Tubulin polymerization-promoting protein

Overview
NameTubulin polymerization-promoting protein
Smed IDSMED30024199
Length (bp)910
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30024199SMESG000026839.1 Contig4987_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Human
Match: TPPP3 (tubulin polymