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFE-NSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYE--KVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLV 1758
            ND  P F Q     + SE I +G  +    A D+DS     + + +++ +        +  +F        ++  + +D E +  +++++ ATD+G P +   + + I++LD NDN P+F       V V E+      +  + ATD+DSG N  + +     +    +  F ID  +GWL+ + T DYE   V  Y+  + A D+G     S  T+ V+V D ++  P    ++Y  D      + G   I      V  +D DSG+ G V
Sbjct: 2401 NDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGD--------DKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTV---IGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFD------VPGNAKIGDFVGQVTATDRDSGDQGRV 2655          

HSP 11 Score: 56.6102 bits (135), Expect = 1.154e-7
Identity = 46/162 (28.40%), Postives = 78/162 (48.15%), Query Frame = 1
Query:  955 NDNSPHFSQPVKT-IEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMY--NLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYF 1431
            NDN P F  P    +++ E++ + +++    A D DS     +S+ +         LI ++S + +T N  F       D EN ++Y  +L + ATD G P LS  + I + + D ++  P F    Y  +V  +   G  +  + ATD+DSG+ G V + F
Sbjct: 2506 NDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTT-NITF-------DYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVF 2659          

HSP 12 Score: 55.4546 bits (132), Expect = 2.062e-7
Identity = 59/212 (27.83%), Postives = 95/212 (44.81%), Query Frame = 1
Query: 2137 GTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP----VEKFT--------IHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQI 2736
            G I +K   DREK ++Y L++   +   P +S +  VL+ + D NDN+P F         +FE  ++     I     A D D G N    YT +S     V K          ++ D  +  ++  +DRE    +  ++   D G       + ++++V D NDN+P F   +N S S  I      GT + ++ A DKD G N+ + Y I
Sbjct:   12 GVITTKTVLDREKVSAYNLTIV--EFSTPPKSYT--VLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLI-----AVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEF---SNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI 211          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 241.121 bits (614), Expect = 4.480e-64
Identity = 206/661 (31.16%), Postives = 304/661 (45.99%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDED-SKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS-YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPD-EGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQ----LDRENKAVHEFSVRVIDK-GILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL----VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKS 2895
            NDN P FS P  TIE  E    G  I    A+D D   N  ++   +EN        + ++   ++    I L   Q +DRE    +N  + ATD G PS S    + IK++D NDN P+F N+ Y   V+E++ +G  +L++ A+DKD G N  + Y  S      +  +F ID  TG ++  E L+ E+   YT  + A DS   A      V ++V D ND+ P+      T SG    +     +      V  +D D  +   V+  +      ++   N   G         +LD E+      II   D G P L S+    I I D+NDN P+F    Y+ T+ E+      V++V+ATD D   NG+  Y I +      F ID  TG I  K   D EK + Y L+V A+DLG P  +G+  V I ++D +DN P F        Y  E+ EN      + T++A D D E  + +V Y   S      F I    G+I  N      L+RE  A +E  V  I +  +  Q++ V   ++V+D NDN PRF     DS S   S L+  G +    +  ++A D DEG +  + + I+SGN     ++ +F MD K G +   R L R+D   Y L +M  D+G P   S
Sbjct: 1288 NDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVEN--------VTDYVTVNAITGVISLGSSQ-LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSG----VLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQF-----TQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIIST---TSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHK----PRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRF-----DSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGN-----ENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSS 1913          

HSP 2 Score: 214.157 bits (544), Expect = 9.285e-56
Identity = 194/648 (29.94%), Postives = 298/648 (45.99%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES-LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPP 2886
            ND SP F + +  + +SES   G  I    A D D +  N I +   N   A F +    S  D  ++        P+DRE  ++Y LN+ A +    +     ++ I + D  D++P F +S+  V + E+   G  +  + A DKD G+   + Y  ++    +    F ID+ TG +     LD E V  Y   V A+DS  +       V V V D NDNPP   +   T        EG + +      V   D D G N  ++   ++    ++ V        T  I+L  S LD E      F I   D G P  +S+    I + DINDNSP+F +  Y+  V EN  AG  VL V A+D+D   N K++Y +  +  + F+IDP TG I ++   +RE+  SY L++ A D    A+ G+  V+IT+TD ND+ P F        Y F ++E+      +G +   D D   N +V Y   S      F+++   GII T   LDRE  A +   +   D GI   E++ SV +++ D NDN+P F     + T  +  +L T    V ++ A D DEG N    Y+I +G++     D +F++D   G I ++  L  +   +Y L +   D G PP
Sbjct: 1083 NDESPLFEKSMYYVNVSESASRGIVIGRVTATDRD-EGINAIIFYSSNGAEAKFYV--SRSTGDIIVDS-------PLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDT--ISYSIAN---GDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDS-VNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQ-----VKAIDADIGDNAAVLYSIVENVTDYVTV-----NAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFT----QSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQ---VVQVIATDPDEGANGQFTYKITAGDT-----DDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPP 1692          

HSP 3 Score: 206.068 bits (523), Expect = 2.780e-53
Identity = 197/659 (29.89%), Postives = 316/659 (47.95%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQK---FILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGK-INYSIDSLSV-SYFSIDPVTGTIRSKIS----FDREKRASYQLSVFA-RDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKEN-GP-SNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF------VIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            NDNSP F+       + E+   G  + +  A D+D      +SY L    +  F + P+  N         +   +P++RE    Y L L A D    +  G  ++ I + DAND+ P F  S Y  +V+E    GH +  +  TD+D  +N  V YY SS  TS +   F ++ +TG +S + TLD E+   YT  + A+D G  A  S  +V +++ D NDN P ++ + V +   R  +   T + +    VI +DPD G  G     +        F +      + +T  I +   LDYE+ ++    +   D G P LT +   EI + D++DN+P+F  P Y   + EN   G  V+ V ATD D++ + K + Y I+S +  S F I   +G I    +     +RE  A Y+L V A   +    Q      +IT+ D NDN P F       SY+  + E+ GP ++A I T+ A+D DEG +G++++T +S  E   F +    G++   + LDRE+ + +   V   DKG     +SV+V ++V+D NDN P        +IP   +T      LD AG  V  + A D D     +L Y  I+ N+ +Q   K F +++ +G++  +  L R+D  V+ L +  S+
Sbjct: 1393 NDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGN---------ITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLM---FSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKP-LFSKSVYNVTLRESVFLKTQVVQ----VIATDPDEGANGQFTYKITAGDTDDVFYI------DANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDS----ESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLD-AGVPVGVVAAQDLD---TKNLIYYYIT-NTEEQ---KYFILNETSGELRTRITLDREDSSVHYLYVKASN 2016          

HSP 4 Score: 200.29 bits (508), Expect = 1.723e-51
Identity = 193/687 (28.09%), Postives = 303/687 (44.10%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLK-IEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRT--LIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES-LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE-HPS-----YHQTVEEN-NQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREK---------RASYQLSVFARDLGEPA---QSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL-------SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP-PRKSYANYVIKI 2919
            NDN P F++      + E I  G  I    A D D   F  ++Y L   + A F++     N D+      +   Q +D + +  Y  +L+  D G       +  + + + D NDN P F    Y  ++ E+  +G ++  + ATDKDSGENG + +  S+    +    F I+ S G ++ +  LD E +  YT  V A D G  +      + V+V+D NDN P+I     TD    T  + EG        S +   DPD+G NG L      G  +F L        +T ++ +  + LD E ++    II   D G P  T+S    + I D+NDN+P F+ +P+     Y  TV+E        ++ + ATD D+D NGK+ YS+      +F +DPVTG +  +   DRE             + L + A D   P    +S +  V IT+ D NDN+P FQ  N    Y   + E     + +  + A D D    G+V+Y            VEK   H +    + N  L +E+K   E +  VI                V D NDN+P F        +  +      GT V R+ A D+D+G N  + Y++ +GN     +D  F ++   G+I +   + R+ +  ++L +   DQG P  RK++A  VI +
Sbjct:  383 NDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSV-----NADNGT----ISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISA---GDDGGHFSINGS-GLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQI-----TDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTL------NSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQN----YETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYNWH--KKNCVLCKESKCSVERTYVVI---------------YVDDVNDNDPVF---NQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGN-----KDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITV 1016          

HSP 5 Score: 194.897 bits (494), Expect = 7.456e-50
Identity = 185/684 (27.05%), Postives = 314/684 (45.91%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQI--FLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARD-SGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNG------GLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEE------------------------RNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQS-GSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE--KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAG---TLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQ-RALTRQDMGVYILKMMVSDQGNPP 2886
            NDN+P F++     +I+E+ ++G  I    A+D DS   + + Y+  N   A  T  P +S     +N +   L L  P+D E    Y L +IA D G P L  +  + I++ D +D  P F  S Y+  ++E+   G  ++ ++A D D G N  ++Y   S  +  V   F IDS+TG ++++ ++D EK   +   V A +    ++  +   V   V   ++ P  +   Y+ D  +   + G    ++    + V+D D           LV  D   S KF + P +     T  IN  ++LDYE+                        R  E+ ++        + +++    + + ++NDN P+F   SY+ T++E    G  +  + ATD D    G + Y +     +YFS++   GTI +    D +    YQ S+  +D G   Q    A V +T+ D NDN P F G+     Y  +I EN P+  I+  + A D D G NG++ +   +  +   F+I+   G++ T ++LDRE  A +  +V   D G+  +   V +TV+V+DENDN P+      D  ++  +  + AG    L++ I A+D D G N  L Y +  G+SR       F ++   G + +    L R+    Y L + V+D G+PP
Sbjct:   40 NDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSN---ATATQTPFFS-----LNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGV---FTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQ----LQVTDGDKNPVFRRVLYHLVGAD---SDKFAIDPTS----GTLYIN--KTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGM----PYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSIN-GSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQIT----DGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSR-------FTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPP 683          

HSP 6 Score: 174.481 bits (441), Expect = 1.338e-43
Identity = 191/688 (27.76%), Postives = 319/688 (46.37%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL-ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKES-EISGHLIL-LLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFN-----------------------VIARDSGTDAAFSK-ATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQ-KFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGE-PQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSL-SVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKEN-GPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQ-LDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF-VIPTNDSTSVKISYLDTAGTL---VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTR---------QDMGVYILKMMVSDQGNP 2883
            +D  P F Q     EI E+  IG+ +    A D D    N I Y +   +   +FT+       DS  N   + +   ID E   ++ + + A++   P+ +  + + + ++D NDN+P F  S YI +V+E   + G ++   L+ TD D       + Y      S+   KF ID ++G L I++TLDYEK   +TF+                       V+A ++ T   FS  A+V +++++ NDN P     +   S   T+ E   T     + +  +D D G  G +  +L+G Q  +  V  +N   S  +I     LDY+     +F +V  D G   Q  +     + ++D+NDN P F    Y   + EN  AG +V +V ATD+DS  NG+++++I +     +FSI+  +G + +    DRE  A+Y L+V A D G  ++     + + + D+NDNTP    +  G +    I E  G    ++ +I A DPD G NGQ+ Y+      +FT++   G ++ +   LDRE K  ++  + V D G     NS +V V+++D NDN P F   P     +  I+  +  GT+   +  I A D D   N  + Y  +SG+     +   F +D   G++ +++ L R         Q  G ++L +  +DQ  P
Sbjct:  147 SDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTI-------DS--NTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSD---KFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPM----FAKSSYNYTMDE-EITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQI-----LDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSING-SGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQ---ITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYS-LSGD-----EHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATP 802          

HSP 7 Score: 148.288 bits (373), Expect = 1.323e-35
Identity = 159/589 (26.99%), Postives = 253/589 (42.95%), Query Frame = 1
Query: 1288 DANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQ--AGIVVLKVVATDRDSD-LNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQL-----------------------SVFARDLGEPAQ-SGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL-SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVS-VTVSVIDENDNEPRFV-IPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTL 2949
            D NDN P+F    Y+  + E+   G  IL + A D DSG N  V Y FS + T+     F ++S  G L++   LD+E  + Y   VIA D G     S+ TV + V D +D PP+    +         IE  T I      V   D D G N  ++   + G+   +    +N    T  I +  S+D E+ +V R  +   +  +P   ++    + + D+NDN P F    Y   V E+      +V  ++  TD D + +  ++ Y +       F+IDP +GT+    + D EK+ ++                          V A +     + S +A+V +T+ + NDN P F       SY + + E       I  I A D D G  G + Y         F+++ D G I   Q LD +    ++FS+ V D G   QE +++ VTV++ D NDN+P F  +P     +  +     AGT+V ++ A DKD G N  L + I +G+      D   F    +G +   R L R+ +  Y L +   D G   R  +    + +    DN+ Q +  L
Sbjct:   38 DYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFS-NATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKE-----IEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSN----TGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMF----AKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLP----AGTIVFQVTATDKDSGENGRLSFNISAGD------DGGHFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGL 602          

HSP 8 Score: 146.747 bits (369), Expect = 3.527e-35
Identity = 185/673 (27.49%), Postives = 287/673 (42.64%), Query Frame = 1
Query:  955 NDNSPHFSQPVK-TIEISESIQIGAKIPLPLA-VDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKL-LQP--IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFEN------STYIVNVKESEISGHLILL-LKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKY---------YTFNVIARDSGTDAAFSK-ATVKVSVV--DCNDNPPKIY-------LEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEER-NVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGS-ANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSD 2871
            NDN+P  +  +  T  ISE    G  +   +A VD D+ +   ++Y +   +          S F  T+N    +L + P  +DRE    Y+L +  TD G P  +    + + ILD NDN P F+       +TY++ V E   + +  L+ + ATD D+  NG V Y  S D        F +D  TG LS+ + LD E  +          +  ++ A D  T  +  K ATV+VS+   D NDN P+         L      G   +    T  + EY   ++ +   G+    +C++   +K +      R  +  K N V  L  E + +VER  +V +                + D+NDN P+F    Y   V EN+  G  VL+V A+DRD   NGKI Y + + +    FSI+ VTG I      DRE   ++ L+V A D GEP+   + A V+IT+ D+NDN P F    G   Y  EI EN P  + I  +    PD+ I+   L    SP                    R   A+             R++  +++       ND  P F         V +S   + G ++ R+ A D+DEG N+ + Y      ++       F++ +  GDI +   L R+   VYIL +  ++
Sbjct:  592 NDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGD----------SRF--TLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDE----HGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENR-KCEV---EKLV------RHYNWHKKNCV--LCKESKCSVERTYVVIY----------------VDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFS-FTG---YEGEIAENSPVGSTITMV----PDQKISSSTLRPRSSP--------------------RAPAALL----------TAREKRPITLI------NDESPLF---EKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAK-------FYVSRSTGDIIVDSPLDREFKNVYILNVTAAN 1166          

HSP 9 Score: 119.398 bits (298), Expect = 8.856e-27
Identity = 110/342 (32.16%), Postives = 159/342 (46.49%), Query Frame = 1
Query: 1954 INDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA--GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRA-LTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKY 2964
            IND SP+FE   Y+  V E+   GIV+ +V ATDRD  +N  I YS +     ++ +   TG I      DRE +  Y L+V A ++   AQ  +  V IT+TD  D+ PYF       S   ++ EN      +  I A D D  I   + Y+  +  P   FTI    G IRT  +LDREN   +E  V+  D   L  +  + V V V D NDN P F +P        I Y + +  GT + +++AID D G N+ + Y I+   +   T + I       G I L  + L R+    +   +  +D G P + S A+  IK+ +    S   NN  Y
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFY-VSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFN----SSSLTVKLSENASIGTNVTKITALDKD--IGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSD-LLKVVVQVEDVNDNPPVFSMP-----GYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAI------TGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDY 1404          

HSP 10 Score: 95.1301 bits (235), Expect = 1.788e-19
Identity = 131/485 (27.01%), Postives = 209/485 (43.09%), Query Frame = 1
Query: 1534 YTFNVIARDSGTDAAFSKATVK---VSVVDCNDNPP----KIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSL-SVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYF-QGLNGGGSYIFEIKENG--PSNAIIGTIHAEDPDEG-INGQVLYTFL-SPVEKFTIHPDQGIIRTNQQLDRENK----------------AVHEFSVRVIDKGILRQEN--------SVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            Y F V   D       ++   K   + V D NDN P    + Y+  + ++ +       TTI K  +I    D DSG    VQ     +      P  +      ++ L   LD+E       +++  D G P+L S     I + DI+D  P F    Y + +EEN   G  V+ V A D D  +N  I Y I S  S   F+ID  TG I    S D EK   ++++V A ++ +P  + +  V++T+ D NDN P F Q +     YIF+++E+   P   +   +   D D+  +  +VLY  + +  +KF I P  G +  N+ LD E +                +  +++ R  +K ++  E         + SVT+++I+ NDN+P F      S +  +    T GT +A I A D D G    L Y++  G      Q   F ++  NG I   + L    +  Y   ++V D G
Sbjct:    9 YEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVG-----TTILKISAI----DADSGTNSQVQYKFSNATA-TQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSV-----YIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFA---KSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGG------QAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGG 469          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 239.195 bits (609), Expect = 2.698e-63
Identity = 211/673 (31.35%), Postives = 327/673 (48.59%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTIN-QIF---LKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKAT-VKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL-KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNS--PIFEHPSYHQT-VEENNQAGIVVLKVVATDRDSDLNGKINYS-IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVL-YTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF-----VIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            N + P F    + I ISES  I   +   +A DED K +N +          L++++    + DS  N  +F   L +  P+DRE +S Y LN+ A D GK   S    + +KI D ND  P+F+ + Y V + E+   G  +  + A+DKD G NG + Y   +D       KF ++  +G +S+ + LDYE+ + Y   + A DS  D     +T V V+++D NDN P +  +    + +  L+     +N   + +  SDPDSG GG ++  L + ++KF      N +  +  I L + LD+E+++     +   D+G P L +  E  + + D+N+NS  P+F      +T + EN+  G VV+   ATD+DS     + Y+ ID   V  F IDP TG IR+    D E    Y L+V A+D        +  VLI I D ND  PYF       +Y   + EN PS + +  + A+DPD G  G +L YT     E+  F I P  G+I T + LDRE K+ ++ +V   D G       V+ TV + DENDN+P F     V+      +   S+       + ++ A D+D G N+ L Y I  GN     +D  F +D ++G+IF   +L   D   Y L ++  D G P   +  N +I +
Sbjct:  680 NRHHPVFRSHDQNIHISESTPIATVVSQFMATDED-KGYNGL---------VLYSIVE--GDVDSVFNINMFTGELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGG----KFRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKPKKFNVTVQEDLL-----VNAVVTSIHASDPDSGPGGEIEFSLPESTRKF------NIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQDS---WYLKYAIIDGTGVDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYF----APSTYYPVLAENLPSGSSVVQVTAKDPDSG--GSLLRYTITKGNEQNNFVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSF------GLYQVVATDEDIGSNADLRYSITKGN-----RDNKFIIDSRSGEIFTNVSLV--DGESYDLTIVAEDNGLPKLSTSTNVLIDV 1303          

HSP 2 Score: 208.379 bits (529), Expect = 8.523e-54
Identity = 199/685 (29.05%), Postives = 305/685 (44.53%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSK-ATVKVSVVDCNDNPP----KIYLEYV---TDSGKRTLIEGPT----TINKEYSIVIVSDPDSGNG-GLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEK--FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI------DNSAQRSQT 2946
            ND +P F        I E+I IG+K+    A D DS +  +++Y L + +     L+ E  + D     I  +    +DRE    +   + ATD G   L+    +   +LD ND  P F  S ++ +VKE  + G  +  + ATD+D       +YYF   ++ + + +F I+  TG + +  +LD E V  Y  N+    S +D  F+  A +K+ + D NDNPP     IY+E++   T  G   L  G T     +N E +  +      G G G    D  G                   NLVE LD E R    F++   D G     S+    I + D+NDN P+F   SY   V E+     V+L+V A D D  +N K+ YS+ + +   F+I+  TG I  +   +RE + +Y L+V   D G P  S  A V I + + ND  P F        Y   + E+ P    +  + A    E  N  + Y  L   +   F+I    G I  N++LD E   ++  +V   D G     ++  V +SV D NDN P F   +    S K+      GT V ++ A D+D G N+ + Y I  GN       K F + ++ G I +   + R+++  Y LK+   DQG PP+   A+ V+ I      DNS + S T
Sbjct: 2750 NDVTPKFVSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSKDK----LVKEKFDIDQHTGWITTR--GALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDEDLNTE---LYYFI--LSGDPQARFGIERKTGVIFVHGSLDRESVGSYDLNI----SASDGLFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVF-----GQGFGTFAVDKNGKMT----------------NLVE-LDRETRPFYNFMVSAADIGGQACYSN--ISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFS----HSIYHGNVSEDAPIGNEVVRVRAVS-RESSNDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEF---SEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDA-----KKFKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQ--VADTVVDIEVTDVNDNSPEFSST 3380          

HSP 3 Score: 198.364 bits (503), Expect = 9.160e-51
Identity = 175/579 (30.22%), Postives = 264/579 (45.60%), Query Frame = 1
Query: 1270 IEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLV---ESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV-EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF---VIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQN 2973
            + +++LD ND  P F +  Y+ ++ E+   G  +L + A D DSG NG+V Y   S     V++KF ID  TGW++    LD EK   + F V A D+GT    S  TV+  V+D ND PPK        S K   +     I +  + +  +D D  N  L    L G        P  R G   K  ++    SLD E        I   D      TS  + +I I D NDN PI     Y + ++EN   G  VL V ATD D  +N ++ YS+       F++D   G + + +  DRE R  Y   V A D+G   Q+  +N+ I + D NDN P F       SY   + E+ P   ++  + A+D D G+N ++ Y+ ++     FTI    GII   + L+RE K  +  +V V+D G     +  +V + V++ ND  P F   +   N S    I      G  V R+ A+ + E  N  + Y I+ G         +F +D+KNG I + R L  +   +Y L +  SD G P  +S +   I +    DN  + S+   + K ++N
Sbjct: 2742 VVVQVLDINDVTPKFVSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSK-DKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDAL-----IGQSVTTITATDEDL-NTELYYFILSGD-------PQARFGIERKTGVIFVHGSLDRESVGSYDLNISASDG---LFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAVDK-NGKMTNLVELDRETRPFYNFMVSAADIG--GQACYSNISIHLDDVNDNRPLFS----QSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPI------GNEVVRVRAVSR-ESSNDVITYAILRG-----ADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDEN 3284          

HSP 4 Score: 197.593 bits (501), Expect = 1.496e-50
Identity = 205/673 (30.46%), Postives = 301/673 (44.73%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI----YLEYVTDSG--KRTLIE-----GPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL--SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDE-GPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNS 2928
            ND  P FSQ      + E   IG  +    A DED  N  +  + L     A F +       +     IF+     +DRE+V  Y+LN+ A+D    S + ++KI+I+  DANDN PI   S Y+ ++KE+   G  +L + ATD D G N  + Y     V  +    F +D +    ++ E LD E   +Y F V A D G  A +S  ++ +   D NDN P      Y   V +    K+ L++         +N++ +  +V+D     GG    +  G+    L  P NRE       L E+      NVE       D G P L+S    +I + +IND  P F H  YH  V E+   G  V++V A  R+S  N  I Y+I        FSID   GTI      D E    Y L+V A D G P    ++ V I++TD NDN P F        Y  ++ EN      +  + A D D G N Q+ Y+    +  +KF I  + G+I+ +  +DRE  A +   VR  D+G+  Q     V + V D NDN P F   TN +T +  S L  A   V  +   D+D  G  +   + +ISG       D   F    NG I     ++  D G Y L+++V+D G+PP+ +  +  +KI  S
Sbjct: 2857 NDTPPKFSQSEFMASVKEDALIGQSVTTITATDED-LNTELYYFILSGDPQARFGI-------ERKTGVIFVH--GSLDRESVGSYDLNISASDGLFTSFA-QMKIDIE--DANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTY----SVFGQGFGTFAVDKNGKMTNLVE-LDRETRPFYNFMVSAADIGGQACYSNISIHLD--DVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDA----GGTFTIE-TGTGIISLEKPLNRE-------LKENYTL---NVE-----VMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRESS-NDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKR----YSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFS-STNLTTVLSESSLPNAA--VIHLRPHDRDALGNGAPYQFTLISG-------DASRFKLHSNGLITKIGDVSHSD-GQYRLRVLVADNGHPPQSTEVSITVKIAES 3473          

HSP 5 Score: 185.652 bits (470), Expect = 6.383e-47
Identity = 188/647 (29.06%), Postives = 280/647 (43.28%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPK----IYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVL-YTFLSP-VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQ 2874
            NDN P  +Q +    I E+  +G+ +    A D D      ++Y +       F +           N     L++ +DRE    YN  + A D G  +    + I +   D NDN+P+F  S+Y   V E      ++L +KA D D G N  + Y   +D        F I++ TG +S+ + L+ E  + YT NV   D GT    S ATV++ V++ ND PP+    IY   V++            I  E   V     +S N  +    L+G+   +     +R+  T  +N    LDYE   +    +   D G P L S+    I + D NDN P F    Y   V+EN+  G  VL+V ATDRDS  N +I YSI +      F I   TG I+     DRE+ ASY+L V A+D G P Q     V I +TD NDN+P F   N        + E+   NA +  +   D D   NG    +T +S    +F +H +  I +       + +  +   V V D G   Q   VS+TV  I E+   P  V P     ++  S L+  G ++ R++A DKD      L Y ++S      ++     M    G +   RA      G Y L + V+D+
Sbjct: 2957 NDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAV---------DKNGKMTNLVE-LDRETRPFYNFMVSAADIGGQACYSNISIHLD--DVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGG----TFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAP---------IGNEVVRVRAVSRESSNDVITYAILRGADSGLF--SIDRKNGTIHVN--RKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFSSTN----LTTVLSESSLPNAAVIHLRPHDRDALGNGAPYQFTLISGDASRFKLHSNGLITKIGDVSHSDGQ--YRLRVLVADNGHPPQSTEVSITVK-IAESKTHPPNVHPLTVYVNLYGSNLN--GGVIGRVKATDKD---GDLLHYSLVS------SEQSSLLMISDEGTV---RARANISPGTYNLNVSVTDK 3553          

HSP 6 Score: 174.481 bits (441), Expect = 1.562e-43
Identity = 190/637 (29.83%), Postives = 297/637 (46.62%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKN---FNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHL-ILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKAT----VKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGG------LVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERF----IIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQS---GSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF--LSPVEKFTIHPDQGIIRTNQQLDRENKAVHEF---SVRVIDKGI-LRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKD-EGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRAL 2823
            I E   IG  +   L +   SKN   F IIS     +E  +F++    S   S  N + +K  + ++RE+V+ Y LN++  DK       + K+ I + D+NDN+PIF    Y+  + E +I  H  I  ++A D D G NGL+ Y F    TS     F I+  +G +S+++ L     + +   V+ARD     +  K++    + V+V   N   P    E+   +  + + EG + I   Y+ + + D D G+ G      +   +L G+   I   PN+     + + +++ LD   R +  F     +  +D+G P    S+   + + D NDN+P F    Y   + E       VL+V+ATD+D+  NG I Y I   + +  F I+  TG I +K   D E R  + L+V A D G P QS    +  V++ I D ND+ P F+       Y  ++ E+      + T+ AED D G NG+V Y+   L PV  F I PD GIIRT   LDR+   + EF    VR  D G  LR+E    V + V + NDN P   +      ++ +      G L+  + AID D    +  L Y+   GN+      K F +D K G++   R+L
Sbjct:    5 IPEITPIGTPVKCDLKMGVYSKNHVDFIIIS----GNEQGMFSV---DSRQVSDFNFMDIKTSKRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPE-DIPMHTSIARIEAVDADVGPNGLIYYSFKEKTTS-----FAINPISGVVSVAQKLS-NSARIHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSP----EFSVKTQLQNVSEGTSGI--VYATLGIIDKDKGSNGDIDRVEITSGNLDGAFS-IKSSPND-----YAVQVIKPLD---RELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIYTKGDLDYESRQRFDLTVAALD-GVPLQSRKISTVPVVVNILDANDHDPEFK----APEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPV-PFEIEPDTGIIRTTTNLDRDT-GLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAP---VLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNT-----GKAFSLDPKTGELRTARSL 597          

HSP 7 Score: 161.77 bits (408), Expect = 1.091e-39
Identity = 160/572 (27.97%), Postives = 256/572 (44.76%), Query Frame = 1
Query: 1186 IDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKV-KYYTFNVIARDSGTDAAF-SKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR---EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHX---XXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV--SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV--EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMV 2865
            +DRE++  Y + + A D   P    +  + ++++D NDNQP+F NS Y + ++     G +I   +ATD D G N  + Y    D+       F I   TG + +  TLD  KV + +T  V A    TD  F ++A VK+ VVD  + P    L +      + L E  T I  E + V    P   NG  +   + G        P N+   +  T  + LV SLDYE R   + ++    R     TSSH     ++ + D+ND +P F    Y  T+ E+      V+ V A D DS +N +INY I ++S   ++F ID  +G +    S D E R  +++ + A D G+P+ +G   V + + D NDN P F        Y   I  +      +  I A DPDEG   ++ Y+       + F I    G+I  ++ +  +   V+   V V D       ++  V V + D ND+ P F   + D   V  +     GT V  + A D D G  +HL Y I S ++  +     F +D  +G ++ +    R++    I+ + +
Sbjct: 1993 LDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRY----DLIGGDPGYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEA----TDGLFRTEAVVKIKVVD-KETPVFDQLSF-----SKVLAED-TPIGSEVTSVTARSP---NGAGILYSITGGD------PVNQFSIDFKTGVVTLVSSLDYETRTKYKLVV----RATDARTSSHSDVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFD----KSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQHFQIDSQSGVITLSRVVGIKQGKVYGLDVEVSDS---VHVSTSKVRVIIGDTNDHSPIF---SEDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRK-----FRIDADSGMLYSRLMFDRENSSQAIMSVPI 2521          

HSP 8 Score: 159.844 bits (403), Expect = 4.894e-39
Identity = 186/662 (28.10%), Postives = 287/662 (43.35%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA-LFTLIPEWSNFDSTINQIFLKLLQPIDRE-NVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYT-FLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA-GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            NDN P F        IS S+ +G  + +  A D D+ +   ++Y +  H+   +FT+     N  + + Q+         RE  V  YN  ++  D G P L     ++I +L+ +     F  S Y V V E+   G ++  L       G    V Y           +KF +D STG + +   LDYE    Y   V A  S  +   ++  V V V+D ND  PK    +V+D    ++ E    I  +   V   D DSG+ G+V   L    K +    +  + + W I    +LD E++    F +   D G  +LTS      I+ D+ND  P F    +  +V+E+   G  V  + ATD   DLN ++ Y I S    + F I+  TG I    S DRE   SY L++ A D      +  A + I I D NDN P    +     Y+  IKEN P  + + T+ A D D G+N ++ Y+ F      F +  + G +    +LDRE +  + F V   D G   Q    ++++ + D NDN P F    + S+     Y D     ++ +++A D D G N  L Y +++           F ++   G I L++ L R+    Y L + V D G PP  S A   IK+ N
Sbjct: 2543 NDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVGHQTPPVFTI-----NAATGVIQV--------SREPEVKSYNFFVLVKDGGNPLLRSIASVKITVLERDARILHFGKSKYDVTVGENAEMGQIVTGLNLV-VPGGNPVDVDYRIIKGNNDNNDRKFGVD-STGRVRVIGRLDYEIRNRYVMIVEANVSAIN-QIARTVVVVQVLDINDVTPK----FVSDPYLASIPEN-IDIGSKVLRVFAEDLDSGSNGMVTYALVSKDKLVKEKFDIDQHTGW-ITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDE--DLNTELYYFILSGDPQARFGIERKTGVIFVHGSLDRESVGSYDLNISASD---GLFTSFAQMKIDIEDANDNPP----ICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAVDKN-GKMTNLVELDRETRPFYNFMVSAADIG--GQACYSNISIHLDDVNDNRPLF----SQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVT------DAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLN 3160          

HSP 9 Score: 145.976 bits (367), Expect = 8.867e-35
Identity = 170/661 (25.72%), Postives = 288/661 (43.57%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL---KGSQKFILVPPN---------NREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSP-----VEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGI--LRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQG 2877
            ND +P F++ +    ISES  +   +    A+D DS     I+Y ++N      + +  +   D     +F+   + +D E+  ++ + ++A D+GKPSL+G+ ++ + ++DANDN P F+ S Y  ++  S   G  +  + ATD D G+   + Y  +     + R+ F IDS +G +++S  +  ++ K Y  +V   DS      S + V+V + D ND+ P    +    S      EG        ++V  +D DSGN   +   +      +KF +   +         +RE S+  I  V     +      F +V     E  L           D NDN PIFE  +Y  T+  +   G  VL   A+D D+  N  + Y I    +   F+I+  TG I  ++S + E + SY   V  +D G P     A+V IT+ +++    +F    G   Y   + EN     I+  ++   P  G    V Y  +         KF +    G +R   +LD E   +    V +++  +  + Q     V V V+D ND  P+FV   +D     I      G+ V R+ A D D G N  + Y ++   S+D+   + F +DQ  G I  + AL R+    +  ++  +D G
Sbjct: 2230 NDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQN-----VSRVGAFFKIDKKSGVVFVA--KSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITG---GQGRQHFQIDSQSGVITLSRVVGIKQGKVYGLDVEVSDS---VHVSTSKVRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFV-----TMVSATDLDSGNYAHLTYSIDSVDAMRKFRIDADSGMLYSRLMFDRENSSQAIMSVPIRATDGGGRFGFCVV-----EVHLI----------DENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVGHQTPPVFTINAATGVI--QVSREPEVK-SYNFFVLVKDGGNPLLRSIASVKITVLERDARILHF----GKSKYDVTVGENAEMGQIVTGLNLVVPG-GNPVDVDYRIIKGNNDNNDRKFGVD-STGRVRVIGRLDYE---IRNRYVMIVEANVSAINQIARTVVVVQVLDINDVTPKFV---SDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALV---SKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNG 2839          

HSP 10 Score: 145.206 bits (365), Expect = 1.232e-34
Identity = 154/617 (24.96%), Postives = 265/617 (42.95%), Query Frame = 1
Query: 1141 FDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDAND---NQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPP----KIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS-YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV-----------EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEP-----RFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
             DS   +IF  +   +D E+   Y+L ++A D G P LS    + I ++  N    N P+F N  Y  +++E +     +L++ A D D  +   + Y  +S        KF ID   G+++++ +LD E+  +Y+  V A D    A+     V ++++D NDN P    + Y  +V ++     +           +  V DPD+G  G V+  +  + K         E  + +I  V+ LDYE        I   DRG P+  +     + + D+ND+ P F  P +   V+ + +AG  +L+V+ATD+D   N K+ YSI S + +   S+D  +G ++            Y L V + D GEP      +V + +     N  + +       Y   + EN P            PD+ I   V+Y  + PV             FT+    G+I + +  D E     +  +R        Q +S  V V++ D+NDN+P     R      + +    + LD  G+ +  + A D+D      L Y+I+  ++RD     +F +    G I   + L  +    Y  K+ V+D GNP   ++A+  I +
Sbjct: 1260 IDSRSGEIFTNV-SLVDGES---YDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPDFDQ---ITYNIAS---GNHGNKFTIDRYGGFITVAHSLDREEKSFYSLRVEATDGYNTASVP---VTINILDVNDNSPQPARREYRAHVAENSDVGTL-----------VTTVKDPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTNKSLSVDQNSGVVKVAGRLSTLVH-QYALKVQSTDGGEPPLKTQVDVKVKVRGIVKNFAFEK-----PKYEVSLPENSP------------PDQAI-ATVVYNGILPVYEIVPGRSPCWRDFTVQRQSGVIISKKSFDAEEVTHCKLEIRA--NSTDGQHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAV-ATDQDIS-GDKLTYEIVETSARD-----VFSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHV 1824          

HSP 11 Score: 140.969 bits (354), Expect = 2.558e-33
Identity = 159/582 (27.32%), Postives = 248/582 (42.61%), Query Frame = 1
Query: 1270 IEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPK----IYLEYVTDSG-------KRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTF--LSPVEKFTIHPDQGIIRTNQQLDREN--KAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYN 2967
            ++IK++D     P+F+  ++   + E    G  +  + A       NG  + Y  S    +   +F ID  TG +++  +LDYE    Y   V A D+ T ++ S   V V+V D ND  P     +YL  +++S            I+G + INKE +  I +   S  G   + D K    F+                 +SLDYE R V   IIV  D G+P LT      +++ D NDN+P F+   Y  ++  +   G  V +++ATD D     K+ YSI       +F ID  +G I        ++   Y L V   ++ +     ++ V + I D ND++P F        Y     EN P    +  + A D D G    + Y+   +  + KF I  D G++ +    DREN  +A+    +R  D G   +     V V +IDENDN+P F +   D+T   IS   T GT V    A D D   N+ L Y I+           +F ++   G I + R     ++  Y   ++V D GNP  +S A+  I +     R       KY+
Sbjct: 2123 VKIKVVDKE--TPVFDQLSFSKVLAEDTPIGSEVTSVTA----RSPNGAGILY--SITGGDPVNQFSIDFKTGVVTLVSSLDYETRTKYKLVVRATDART-SSHSDVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNV--SRVGAFFKIDKKSGVVFV----------------AKSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQHFQIDSQSGVITLSRVVGIKQGKVYGLDV---EVSDSVHVSTSKVRVIIGDTNDHSPIFS----EDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRKFRIDADSGMLYSRLMFDRENSSQAIMSVPIRATDGG--GRFGFCVVEVHLIDENDNQPIFELKNYDTT---ISRSVTMGTPVLMTSASDPDASSNAALTYVIVG-----HQTPPVFTINAATGVIQVSR---EPEVKSYNFFVLVKDGGNPLLRSIASVKITVLERDARILHFGKSKYD 2657          

HSP 12 Score: 138.272 bits (347), Expect = 1.689e-32
Identity = 158/632 (25.00%), Postives = 275/632 (43.51%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQ--IFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYS--IVIVSDPDSGNGGLVQCDLKGSQK--FILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIR-SKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGI--IRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRAL 2823
            ND+ P F  P+   E+  S + G  I   +A D+D    + + Y          +++   +N   +++Q    +K+   +    V  Y L + +TD G+P L  ++ +++K+     N   FE   Y V++ E+      I  +         NG++  Y      S   + F +   +G +   ++ D E+V +    +  R + TD   S   V V++ D NDN P      +T        +G   ++ + S  + + +D D     L    ++ S +  F + P      +T  I   + LDYE      F I   D G P+L++  + +I + DIND +P+F   +YH TV   + AG  V  V ATD DS  N  + +S+       F+++P+TG +  S  +  R  R +Y + +   D    A    A V I   +   +   F   N    Y   ++E    ++ + T+ A      I   + YT ++P E F I P  G+  IR    LDRE+   ++  V+  D  +       +V V VID NDN+P F+   N    + +      GT++ + +A D D G N++L Y +I G+         F + +K G++ ++R L
Sbjct: 1515 NDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKY----------SIVSGNTNKSLSVDQNSGVVKVAGRLSTL-VHQYALKVQSTDGGEPPLKTQVDVKVKVRGIVKNFA-FEKPKYEVSLPENSPPDQAIATVVY-------NGILPVYEIVPGRSPCWRDFTVQRQSGVIISKKSFDAEEVTHCKLEI--RANSTDGQHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGDKLTYEIVETSARDVFSIHP------ATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSYAGTRVTMVTATDGDSAAN--LTFSLARQDTELFAVNPLTGVVTVSNAALLR--RDTYTIKLTVSDGNHTAH---ARVRIRCENLPSSDLQFSRKN----YSASVREGVSVDSELVTVRAL--GYPIGSTITYTIINPSELFHIVPSTGVMSIRAGFDLDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFI---NSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIGGDP------GYFSISRKTGEVVVRRTL 2097          

HSP 13 Score: 133.265 bits (334), Expect = 6.267e-31
Identity = 174/692 (25.14%), Postives = 288/692 (41.62%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDREN--VSMYNLNLIATDKGKP-SLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATV-KVSVVD--------------CNDNPP-----KIYLEYVTDSGKRTLIEGPTTINKEYSIV-----------------------IVSDPDSGNGGLVQCDL-KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQS-GSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPP 2886
            ND+ P F  P    ++ E +  G  +    A D DS     + Y L N     F + P+     +T N         +DR+       NL + A+D G P     +  +++++ + NDN P+ +     + V  +   G LI  + A D D  +    + Y S+       K F +D  TG L  + +L   + + +T  + A D   ++  +   + K+S+V               C D+P      KI  E  + S  + LI     ++  +  V                       + +D D G  GLV   + +G    +     N    T ++ +   LD E  +     I   D G+ + ++     + I D+ND SP+F+   Y  T+ EN   G  V  V A+D+D   NG I Y I +     F ++ ++G +      D E++  Y++ + A D     Q  GS +V++T+ D NDN+P  +       +   ++E+   NA++ +IHA DPD G  G++ ++      KF I    G+IR  Q+LD E K+ +  +VRV DKG       V V V+V+D N+N    V          I+     GT+V   +A D+D   + +L Y II G   D+     F +D   G I     L  +    Y L +   D  + P
Sbjct:  420 NDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDTGIIRTTTN---------LDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKST--FGNTGKAFSLDPKTGELRTARSLRGLQ-REFTLIIKATDGIQESPDTHPVILKISIVGGRQARKLQNHVSTKCVDSPLYAKALKIKQEQKSYSSLQPLIFATAKLHNRHHPVFRSHDQNIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGDVDSVF----NINMFTGELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGGKFRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKP----KKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQD---SWYLKYAIIDGTGVDK-----FIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESYP 1083          

HSP 14 Score: 120.939 bits (302), Expect = 3.602e-27
Identity = 182/722 (25.21%), Postives = 299/722 (41.41%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKG----KPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTS-EVRKKFHIDSSTG--WLSISETLDYEKVKY-YTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQ--KFILVPPNNREGSTWKINLVESLDYEERNVERF-IIVCHDRGEP---QLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRAS--YQLSVFARDLGEPAQSGSANVL-ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLY---TFLSPVEKFTIHPDQGIIRTNQQ---LDRE--------------------------------NKAVHEFSVRVIDKGI------LRQE----NSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            NDN P F +      I E I +   I    AVD D     +I Y  +    + F + P      S +  +  KL       +  ++ L ++A D+     KP  S   ++ + +   N   P F   T + NV E   SG +   L   DKD G NG +      ++TS  +   F I SS     + + + LD E   + Y   + A D GT        ++V+V+D NDN P+     Y+T+  +   I  P         V+ +D D+G NG ++    +G++  KF +   N++ G  +       LDYE R  +RF + V    G P   +  S+    + I D ND+ P F+ P Y + + E+   G  V  V A D DS  NGK+ YS+ +L    F I+P TG IR+  + DR+        L V A D G P +  +  ++ + + + NDN P  +           +  N P   +I T+ A D D     Q L    TF +  + F++ P  G +RT +    L RE                                 K  +  S + +D  +      ++QE    +S+   +    +  N    V  ++D  ++ IS      T+V++  A D+D+G N  + Y I+ G+      D +F ++   G++ +   L R+ +  Y L +   D G   + +Y    +KI
Sbjct:   99 NDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSFKEKTTS-FAINPI-----SGVVSVAQKL-----SNSARIHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSVKTQLQNVSEG-TSGIVYATLGIIDKDKGSNGDIDRV---EITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVL------RVLATDKDAGSNGNIMYVITRGNELGKFEI---NSKTGQIYTKG---DLDYESR--QRFDLTVAALDGVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCN----ILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELRTARSLRGLQREFTLIIKATDGIQESPDTHPVILKISIVGGRQARKLQNHVSTKCVDSPLYAKALKIKQEQKSYSSLQPLIFATAKLHNRHHPVFRSHDQ-NIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGDV-----DSVFNINMFTGELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKI 781          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 328.561 bits (841), Expect = 6.327e-94
Identity = 245/743 (32.97%), Postives = 367/743 (49.39%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDIRVKK-PIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI   + PIDRE+L  D       +P C+ E +V V            +    + +  +   RI++ DINDN+P F   V TI + E+  +GA   +PLA D DS+   +  Y L     A  TL       D       L +L  +DRE    Y+L + A D G P    +  + + + DANDN P FE+ +Y   V E+   GH +L +KA D D G NG + Y     V   V K   ID +TG + +   LD E++   +F V+ARD G     SK  V + V D NDN P + +     VT S     I     +    ++V VSD D G   +V C + G   F L P ++      +   +++   LDYE     R  IV  D G P L+S++  ++ + D+NDNSP+F    +     E NQ G  +L V ATD DS  N ++ Y+I  DS     F IDP TG ++++   DRE +  Y+  V A D G P   G+A V+I + D NDN P F  L+G   Y F + EN P  + +G +   D D+G N  V  +      KF +    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN+P    P+N S+  ++S + +  + V  +EA D D GPN+ L + I  GN       ++F +   +G+I L + +TR+  G++ L + VSD+G PPR + A
Sbjct:   54 YKLEVGAPYLRVDGKTGDIFTTEIPIDRETLR-DCRSLVKGKP-CYLEFEVSV------------TDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAA-TLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAV-DPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFM-LSG---YSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSN-SSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPY-----QLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATA 770          

HSP 2 Score: 172.17 bits (435), Expect = 6.886e-43
Identity = 156/579 (26.94%), Postives = 247/579 (42.66%), Query Frame = 1
Query: 1276 IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGW----LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES-LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV---EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            I++ D NDN P F  S   ++V E+ I G L  +  ATD+DS  NG+  Y  ++   +       +    G     L +   LD E    Y   + A D G    +S+A ++V V D NDN PK  +  Y  +  + + + G + +      V   D D G  G ++  L   Q    VP   R   T  I  V+  LD EE N   F +V  D+G    +S     I + D NDN+P  E        H      + E+   G  V  V  +D+D   N  +   +       F + P + +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDN+P F         IFE+   +EN P   I+  + A D D G N ++ Y  +        F I P+ G ++    LDRE+K  +EF V   DKG    + + +V + V+D NDN+P+F++     +    S L+    L  V  +  +D D+G N+H+   +     +       F +    G I    +  R+    Y  ++   D G PPR SY    I +
Sbjct:  120 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPV-GHSVLQ-----VKADDSDMGPNGEIEYSLH--QAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVV--AGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFS------PTIFEVDFAEENQPGETIL-DVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFML-----SGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK-------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINV 669          

HSP 3 Score: 157.147 bits (396), Expect = 2.838e-38
Identity = 141/462 (30.52%), Postives = 201/462 (43.51%), Query Frame = 1
Query: 1597 KVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKG----SQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQ----GLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQG---------IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            ++ V D NDN P+  L  +T S     I G       +SI + +D DS   G+    L      +  F L   ++R G   ++ ++ +LD E ++     I   D G PQ  S     +++ D NDNSP FEHPSY   V EN+  G  VL+V A D D   NG+I YS    +D +      ID  TG I  K   DRE+  S    V ARD G   +S    V I +TDQNDN P  +    GL      I  I E+ P    +  +   D DEG N  V       V  F + P             ++T   LD E    +   +  +D G     ++ S+ V V D NDN P F  PT     V  +  +  G  +  + A D D G N+ L Y I+     D     +F +D   G++  +  L R+    Y  ++  +D+G+P  K  A  VIK+
Sbjct:  119 RIEVQDINDNTPQFPLSVLTISVPENTIMGAL-----FSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVP-KLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDV-PFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFS-PT--IFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVG----DSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKV 566          

HSP 4 Score: 142.124 bits (357), Expect = 1.370e-33
Identity = 127/444 (28.60%), Postives = 195/444 (43.92%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK-GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHP---SYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSY 2316
            ISE + +G  + L    D+D     +++  +       F L P   +      + FL+   P+D E V  Y + ++A D G P+LS    +++++ D NDN P+F  + + V+  E    G  IL + ATD DSG N  + Y    D  S ++  F ID +TG +     LD E  + Y F V A D G+      ATV + V+DCNDN PK  L   + S    ++E    ++    +V V D D G    V   ++    KF++      +  T  I    S D E+ +   F +   D GEP  +S     I + D NDN P+   P   S+ Q     +    V + V A D DS  N  + +SI   +    F I P +G I       R+    ++L V   D G+P +  +A V I + +   N    + L G   Y
Sbjct:  368 ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGD--VPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGD--SYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFS----VLENMPPLSP-VGMVTVLDMDKGENAHVHLSVEPDGGKFVV------QNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDV-VEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLY 795          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 328.176 bits (840), Expect = 3.993e-92
Identity = 245/743 (32.97%), Postives = 367/743 (49.39%), Query Frame = 1
Query:  712 YSLNSKNDHLRI----GDIRVKK-PIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES---LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI--DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            Y L     +LR+    GDI   + PIDRE+L  D       +P C+ E +V V            +    + +  +   RI++ DINDN+P F   V TI + E+  +GA   +PLA D DS+   +  Y L     A  TL       D       L +L  +DRE    Y+L + A D G P    +  + + + DANDN P FE+ +Y   V E+   GH +L +KA D D G NG + Y     V   V K   ID +TG + +   LD E++   +F V+ARD G     SK  V + V D NDN P + +     VT S     I     +    ++V VSD D G   +V C + G   F L P ++      +   +++   LDYE     R  IV  D G P L+S++  ++ + D+NDNSP+F    +     E NQ G  +L V ATD DS  N ++ Y+I  DS     F IDP TG ++++   DRE +  Y+  V A D G P   G+A V+I + D NDN P F  L+G   Y F + EN P  + +G +   D D+G N  V  +      KF +    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN+P    P+N S+  ++S + +  + V  +EA D D GPN+ L + I  GN       ++F +   +G+I L + +TR+  G++ L + VSD+G PPR + A
Sbjct:  131 YKLEVGAPYLRVDGKTGDIFTTEIPIDRETL-RDCRSLVKGKP-CYLEFEVSV------------TDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAA-TLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAV-DPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFM-LSG---YSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSN-SSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPY-----QLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATA 847          

HSP 2 Score: 172.555 bits (436), Expect = 8.768e-43
Identity = 156/579 (26.94%), Postives = 247/579 (42.66%), Query Frame = 1
Query: 1276 IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGW----LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKI-YLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVES-LDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPV---EKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTL--VARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            I++ D NDN P F  S   ++V E+ I G L  +  ATD+DS  NG+  Y  ++   +       +    G     L +   LD E    Y   + A D G    +S+A ++V V D NDN PK  +  Y  +  + + + G + +      V   D D G  G ++  L   Q    VP   R   T  I  V+  LD EE N   F +V  D+G    +S     I + D NDN+P  E        H      + E+   G  V  V  +D+D   N  +   +       F + P + +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDN+P F         IFE+   +EN P   I+  + A D D G N ++ Y  +        F I P+ G ++    LDRE+K  +EF V   DKG    + + +V + V+D NDN+P+F++     +    S L+    L  V  +  +D D+G N+H+   +     +       F +    G I    +  R+    Y  ++   D G PPR SY    I +
Sbjct:  197 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPV-GHSVLQ-----VKADDSDMGPNGEIEYSLH--QAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVV--AGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFS------PTIFEVDFAEENQPGETIL-DVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFML-----SGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK-------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINV 746          

HSP 3 Score: 156.762 bits (395), Expect = 6.656e-38
Identity = 141/462 (30.52%), Postives = 201/462 (43.51%), Query Frame = 1
Query: 1597 KVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKG----SQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYS----IDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQ----GLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQG---------IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            ++ V D NDN P+  L  +T S     I G       +SI + +D DS   G+    L      +  F L   ++R G   ++ ++ +LD E ++     I   D G PQ  S     +++ D NDNSP FEHPSY   V EN+  G  VL+V A D D   NG+I YS    +D +      ID  TG I  K   DRE+  S    V ARD G   +S    V I +TDQNDN P  +    GL      I  I E+ P    +  +   D DEG N  V       V  F + P             ++T   LD E    +   +  +D G     ++ S+ V V D NDN P F  PT     V  +  +  G  +  + A D D G N+ L Y I+     D     +F +D   G++  +  L R+    Y  ++  +D+G+P  K  A  VIK+
Sbjct:  196 RIEVQDINDNTPQFPLSVLTISVPENTIMG-----ALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVP-KLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDV-PFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFS-PT--IFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVG----DSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKV 643          

HSP 4 Score: 142.51 bits (358), Expect = 1.365e-33
Identity = 127/444 (28.60%), Postives = 195/444 (43.92%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKG-SQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHP---SYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLS-VSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSY 2316
            ISE + +G  + L    D+D     +++  +       F L P   +      + FL+   P+D E V  Y + ++A D G P+LS    +++++ D NDN P+F  + + V+  E    G  IL + ATD DSG N  + Y    D  S ++  F ID +TG +     LD E  + Y F V A D G+      ATV + V+DCNDN PK  L   + S    ++E    ++    +V V D D G    V   ++    KF++      +  T  I    S D E+ +   F +   D GEP  +S     I + D NDN P+   P   S+ Q     +    V + V A D DS  N  + +SI   +    F I P +G I       R+    ++L V   D G+P +  +A V I + +   N    + L G   Y
Sbjct:  445 ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGD--VPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGD--SYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFS----VLENMPPLSP-VGMVTVLDMDKGENAHVHLSVEPDGGKFVV------QNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDV-VEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLY 872          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 320.857 bits (821), Expect = 5.541e-91
Identity = 230/661 (34.80%), Postives = 335/661 (50.68%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTL-IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPN---NREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE-KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDS-TSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            NDN+P FS P+ T+ I E+   G    +P+AVD DS +  +  Y L     A  LF L + E  + D  I Q+ +  +  +DRE    Y+LN+   D GKP  +    + I + D NDN P FE + Y   + E+   GH +L ++A D D+G NG + Y      +  V++   ID STG + +   +D E+     F V+ARD G ++  SKA V +S+ D NDN P I +     V        I     I    ++V VSD D G   +V C + G   F L P +   N     + +     LDYE     R  IV  D G P L+S++  ++ + DINDN+P F          E+NQ G  V+ VVATD DS +N ++ YSI +S + S F I+  TG IR +   DRE    Y+  V A D G P+++G+A V+I + D+NDN P F  L+G   Y F + EN P    +G +   D D+G N QV   F+ P   KF I    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN P    P N S T +K S      T V  ++A D D G N+ L Y I  GN        +F +   +G+I L +  T +  G++ L + VSD+G PPR + A
Sbjct:  145 NDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAE--DVDEKIPQVIV--IGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQ-ASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFM-LSG---YSFSVNENMPPLNPVGVVTVSDADKGENSQVTL-FVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPS--SPPDTPVEVVKAEDIDAGVNAELYYTITGGNPH-----GLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTA 788          

HSP 2 Score: 190.274 bits (482), Expect = 1.440e-48
Identity = 165/562 (29.36%), Postives = 253/562 (45.02%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFE--------NSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTG---WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDN 2598
            NDN+P F +     E+ E+   G  +    A D D+     I Y L      +  L+      D +   I++K L  +DRE  ++    ++A D+G  S S K ++ I I D NDN P  E        +  ++ N+ E    G  + L++ +D+D GEN +V    + DV  ++R      +      +L  +  LDYE++K Y   ++A DSG  A  S  ++KV V D NDN P      +  +       G   I+     V+ +D DSG N  LV   ++ S   +    +N    T +I +   LD E+     F +   D+G P  T +    I + D NDN P F    Y  +V EN      V  V  +D D   N ++   ++  +   F I   TGTI S ISFDREK ++Y   + A D G+P +S    V I + D+NDN PY        S    +K + P +  +  + AED D G+N ++ YT     P   F I  + G I+  Q    ++K +H   VRV DKG   +  +  V V V +  +N
Sbjct:  257 NDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLL----RIDRSTGIIYVKGL--VDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVID-----VVATDADSGVNAELVYSIIESSAASLFEINSN----TGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDN-GKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVT--KPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          

HSP 3 Score: 180.259 bits (456), Expect = 2.027e-45
Identity = 169/638 (26.49%), Postives = 281/638 (44.04%), Query Frame = 1
Query: 1144 DSTINQIFLKLLQPIDRENVS-----------MYNLNLIATDKGKPSLSGKLKIE--IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSE----VRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIV--SDPDSGNGGLVQCDLKGS----QKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFL--SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTND-STSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            DS   +I+   + PIDRE +S                +  TD  K    G   IE  I++LD NDN P F +    +++ E+  +G L  +  A D+DSG NG+  Y  S+   +     ++    +D     + +   LD EK   Y  N+   D G     S A ++++V D NDN PK           +   E P      +S++ V  +D D+G  G +   L  +    Q+ + +     + ST  I +   +D EE N+ +F +V  DRG    +S  +  I I+D NDN+P  E        H ++   + E+   G  V  V  +DRD   N  +   +       F + P + +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDNTP F         + E+   ++N P + +I  + A D D G+N +++Y+ +  S    F I+ + G IR   QLDRE+   +EF V   DKG+  +  +  V ++V D NDN+P+F++     S +  +  L+  G +       D D+G NS +   +   N +       F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:   83 DSKTGEIYTTEI-PIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKF-------EKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRI-----DRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVV--AGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFS------PALLEVNFAEDNQPGDKVIDVV-ATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVS----DADKGENSQVTLFVEPDNGK-------FIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINV 687          

HSP 4 Score: 140.969 bits (354), Expect = 3.039e-33
Identity = 133/462 (28.79%), Postives = 206/462 (44.59%), Query Frame = 1
Query: 1600 VSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGS----QKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS---YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQ----GLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPD---------QGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            + V+D NDN P+     +T S     I   T     +SI +  D DSG+ G+ +  L       Q F L    + +    ++ ++ +LD E+++     I   D G+P   SS    I + D NDN+P FE   Y   + EN+  G  VL+V A D D+  NG I+YS+   S +      ID  TG I  K   DRE+    +  V ARD G  ++S  A V I+I DQNDN P  +    GL    +++  I E+ P    +  +   D DEG N  V       V  F + P          +  ++T   LD E    +   +  +D G     ++ S+ V V D NDN P F   +     V  +  +  G  V  + A D D G N+ L Y II     + +   +F ++   G+I ++  L R+D+  Y   +  +D+G P +   A  VI +++
Sbjct:  139 IEVLDINDNTPQFSSPILTLS-----IPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDV-PFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSF---SPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSII-----ESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVED 586          

HSP 5 Score: 133.65 bits (335), Expect = 5.574e-31
Identity = 123/446 (27.58%), Postives = 197/446 (44.17%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHP--SYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSY 2316
            ISE + IG  + L    D D     +++  +       F L P   + +    + FL+    +D E +  Y + ++A D G P+LS    +++++ D NDN P F  +   VN  E    G  ++ + ATD DSG N  ++Y   S + S     F I+S+TG + +   LD E V+ Y F V A D G  +    A V ++V D NDN PK  L     SG    +           +V VSD D G         + SQ  + V P+N     +  T  I    S D E+ +   F +   D G+P  +S     I + D NDN+P    P  S +  ++ ++     V  V A D D+ +N ++ Y+I   +    F I   +G I+    F  + +  ++L V   D G+P +  +A V + + +  +N    +GL G   Y
Sbjct:  387 ISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGD--VPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVY---SIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFML-----SGYSFSVNENMPPLNPVGVVTVSDADKG---------ENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEGLVGHSLY 813          

HSP 6 Score: 60.4622 bits (145), Expect = 1.773e-8
Identity = 67/243 (27.57%), Postives = 104/243 (42.80%), Query Frame = 1
Query: 2317 IFEIKENGPSNAIIGTIHAED--PDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQ-QLDRE-----------NKAVHEFSVRVID--KGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFM------DQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQH 2979
            I+++ E  P N +IG++ A+   PD G     LY          +    G I T +  +DRE           +K   EF V + D  KGI      +   + V+D NDN P+F  P     ++ I      GTL +   A+D+D G N   +Y + +G   +Q    +F +      D+K   + +   L R+    Y L + V D G PPR S A   I + +     Q  N  K+ +NQ+
Sbjct:   42 IYKLSEEQPPNTLIGSLAADLGLPDSGH----LYKLEVGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPI---LTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQ----LFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTD-----QNDNAPKFEKNQY 268          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 320.472 bits (820), Expect = 8.192e-90
Identity = 230/661 (34.80%), Postives = 335/661 (50.68%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHA--LFTL-IPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE---YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPN---NREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE-KFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDS-TSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYA 2901
            NDN+P FS P+ T+ I E+   G    +P+AVD DS +  +  Y L     A  LF L + E  + D  I Q+ +  +  +DRE    Y+LN+   D GKP  +    + I + D NDN P FE + Y   + E+   GH +L ++A D D+G NG + Y      +  V++   ID STG + +   +D E+     F V+ARD G ++  SKA V +S+ D NDN P I +     V        I     I    ++V VSD D G   +V C + G   F L P +   N     + +     LDYE     R  IV  D G P L+S++  ++ + DINDN+P F          E+NQ G  V+ VVATD DS +N ++ YSI +S + S F I+  TG IR +   DRE    Y+  V A D G P+++G+A V+I + D+NDN P F  L+G   Y F + EN P    +G +   D D+G N QV   F+ P   KF I    G I ++   DRE ++ + F ++ +D G   + + V VT++V+DENDN P    P N S T +K S      T V  ++A D D G N+ L Y I  GN        +F +   +G+I L +  T +  G++ L + VSD+G PPR + A
Sbjct:  145 NDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAE--DVDEKIPQVIV--IGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQ-ASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFM-LSG---YSFSVNENMPPLNPVGVVTVSDADKGENSQVTL-FVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPS--SPPDTPVEVVKAEDIDAGVNAELYYTITGGNPH-----GLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTA 788          

HSP 2 Score: 190.274 bits (482), Expect = 2.346e-48
Identity = 165/562 (29.36%), Postives = 253/562 (45.02%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFE--------NSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTG---WLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSG-NGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS--PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDN 2598
            NDN+P F +     E+ E+   G  +    A D D+     I Y L      +  L+      D +   I++K L  +DRE  ++    ++A D+G  S S K ++ I I D NDN P  E        +  ++ N+ E    G  + L++ +D+D GEN +V    + DV  ++R      +      +L  +  LDYE++K Y   ++A DSG  A  S  ++KV V D NDN P      +  +       G   I+     V+ +D DSG N  LV   ++ S   +    +N    T +I +   LD E+     F +   D+G P  T +    I + D NDN P F    Y  +V EN      V  V  +D D   N ++   ++  +   F I   TGTI S ISFDREK ++Y   + A D G+P +S    V I + D+NDN PY        S    +K + P +  +  + AED D G+N ++ YT     P   F I  + G I+  Q    ++K +H   VRV DKG   +  +  V V V +  +N
Sbjct:  257 NDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLL----RIDRSTGIIYVKGL--VDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVID-----VVATDADSGVNAELVYSIIESSAASLFEINSN----TGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDN-GKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVT--KPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          

HSP 3 Score: 179.874 bits (455), Expect = 4.320e-45
Identity = 169/638 (26.49%), Postives = 281/638 (44.04%), Query Frame = 1
Query: 1144 DSTINQIFLKLLQPIDRENVS-----------MYNLNLIATDKGKPSLSGKLKIE--IKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSE----VRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIV--SDPDSGNGGLVQCDLKGS----QKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFE--------HPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGT---------IRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEI---KENGPSNAIIGTIHAEDPDEGINGQVLYTFL--SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTND-STSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            DS   +I+   + PIDRE +S                +  TD  K    G   IE  I++LD NDN P F +    +++ E+  +G L  +  A D+DSG NG+  Y  S+   +     ++    +D     + +   LD EK   Y  N+   D G     S A ++++V D NDN PK           +   E P      +S++ V  +D D+G  G +   L  +    Q+ + +     + ST  I +   +D EE N+ +F +V  DRG    +S  +  I I+D NDN+P  E        H ++   + E+   G  V  V  +DRD   N  +   +       F + P + +         +++    D E+   Y++ + A D G PA S + ++ + +TD NDNTP F         + E+   ++N P + +I  + A D D G+N +++Y+ +  S    F I+ + G IR   QLDRE+   +EF V   DKG+  +  +  V ++V D NDN+P+F++     S +  +  L+  G +       D D+G NS +   +   N +       F +    G I    +  R+    Y  ++   D G+PPR SY    I +
Sbjct:   83 DSKTGEIYTTEI-PIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKF-------EKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRI-----DRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVV--AGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFS------PALLEVNFAEDNQPGDKVIDVV-ATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVS----DADKGENSQVTLFVEPDNGK-------FIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINV 687          

HSP 4 Score: 139.813 bits (351), Expect = 7.977e-33
Identity = 133/462 (28.79%), Postives = 206/462 (44.59%), Query Frame = 1
Query: 1600 VSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGS----QKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVS---YFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQ----GLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPD---------QGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            + V+D NDN P+     +T S     I   T     +SI +  D DSG+ G+ +  L       Q F L    + +    ++ ++ +LD E+++     I   D G+P   SS    I + D NDN+P FE   Y   + EN+  G  VL+V A D D+  NG I+YS+   S +      ID  TG I  K   DRE+    +  V ARD G  ++S  A V I+I DQNDN P  +    GL    +++  I E+ P    +  +   D DEG N  V       V  F + P          +  ++T   LD E    +   +  +D G     ++ S+ V V D NDN P F   +     V  +  +  G  V  + A D D G N+ L Y II     + +   +F ++   G+I ++  L R+D+  Y   +  +D+G P +   A  VI +++
Sbjct:  139 IEVLDINDNTPQFSSPILTLS-----IPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDV-PFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSF---SPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSII-----ESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVED 586          

HSP 5 Score: 133.265 bits (334), Expect = 8.633e-31
Identity = 123/446 (27.58%), Postives = 197/446 (44.17%), Query Frame = 1
Query: 1000 ISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHP--SYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV-SYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSY 2316
            ISE + IG  + L    D D     +++  +       F L P   + +    + FL+    +D E +  Y + ++A D G P+LS    +++++ D NDN P F  +   VN  E    G  ++ + ATD DSG N  ++Y   S + S     F I+S+TG + +   LD E V+ Y F V A D G  +    A V ++V D NDN PK  L     SG    +           +V VSD D G         + SQ  + V P+N     +  T  I    S D E+ +   F +   D G+P  +S     I + D NDN+P    P  S +  ++ ++     V  V A D D+ +N ++ Y+I   +    F I   +G I+    F  + +  ++L V   D G+P +  +A V + + +  +N    +GL G   Y
Sbjct:  387 ISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGD--VPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVY---SIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFML-----SGYSFSVNENMPPLNPVGVVTVSDADKG---------ENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEGLVGHSLY 813          

HSP 6 Score: 60.077 bits (144), Expect = 1.922e-8
Identity = 67/243 (27.57%), Postives = 104/243 (42.80%), Query Frame = 1
Query: 2317 IFEIKENGPSNAIIGTIHAED--PDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQ-QLDRE-----------NKAVHEFSVRVID--KGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFM------DQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQH 2979
            I+++ E  P N +IG++ A+   PD G     LY          +    G I T +  +DRE           +K   EF V + D  KGI      +   + V+D NDN P+F  P     ++ I      GTL +   A+D+D G N   +Y + +G   +Q    +F +      D+K   + +   L R+    Y L + V D G PPR S A   I + +     Q  N  K+ +NQ+
Sbjct:   42 IYKLSEEQPPNTLIGSLAADLGLPDSGH----LYKLEVGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPI---LTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQ----LFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTD-----QNDNAPKFEKNQY 268          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 314.694 bits (805), Expect = 4.674e-89
Identity = 204/647 (31.53%), Postives = 327/647 (50.54%), Query Frame = 1
Query:  955 NDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLI---PEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTL-IEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNP 2883
            NDN+P F  PV  I I E+  I ++  +P A D D+   ++  Y L N + A    I   PE   +   I Q      Q +DRE    Y + +   D G P  S    +++ + D NDN+P+F  +   V++ E+   G  ++ L+ATD D G N  + Y F + V+   ++ F ++S++G +++   LD E+   +  +V+A D  +  A  +ATV ++V D NDNPP I L Y+      T+ +     IN + +++ VSD D+   G V C ++    F L    + +   + +     LDYE      F IV  D G+P L  +    + + D NDN PIF  P     V ENN+  + +  + ATD DS  N +I Y +   + S+F +D  TG + +   FDRE +  +  +V ARD G P     A V++T+ D+NDN P F        + F + EN P  + +G I   D D G N  +  + L+  E F + P  G+I++N   DRE ++ + F VR ID G     ++  VT++VID NDN P  + P ++++   +      G++VA + A+D D G N+ L Y I+SGN++      +F +D   G+I L+      D+G++ L + +SD G P
Sbjct:  135 NDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQ------QNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPA--RATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQ---YLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGP-NASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTH----NHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNK-----GLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 150.984 bits (380), Expect = 2.888e-36
Identity = 134/482 (27.80%), Postives = 217/482 (45.02%), Query Frame = 1
Query: 1579 FSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL-KGSQKFILVPPNNREGSTWKINLVE-SLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINY----SIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARD-LGEPAQSGSANVLITITDQNDNTP------YFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS---PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQ 2976
            F    +K+ V D NDN P      +  S     I   T IN  ++I   +DPD+G   + + +L  G   F L      EG  W   +V+ +LD E+++     I   D G PQ +S+   ++ + D+NDN P+F        + EN+  G  V+++ ATD D   N +I+Y     +   +   F+++  +G I  +   DRE+ A ++LSV A D    PA+   A V+I +TD NDN P          +NG    +F + E  P N  I  I   D D  ING+V+  F+    P     ++ +Q ++ T+  LD E    + F +   D G      +  V V + DENDN P F  P  +   ++ +  D     +  + A D+D G N+ + YQ+    S        F +D+K G +   R   R+D   ++  +   D G PP ++ A  ++ +       +  NN K+  N 
Sbjct:  122 FRLIKIKIIVKDTNDNAPMFPSPVINIS-----IPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPAR---ATVIINVTDVNDNPPNIDLRYIISPING---TVF-LSEKDPINTKIALITVSDKDTDINGKVI-CFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDL---FLTTLSATDEDSGKNAEIVYQLGPNAS-------FFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTV-----LDENDNNPKFTHNH 575          

HSP 3 Score: 127.102 bits (318), Expect = 5.271e-29
Identity = 131/565 (23.19%), Postives = 234/565 (41.42%), Query Frame = 1
Query: 1264 LKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGW--LSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSP------IFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDS-LSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            +KI+I + D NDN P+F +    +++ E+ +      +  ATD D+G N +  Y   +  ++             W  L + + LD E+   Y   +   D G+    S A ++V+V D NDN P ++ E    +     I   + I      +  +D D G    +   + G+Q   + P   R      ++  I +   LD EE  + +  ++  D       ++    I + D+NDN P      I    +    + E +     +  +  +D+D+D+NGK+   I+  +     ++      + +    D E    Y   + A D G+P+ + +A V + + D+NDN P F            + EN   +  + T+ A D D G N +++Y        F +    G++  ++  DRE++    F+V   D G    +   +V V+V+DENDN P+F   T++     +S      + V  I   D D G N+ +   I++ N         F +D  +G I    +  R+    Y   +   D G PP  S A   I +
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKP-VFRE----NQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHY-VFGTQ---VSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARAT--VIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQ----PVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKF---THNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNEN-------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINV 664          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000076665.1 (SMESG000076665.1)

HSP 1 Score: 2243 bits (5811), Expect = 0.000e+0
Identity = 1178/1178 (100.00%), Postives = 1178/1178 (100.00%), Query Frame = 1
Query:  490 SLSVEFECQLKEESIVGTVLTDILNGRPCNILQKRSLSFNTIQILMNKITVKILPIQENRISNYFEIINNDDLKYSLNSKNDHLRIGDIRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQHATYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKRGQEELNEILFKNSDRGETSANLHFCFCLSKSRNPRKPRSDSHRFSEMLYNNYSVLPKTFKAASDIDDSGFRKENNFGTLIHKDRGNSTGSLMIEKNSQTKPTECQSYQMANFRKEFNPEFNLESRYISFQGTTDSRTVDEYTTLVNNKINQANYQKLQRKLENENRKSPSTKYGNSSIDPIVYIRCSSTPGNNDTISDSEKPTKPGPATQESLSPLFRNFQSGDLLYPFTNCSKSKTLSSRTQQKNRHAKQLKSHFRYPSVPESLNYLSVGSNSGIDIHENPSRLITWEFGKKIKSTPLHKGSFV 4023
            SLSVEFECQLKEESIVGTVLTDILNGRPCNILQKRSLSFNTIQILMNKITVKILPIQENRISNYFEIINNDDLKYSLNSKNDHLRIGDIRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPSINSKISYSSSEKISSTMTIETIRIKIIDINDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHEEEIIIRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQHATYSDRSRDDSLSTSVILIVSIALICIIVLVLLTLAVFLCGKRGQEELNEILFKNSDRGETSANLHFCFCLSKSRNPRKPRSDSHRFSEMLYNNYSVLPKTFKAASDIDDSGFRKENNFGTLIHKDRGNSTGSLMIEKNSQTKPTECQSYQMANFRKEFNPEFNLESRYISFQGTTDSRTVDEYTTLVNNKINQANYQKLQRKLENENRKSPSTKYGNSSIDPIVYIRCSSTPGNNDTISDSEKPTKPGPATQESLSPLFRNFQSGDLLYPFTNCSKSKTLSSRTQQKNRHAKQLKSHFRYPSVPESLNYLSVGSNSGIDIHENPSRLITWEFGKKIKSTPLHKGSFV
Sbjct:   15 SLSVEFECQLKEESIVGTVLTDILNGRPCNILQKRSLSFNTIQILMNKITVKILPIQENRISNYFEIINNDDLKYSLNSKNDHLRIGDIRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPSINSKISYSSSEKISSTMTIETIRIKIIDINDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHEEEIIIRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQHATYSDRSRDDSLSTSVILIVSIALICIIVLVLLTLAVFLCGKRGQEELNEILFKNSDRGETSANLHFCFCLSKSRNPRKPRSDSHRFSEMLYNNYSVLPKTFKAASDIDDSGFRKENNFGTLIHKDRGNSTGSLMIEKNSQTKPTECQSYQMANFRKEFNPEFNLESRYISFQGTTDSRTVDEYTTLVNNKINQANYQKLQRKLENENRKSPSTKYGNSSIDPIVYIRCSSTPGNNDTISDSEKPTKPGPATQESLSPLFRNFQSGDLLYPFTNCSKSKTLSSRTQQKNRHAKQLKSHFRYPSVPESLNYLSVGSNSGIDIHENPSRLITWEFGKKIKSTPLHKGSFV 1192          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 315.849 bits (808), Expect = 1.725e-89
Identity = 246/743 (33.11%), Postives = 365/743 (49.13%), Query Frame = 1
Query:  748 GDIRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYR-LENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPS-YHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI---DSLSVSYFSIDPVTGTIRSKISFDREKR----ASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL------SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVID-KGILRQENSVSVTVSVIDENDNEPRFVIP-TNDSTSVKISYLDTAGTLVARIEAIDKDEGP--NSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            G +  K+ IDR+SLC +I  CC S+  C   + V +           +      S   I    I I D ND+ P+F  P+  + ISES  +     LPLA+D+DS  +++ SY+ +   + ++F+L    + F      ++L+L   +DRE+   Y+L + A D G P+L+G L + I +LD NDN P+FEN+ Y V VKES++    I  ++ATD+D GEN  + Y   S +       F +D  +G + +   LDYEK + Y   + AR+       + AT+ V+V++ ND  P I+++Y  +    ++ E  T       IV V D D G  G VQC L    +   +  N+     +KI+  + LD E  +     IVC D+G P L++     ++I D NDN P    PS +H  V EN   G +V K+ ATD+D  LNGK+ YSI    +L  SY +ID  TG IR+    DRE          LSV   D G P QS   ++ I I D+NDN P F    G  ++ F + EN      +G I   DPDE  + ++  +F+      SP    T   ++  + T + LDRE    +E  +   D  G      S +V V+V+D NDN P F+ P + + T  K+ Y    G LV    A DKD  P  N  L Y  I+ NS     + +F +D  NG+I + R +   D+G + + + V D G P   S     IKI
Sbjct:   69 GKLFAKRKIDRDSLCSEIELCCKSDIICSVSVSVAMTA---------AQPSSKLSDPIIGKFLIVIEDRNDHKPNFEYPIFNLSISESCPVSTTFQLPLAIDKDSDKYSVKSYKFISKSDLSIFSL---ETQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVFENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKLDSGM-------FRVDELSGSVYMISPLDYEKDQEYKLIITARNRIPGVNTATATLTVNVININDEKPVIFVDYFNNWQHASISEYETA-PAFVCIVTVKDKDIGIAGKVQCQLDNHHELFDLRQNS--PGQYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPSIFH--VSENKPPGTIVTKIDATDKDDGLNGKLTYSITDAQNLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQF----GQSTFRFSVTENEAPIYRLGQIEVSDPDETGSVRLGISFIKSNNRKSPF-SITSEKNRFWLMTTESLDREELDFYELVIIATDGAGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKL-YFSINSNS-----NNLFNIDPHNGEIRIHRQMGISDIGDHFIIIKVEDDGTPVLSSERQIQIKI 776          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 315.464 bits (807), Expect = 1.934e-89
Identity = 246/743 (33.11%), Postives = 365/743 (49.13%), Query Frame = 1
Query:  748 GDIRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYR-LENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPS-YHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSI---DSLSVSYFSIDPVTGTIRSKISFDREKR----ASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL------SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVID-KGILRQENSVSVTVSVIDENDNEPRFVIP-TNDSTSVKISYLDTAGTLVARIEAIDKDEGP--NSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI 2919
            G +  K+ IDR+SLC +I  CC S+  C   + V +           +      S   I    I I D ND+ P+F  P+  + ISES  +     LPLA+D+DS  +++ SY+ +   + ++F+L    + F      ++L+L   +DRE+   Y+L + A D G P+L+G L + I +LD NDN P+FEN+ Y V VKES++    I  ++ATD+D GEN  + Y   S +       F +D  +G + +   LDYEK + Y   + AR+       + AT+ V+V++ ND  P I+++Y  +    ++ E  T       IV V D D G  G VQC L    +   +  N+     +KI+  + LD E  +     IVC D+G P L++     ++I D NDN P    PS +H  V EN   G +V K+ ATD+D  LNGK+ YSI    +L  SY +ID  TG IR+    DRE          LSV   D G P QS   ++ I I D+NDN P F    G  ++ F + EN      +G I   DPDE  + ++  +F+      SP    T   ++  + T + LDRE    +E  +   D  G      S +V V+V+D NDN P F+ P + + T  K+ Y    G LV    A DKD  P  N  L Y  I+ NS     + +F +D  NG+I + R +   D+G + + + V D G P   S     IKI
Sbjct:   74 GKLFAKRKIDRDSLCSEIELCCKSDIICSVSVSVAMTA---------AQPSSKLSDPIIGKFLIVIEDRNDHKPNFEYPIFNLSISESCPVSTTFQLPLAIDKDSDKYSVKSYKFISKSDLSIFSL---ETQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVFENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKLDSGM-------FRVDELSGSVYMISPLDYEKDQEYKLIITARNRIPGVNTATATLTVNVININDEKPVIFVDYFNNWQHASISEYETA-PAFVCIVTVKDKDIGIAGKVQCQLDNHHELFDLRQNS--PGQYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPSIFH--VSENKPPGTIVTKIDATDKDDGLNGKLTYSITDAQNLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQF----GQSTFRFSVTENEAPIYRLGQIEVSDPDETGSVRLGISFIKSNNRKSPF-SITSEKNRFWLMTTESLDREELDFYELVIIATDGAGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKL-YFSINSNS-----NNLFNIDPHNGEIRIHRQMGISDIGDHFIIIKVEDDGTPVLSSERQIQIKI 781          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000022552.1 (SMESG000022552.1)

HSP 1 Score: 299.286 bits (765), Expect = 5.419e-84
Identity = 238/736 (32.34%), Postives = 360/736 (48.91%), Query Frame = 1
Query:  748 GDIRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFD----STINQIF--LKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYE----KVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSG-KRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKF-ILVPPNNREGST--WKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGK--INYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFL----SPVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKS 2895
            GD+R K  IDR+ LC     CC +      E ++  RV        +  S K +       I++ + DINDN+P F +  + I I ES  +G    LPLA D+D    +I  Y  E           + SNF     S  + I+  L+L++ +DRE+VS Y L L A D GKP   G   I + I D+NDN PI    + ++ + +S   G +I  +KATDKDSG N +++Y  S ++   ++K F IDSSTG + + + L+YE     V      +   DSG     S  TV + + D N+  P I + Y+ D+   + +I       +  + V V D D    G V C +KGS KF +++ P  R+     +KI   + LD EE+      IVC D+G P  TS+   +I++ D NDN P+F        + EN     VV  +  TD D +  G   +    +S    Y  +DP    I ++   DRE       ++ A D G P +  +A++++ I DQNDN P F        Y F +KEN     +I  I A+D DE  NGQV Y       +    F I  + G + T  +LDRE +A +EF V  +D G ++  +S +V V V D NDN P+F+ P+ ++ S   S  +T  T + ++ A D DEG N  + Y+II GN     ++ +F ++  +G ++L R L   D G Y + +   D G+P  +S
Sbjct:   74 GDLRTKVKIDRDILCSRKSLCCTAISTQSSECEINFRV--------FLQSRKTTIASKYFRIQVVVEDINDNAPKFPRASEQIMIPESATLGTIKYLPLATDDDIGKNSIQKYSFEK----------DTSNFRLVTVSIADIIYPRLELIENLDRESVSEYQLTLCAHDSGKPPRKGCTVIHVVIEDSNDNPPIIIQRSLVIKITQSIPPGKVIGTVKATDKDSGRNSILIYQIS-NLVPIIKKNFEIDSSTGEIKLLQKLNYETMGKSVNQILLPIDVMDSGLSPLTSTGTVTIYIQDMNNESPIITVTYIQDNNLNKPIINENRPSGQLIAFVHVIDTDQNENGQVDCTIKGSTKFRLILEPEQRDNQEKEFKIETTQPLDREEQANIEITIVCKDKGTPPKTSNKAVKIVVIDENDNYPVFYPNPVVIKILENLPVNSVVAMLNVTDADENPTGTLPVTCQFESNDNEYLKLDPDKCIIYTRQLIDREVTDKINTNIVAIDKGYPPKKTTAHIVVEIIDQNDNRPTF----SKKIYEFHVKENQDP-MVIAKIIAQDSDENYNGQVTYQLSFHDNAAHVAFGIDSNVGNLHTKIRLDREKRADYEFEVIAMDNGPIKLASSANVRVIVDDINDNTPKFIYPSQENQSHTYSIYNTKSTPLIKVTATDLDEGVNKDIIYEIIDGN-----RNGLFQLNPTSGQLYLARDLELGDAGTYFITIEAKDNGDPSLRS 780          

HSP 2 Score: 161.384 bits (407), Expect = 1.295e-39
Identity = 160/587 (27.26%), Postives = 262/587 (44.63%), Query Frame = 1
Query: 1255 SGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHI-DSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNR----EGSTWKINLVESLDYEE--RNVERFI--IVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQ-------TVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTG-------TIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYT--FLS-PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTA----GTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKIDN 2925
            S   +I++ + D NDN P F  ++  + + ES   G +  L  ATD D G+N +  Y F  D ++       I D     L + E LD E V  Y   + A DSG         + V + D NDNPP I    +     +++  G     K    V  +D DSG   ++   +       LVP   +    + ST +I L++ L+YE   ++V + +  I   D G   LTS+    I I+D+N+ SPI    +Y Q        + EN  +G ++  V   D D + NG+++ +I   +     ++P           I +    DRE++A+ ++++  +D G P ++ +  V I + D+NDN P F         + +I EN P N+++  ++  D DE   G +  T  F S   E   + PD+ II T Q +DRE       ++  IDKG   ++ +  + V +ID+NDN P F        S KI            ++A+I A D DE  N  + YQ+   +  D      F +D   G++  +  L R+    Y  +++  D G     S AN  + +D+
Sbjct:  122 SKYFRIQVVVEDINDNAPKFPRASEQIMIPESATLGTIKYLPLATDDDIGKNSIQKYSFEKDTSNFRLVTVSIADIIYPRLELIENLDRESVSEYQLTLCAHDSGKPPRKGCTVIHVVIEDSNDNPPIIIQRSLVIKITQSIPPG-----KVIGTVKATDKDSGRNSILIYQISN-----LVPIIKKNFEIDSSTGEIKLLQKLNYETMGKSVNQILLPIDVMDSGLSPLTSTGTVTIYIQDMNNESPIITV-TYIQDNNLNKPIINENRPSGQLIAFVHVIDTDQNENGQVDCTIKGSTKFRLILEPEQRDNQEKEFKIETTQPLDREEQANIEITIVCKDKGTPPKTSNKAVKIVVIDENDNYPVFY----PNPVVIKILENLPVNSVVAMLNVTDADENPTGTLPVTCQFESNDNEYLKLDPDKCIIYTRQLIDREVTDKINTNIVAIDKGYPPKKTTAHIVVEIIDQNDNRPTF--------SKKIYEFHVKENQDPMVIAKIIAQDSDENYNGQVTYQL---SFHDNAAHVAFGIDSNVGNLHTKIRLDREKRADYEFEVIAMDNGPIKLASSANVRVIVDD 682          

HSP 3 Score: 121.324 bits (303), Expect = 2.401e-27
Identity = 133/504 (26.39%), Postives = 218/504 (43.25%), Query Frame = 1
Query: 1540 FNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDL-KGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSV---SYFSIDPVTGTIR--SKISFDREKRASYQ--LSVFARDLGEPAQSGSANVLITITDQNDNTP-----YFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVE-KFTIHPDQG-------IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSAQRSQTLNNMKYNQNQ 2976
            F V  +   T  A     ++V V D NDN PK        + ++ +I    T+     + + +D D G   + +    K +  F LV  +  +    ++ L+E+LD E  +  +  +  HD G+P         ++I D NDN PI    S    + ++   G V+  V ATD+DS  N  + Y I +L       F ID  TG I+   K++++   ++  Q  L +   D G    + +  V I I D N+ +P     Y Q  N     I    EN PS  +I  +H  D D+  NGQV  T     + +  + P+Q         I T Q LDRE +A  E ++   DKG   + ++ +V + VIDENDN P F     +   +KI       ++VA +   D DE P   L          +   ++   +D     I+ ++ + R+        ++  D+G PP+K+ A+ V++I    DN    S+ +      +NQ
Sbjct:  109 FRVFLQSRKTTIASKYFRIQVVVEDINDNAPKF-----PRASEQIMIPESATLGTIKYLPLATDDDIGKNSIQKYSFEKDTSNFRLVTVSIADIIYPRLELIENLDRESVSEYQLTLCAHDSGKPPRKGCTVIHVVIEDSNDNPPIIIQRSLVIKITQSIPPGKVIGTVKATDKDSGRNSILIYQISNLVPIIKKNFEIDSSTGEIKLLQKLNYETMGKSVNQILLPIDVMDSGLSPLTSTGTVTIYIQDMNNESPIITVTYIQDNNLNKPII---NENRPSGQLIAFVHVIDTDQNENGQVDCTIKGSTKFRLILEPEQRDNQEKEFKIETTQPLDREEQANIEITIVCKDKGTPPKTSNKAVKIVVIDENDNYPVFY---PNPVVIKILENLPVNSVVAMLNVTDADENPTGTLPVTC----QFESNDNEYLKLDPDKCIIYTRQLIDREVTDKINTNIVAIDKGYPPKKTTAHIVVEIIDQNDNRPTFSKKIYEFHVKENQ 597          

HSP 4 Score: 111.694 bits (278), Expect = 2.395e-24
Identity = 103/406 (25.37%), Postives = 176/406 (43.35%), Query Frame = 1
Query: 1114 FTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPP----KIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYH---QTVEENNQAGIVVLKVVATDRDSDLNGKINYSI-DSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGG 2307
            F LI E    D+   +  ++  QP+DRE  +   + ++  DKG P  +    ++I ++D NDN P+F  +  ++ + E+     ++ +L  TD D    G +    +    S   +   +D     +   + +D E       N++A D G     + A + V ++D NDN P    KIY  +V ++      + P  I K    +I  D D    G V   L        V     + +   ++    LD E+R    F ++  D G  +L SS    +I+ DINDN+P F +PS      T    N     ++KV ATD D  +N  I Y I D      F ++P +G +      +     +Y +++ A+D G+P+   +  + +T   Q+   P +  LN G
Sbjct:  412 FRLILEPEQRDNQEKEFKIETTQPLDREEQANIEITIVCKDKGTPPKTSNKAVKIVVIDENDNYPVFYPNPVVIKILENLPVNSVVAMLNVTDADENPTGTLP--VTCQFESNDNEYLKLDPDKCIIYTRQLIDREVTDKINTNIVAIDKGYPPKKTTAHIVVEIIDQNDNRPTFSKKIYEFHVKEN------QDPMVIAK----IIAQDSDENYNGQVTYQLSFHDNAAHVA-FGIDSNVGNLHTKIRLDREKRADYEFEVIAMDNGPIKLASSANVRVIVDDINDNTPKFIYPSQENQSHTYSIYNTKSTPLIKVTATDLDEGVNKDIIYEIIDGNRNGLFQLNPTSGQLYLARDLELGDAGTYFITIEAKDNGDPSLRSNGVLRLTFDSQSKVIPLYNVLNEG 804          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000074162.1 (SMESG000074162.1)

HSP 1 Score: 297.745 bits (761), Expect = 3.317e-83
Identity = 235/759 (30.96%), Postives = 369/759 (48.62%), Query Frame = 1
Query:  748 GDIRVKKPIDRESLCGDIGKCCDSEP-FCFFELKVLVRVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL--ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE--YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK--GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHXXXXXXRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-------------PVEK-------------FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTR-QDMGVYILKMMVSDQGNPPRKSYANYVIKID 2922
            G I +++ IDR++LC  +  CC  +   C  +L +                +       I  + I++ DINDNSP +SQ     + SE  +IG    L +A+D D     I  Y +  E  E  L  +I   +   S   Q+ L L + +DRE +  Y   + A D G PS +G +K+ + + D NDN P+FE + YI++V E+  S   ++ LKA D DS  NG + Y  SS    E  K F I+S++G++ +   LDYE     +  V A D G     S  TV +++ D NDN P+IY E    T++ K T  E P    K  ++  V D DS   G V C L+   +++F L   N      +KI+ ++S D E+++     IVC D G P+ T+S    + + DIND +P F   SY   V E+ + G  +  + ATD+D  +N  ++YSI       FSI  + G +  +   DRE   S   ++ A D G P Q  +ANV + + D NDN P+        S    + EN  ++  +  ++  D DEG+N +   T +S             P++K             F++ PD  +I     LDRE    +E  +   D+G   +     + ++V+D ND +P+F+ P+  +++VK+     +GT +A+I AID+DEG NS L+Y   S N   QT D +F M+ ++G I LQ+ +     +  Y+L ++V D G P  +  A   I I+
Sbjct:  105 GVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTI----------------KSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQLKLVLKKKLDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAP---GKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSISKLDGKVFLETDLDRESVESLHFTIRAADSGYPKQLSTANVTVIVKDINDNYPFLP-----KSIYLYVFENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDRELTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNN---QTND-LFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIE 835          

HSP 2 Score: 65.855 bits (159), Expect = 2.921e-10
Identity = 85/326 (26.07%), Postives = 136/326 (41.72%), Query Frame = 1
Query: 2113 YFSIDPVTGTIRSKISFDREKRASYQLSVFAR-------DLGEPAQSGSANVL---ITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQGIIRTNQQL---------------DRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRF-----VIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQGNPPRKSYANYVIKI----DNSA----QRSQTLNNMKYNQNQ 2976
            YF I+P+ G I  +   DR+       +   +       DL   +    ++++   I + D NDN+P++   N   +   E  E G S ++   +   D D G NG   Y+    + +F +     II TN  +               DRE    +EF V   D G      S+ V V+V DENDN P F     +I  N++          + T V +++AID D   N  ++YQI S    +    K+F ++  +G I ++  L  +      L +  +D GN  R S    +I I    DNS     + S+  NN K  +N+
Sbjct:   97 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQ-NELVTQFSEGSEIGDSKSLTVAL---DNDFGTNGISYYSISPEITEFEL---SYIINTNTMMYSNKEQLKLVLKKKLDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQ--------SNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA--KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENE 405          
The following BLAST results are available for this feature:
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH13.806e-9332.93protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH13.384e-9233.33protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH92.779e-9130.89protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11Y3.592e-9031.77protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y3.594e-9031.77protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.640e-5828.83FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.083e-5230.03FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-45.709e-4527.94Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-11.808e-4327.12CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-33.101e-3226.84Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.720e-7131.32gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.720e-7131.32gene:FBgn0284247 transcript:FBtr0343249[more]
ft4.231e-6628.65gene:FBgn0001075 transcript:FBtr0077478[more]
kug2.808e-6030.34gene:FBgn0261574 transcript:FBtr0332722[more]
kug2.854e-6030.34gene:FBgn0261574 transcript:FBtr0346077[more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a3.030e-10134.27protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a3.344e-10034.27protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
CT030123.11.245e-9233.96protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.11.456e-9233.96protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.676e-9233.96protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh171.762e-9533.42protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.974e-9533.42protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.292e-9433.42protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.492e-9433.42protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh175.404e-9433.29protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11.571e-9233.08protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.777e-9233.08protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.777e-9233.08protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh92.752e-9230.89protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh95.976e-9030.89protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6KEQ9|PC11X_PIG3.047e-9332.25Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q08174|PCDH1_HUMAN1.828e-9232.93Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9HC56|PCDH9_HUMAN3.408e-8930.89Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q71M42|PC11X_PANTR3.348e-8831.77Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA4.088e-8831.77Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PLW99.341e-10033.68Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A210QG071.340e-9836.21Protocadherin-11 X-linked OS=Mizuhopecten yessoens... [more]
A0A3N0Z7N33.682e-9834.14Protocadherin-1 OS=Anabarilius grahami OX=495550 G... [more]
E7F7436.780e-9834.27Protocadherin 1a OS=Danio rerio OX=7955 GN=pcdh1a ... [more]
K1Q4541.094e-9733.70Protocadherin-9 OS=Crassostrea gigas OX=29159 GN=C... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a2.818e-9933.87protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.006e-9733.87protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b6.456e-9433.15protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh113.288e-9332.77protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.393e-9232.72protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.13.030e-9032.31pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh116.898e-8330.28protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.14.506e-7030.24protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.12.179e-6429.85pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004043.11.843e-5827.92pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354124.344e-7532.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461896.333e-7432.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404703.576e-6932.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303644.480e-6431.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417672.698e-6331.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a6.327e-9432.97protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a3.993e-9232.97protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1b5.541e-9134.80protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b8.192e-9034.80protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh94.674e-8931.53protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
back to top
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076665.10.000e+0100.00SMESG000076665.1[more]
SMESG000059376.11.725e-8933.11SMESG000059376.1[more]
SMESG000059376.11.934e-8933.11SMESG000059376.1[more]
SMESG000022552.15.419e-8432.34SMESG000022552.1[more]
SMESG000074162.13.317e-8330.96SMESG000074162.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024206 ID=SMED30024206|Name=Protocadherin-11 X-linked|organism=Schmidtea mediterranea sexual|type=transcript|length=4637bp
ATTCTAAGTTGTTTATACAGCAACAGTAGTTGTTGTTGTTTATGTGACGT
CTTTGTTTGAATTGATAAGTTAAATTGATGGATTGGTTAAATTAAAAAAA
TGTGTAAAAATATATTTGTTGGCCAATTTGGACTGTCTATTTGTAACCAA
ACCTTTCATTGTCCTTTCTTCAATTAGTAGTAATTTGACGTTTTTACAGT
TAATTTCTCAATACGCAAGCAATCCAAAAGGTTTTAAACATCAAAGTCCC
ATCTGGTTTTGAAAAGGTTTTGAAGTTATAAATAATAACTCAGATTCTCA
AGATTCATTAACCAGATTACTTTCGGATCAGTCAAAAAATATTTCAACAA
AAAGCCAAAATTAATGATTATAATTCAATACTCAAAAAAAGGAAAAATCT
CGTATTTCCATTGACAATTTCACAGCTGAAATCTGATTGGTTGAATTTCA
AAGTAATGATTCAATTGGCGTAAAATCTCAATAAATGAAAGTCTGAGCGT
TGAGTTTGAATGCCAATTAAAAGAAGAAAGTATTGTTGGAACTGTTCTCA
CTGATATCCTTAATGGTAGGCCTTGCAATATTTTACAGAAACGGTCTCTC
TCATTCAATACAATTCAAATTTTAATGAACAAAATCACTGTGAAAATTTT
GCCAATTCAAGAAAATCGAATCAGTAATTATTTCGAAATAATCAACAATG
ACGATTTGAAATATTCTTTGAACAGCAAAAACGACCATTTACGGATTGGA
GATATACGAGTGAAAAAGCCGATTGATCGAGAATCTCTCTGTGGAGATAT
TGGGAAATGTTGTGATTCAGAACCGTTTTGTTTCTTTGAACTGAAAGTGC
TAGTTCGAGTTCCATCTATCAATAGCAAAATATCCTACAGTAGCTCAGAA
AAGATCAGTTCAACTATGACAATTGAAACAATTCGTATTAAAATCATCGA
CATCAATGACAATTCACCACACTTTTCACAGCCGGTTAAAACAATTGAAA
TTTCAGAATCCATACAAATAGGTGCTAAAATTCCTTTACCTTTAGCTGTT
GATGAGGACTCAAAAAATTTCAATATTATCAGTTATCGCCTAGAAAATCA
TGAACATGCTCTATTTACATTGATCCCAGAATGGTCAAACTTTGATTCAA
CGATTAATCAAATATTTTTGAAACTTTTGCAGCCCATCGACAGAGAGAAT
GTTTCCATGTATAATCTCAATCTCATTGCAACAGATAAAGGAAAACCTTC
TCTTTCGGGGAAATTGAAAATCGAAATAAAAATTCTTGATGCCAATGATA
ATCAACCAATTTTCGAAAATTCTACTTACATAGTCAATGTCAAAGAATCA
GAAATCTCTGGTCATTTAATTCTCTTACTCAAAGCAACTGATAAAGATTC
TGGAGAAAACGGACTCGTCATGTATTATTTCTCCTCAGACGTTACTTCCG
AAGTACGGAAGAAGTTTCATATTGATTCTTCAACCGGTTGGCTTTCAATT
TCTGAAACTCTGGATTATGAAAAAGTCAAATATTACACTTTTAATGTCAT
TGCAAGAGATTCTGGAACCGACGCAGCATTTTCAAAAGCAACAGTAAAGG
TTTCAGTGGTTGATTGCAATGATAATCCACCCAAGATCTATCTTGAATAT
GTTACAGATTCCGGAAAACGTACCTTAATTGAAGGTCCCACAACAATAAA
TAAAGAATATTCAATAGTTATTGTAAGCGATCCGGATTCTGGTAATGGAG
GGTTGGTACAATGTGATCTGAAAGGGTCGCAAAAGTTTATTTTAGTTCCT
CCTAATAATAGAGAAGGATCTACGTGGAAAATTAATTTGGTCGAATCTTT
AGATTATGAAGAAAGGAATGTTGAGAGATTCATAATTGTTTGTCATGATC
GAGGTGAACCTCAGTTAACTTCGAGTCATGAAGAAGAAATTATAATTCGG
GATATCAATGACAATTCTCCAATTTTTGAACATCCTTCATATCATCAAAC
AGTGGAAGAAAACAACCAAGCTGGGATAGTTGTATTAAAGGTAGTGGCTA
CCGATAGGGACAGTGATTTGAATGGGAAAATTAATTATTCAATAGATTCT
TTAAGCGTTTCATATTTTTCCATTGATCCCGTTACAGGAACGATTCGATC
AAAGATTTCATTTGATAGAGAAAAACGTGCGTCCTACCAATTATCAGTCT
TTGCTCGGGACTTAGGAGAACCTGCACAATCTGGATCGGCAAATGTTTTA
ATTACTATAACCGATCAAAATGATAACACTCCTTATTTCCAAGGATTAAA
TGGTGGAGGATCTTACATTTTCGAAATTAAAGAAAACGGACCAAGCAATG
CCATTATTGGAACAATTCACGCAGAAGATCCAGATGAAGGTATTAATGGG
CAAGTTCTTTATACCTTTCTTTCACCAGTAGAAAAGTTCACCATTCATCC
TGATCAAGGTATTATTAGAACGAATCAACAATTAGACAGAGAAAATAAAG
CTGTTCATGAGTTCTCAGTAAGAGTTATAGATAAAGGCATTTTACGACAA
GAAAATAGTGTTTCAGTTACAGTGAGCGTGATAGATGAAAATGACAACGA
ACCAAGATTTGTCATACCAACTAATGACAGCACTTCTGTAAAGATATCAT
ATCTAGATACCGCAGGAACATTGGTGGCAAGGATAGAAGCTATTGACAAA
GACGAAGGTCCTAATAGCCATTTAGACTATCAAATAATATCTGGAAATAG
TCGAGATCAAACTCAAGACAAAATATTTTTTATGGATCAAAAGAATGGCG
ATATATTTCTTCAGAGAGCTTTAACAAGACAGGACATGGGAGTATACATA
TTAAAGATGATGGTCTCAGATCAAGGAAATCCTCCTCGAAAGTCCTATGC
AAATTATGTTATAAAAATCGACAACAGTGCCCAGCGTTCACAAACATTAA
ACAATATGAAGTATAACCAAAATCAGCATGCCACCTATTCAGATCGTTCA
AGGGATGATTCTTTAAGTACCAGTGTTATTCTTATTGTCAGCATAGCACT
CATCTGTATCATTGTACTTGTACTTTTAACATTAGCGGTTTTTCTCTGTG
GAAAACGAGGTCAAGAAGAATTGAATGAAATACTTTTTAAAAATAGCGAC
AGAGGAGAAACTTCAGCAAATCTACATTTTTGTTTTTGTCTTTCAAAATC
GAGAAATCCCCGAAAGCCGCGATCTGATTCACATAGATTTTCGGAAATGC
TTTATAACAATTATTCAGTTTTGCCGAAAACTTTCAAAGCTGCAAGTGAC
ATTGATGATAGTGGATTTAGAAAAGAAAACAATTTCGGAACTTTAATTCA
TAAAGACCGAGGAAACTCAACTGGGTCCTTAATGATTGAAAAAAACTCTC
AAACCAAGCCTACTGAATGTCAGTCCTATCAGATGGCAAATTTTCGAAAA
GAATTCAATCCTGAATTTAACTTAGAATCCAGATACATTTCATTCCAAGG
AACAACGGATTCCAGAACGGTCGACGAGTATACAACTCTAGTAAATAATA
AAATCAATCAAGCTAACTATCAAAAACTACAAAGAAAATTAGAAAATGAA
AATAGAAAATCTCCATCTACAAAATATGGAAATTCATCAATTGATCCGAT
AGTTTACATTCGTTGCAGCAGCACCCCCGGTAACAATGACACCATCAGTG
ACTCAGAAAAGCCTACTAAGCCTGGTCCTGCAACACAAGAATCCCTTTCG
CCTTTATTCAGAAACTTTCAAAGTGGTGATCTTTTATACCCTTTTACAAA
TTGTTCAAAATCAAAAACATTATCTTCAAGAACCCAACAGAAGAATCGAC
ACGCTAAACAACTAAAATCCCATTTTCGTTACCCAAGTGTTCCAGAAAGT
TTAAACTATCTCTCGGTCGGCAGCAATTCTGGTATTGATATTCACGAAAA
TCCAAGTCGACTGATTACTTGGGAATTCGGAAAAAAAATCAAATCTACCC
CCCTGCACAAAGGAAGCTTTGTGTAGATATGTCCAGTGGCTAGTCAACCA
TAATAACATTATATCCATTTGAAACTGTGATAATAGAATCTATTGTTTTC
TGTTGCAGTCATTGTATTATAATGTCGATTGTTGTCAAGTGAAATATATT
ATATATAAAAGGACTTCGTAAGTCACTGCTAATTTTCTTTGGAGATTTCT
TTTTGATGATATCCGTTTATGATCAATCATTTTCCCTCTTGCAGAAACGT
AAGAGCAAGTTTGATTTCATCGAATCTTTCCTAAAACGTGCCCTCATTCT
TCACGGAATTTTATTATGAACGTCTTTGTTTTATTAATGATAGATGAAGC
GGAAATTGAAATCCATAATCAACGAAATTCATTTGCATTTGAAGAGAAAC
TCAACTCAGGAGAATTTAAATTATTATTGTTTTATTTACTATTATTTTCT
GATTTGATTTTCAATGCATCCACAGACTTATGTAAGAATAGTTTCTCTTC
AATTTGTTGCAGGAAGAAAAGAAATTTACAAGTGACATTTGCGCCTAAAA
TTTTCATTTAAAACTTTGGCACTCTGTTTAGGTTTATTCTGTTTGCAGTT
TGATATTTTGATGATTACTTTATCATAGTAATGTACC
back to top

protein sequence of SMED30024206-orf-1

>SMED30024206-orf-1 ID=SMED30024206-orf-1|Name=SMED30024206-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1134bp
MNKITVKILPIQENRISNYFEIINNDDLKYSLNSKNDHLRIGDIRVKKPI
DRESLCGDIGKCCDSEPFCFFELKVLVRVPSINSKISYSSSEKISSTMTI
ETIRIKIIDINDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFN
IISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNL
IATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLIL
LLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEK
VKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLEYVTDSGKRT
LIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGST
WKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHEEEIIIRDINDNSPI
FEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSI
DPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQND
NTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS
PVEKFTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTV
SVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHL
DYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYILKMMVSDQ
GNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQHATYSDRSRDDSLSTS
VILIVSIALICIIVLVLLTLAVFLCGKRGQEELNEILFKNSDRGETSANL
HFCFCLSKSRNPRKPRSDSHRFSEMLYNNYSVLPKTFKAASDIDDSGFRK
ENNFGTLIHKDRGNSTGSLMIEKNSQTKPTECQSYQMANFRKEFNPEFNL
ESRYISFQGTTDSRTVDEYTTLVNNKINQANYQKLQRKLENENRKSPSTK
YGNSSIDPIVYIRCSSTPGNNDTISDSEKPTKPGPATQESLSPLFRNFQS
GDLLYPFTNCSKSKTLSSRTQQKNRHAKQLKSHFRYPSVPESLNYLSVGS
NSGIDIHENPSRLITWEFGKKIKSTPLHKGSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
GO:0010923negative regulation of phosphatase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 975..995
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 553..659
e-value: 1.5E-26
score: 95.1
coord: 660..772
e-value: 3.8E-22
score: 80.9
coord: 116..225
e-value: 2.7E-23
score: 84.6
coord: 447..552
e-value: 2.8E-33
score: 116.8
coord: 226..335
e-value: 1.2E-31
score: 111.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 336..446
e-value: 5.7E-15
score: 57.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 3..115
e-value: 1.2E-7
score: 34.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1018..1039
NoneNo IPR availablePANTHERPTHR24026:SF51PROTOCADHERIN-LIKE WING POLARITY PROTEIN STANcoord: 602..754
coord: 184..451
coord: 24..164
NoneNo IPR availablePANTHERPTHR24026:SF51PROTOCADHERIN-LIKE WING POLARITY PROTEIN STANcoord: 400..598
NoneNo IPR availablePANTHERPTHR24026FAMILY NOT NAMEDcoord: 184..451
NoneNo IPR availablePANTHERPTHR24026FAMILY NOT NAMEDcoord: 602..754
coord: 400..598
NoneNo IPR availablePANTHERPTHR24026:SF51PROTOCADHERIN-LIKE WING POLARITY PROTEIN STANcoord: 449..709
NoneNo IPR availablePANTHERPTHR24026FAMILY NOT NAMEDcoord: 449..709
coord: 24..164
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 666..775
score: 17.74
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 231..338
score: 26.246
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 452..555
score: 27.869
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 560..662
score: 24.778
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 365..451
score: 13.246
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 118..230
score: 21.226
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 20..117
score: 11.712
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 563..658
e-value: 3.32313E-30
score: 113.177
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 365..447
e-value: 6.95039E-11
score: 58.0938
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 24..113
e-value: 2.10319E-5
score: 42.3006
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 234..334
e-value: 5.95009E-29
score: 109.325
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 123..226
e-value: 5.62761E-19
score: 80.8205
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 681..765
e-value: 2.73019E-17
score: 76.1981
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 455..551
e-value: 2.39001E-31
score: 116.259
NoneNo IPR availableTMHMMTMhelixcoord: 802..824
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 644..661
score: 42.79
coord: 451..480
score: 36.98
coord: 610..636
score: 26.76
coord: 534..553
score: 41.49
coord: 520..532
score: 40.11
coord: 279..298
score: 27.8
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 252..336
e-value: 3.2E-27
score: 106.4
coord: 687..769
e-value: 5.8E-9
score: 45.8
coord: 581..660
e-value: 4.6E-25
score: 99.3
coord: 139..228
e-value: 1.9E-13
score: 60.7
coord: 365..449
e-value: 2.8E-10
score: 50.1
coord: 473..553
e-value: 4.9E-29
score: 112.5
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 456..546
e-value: 3.9E-19
score: 68.9
coord: 123..221
e-value: 2.1E-9
score: 37.7
coord: 236..328
e-value: 1.5E-17
score: 63.8
coord: 680..765
e-value: 2.1E-15
score: 57.0
coord: 564..652
e-value: 2.5E-16
score: 59.9
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 650..660
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 439..449
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 218..228
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 326..336
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 543..553
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 105..115
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 332..443
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 543..665
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 218..343
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 650..772
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 439..556
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 110..222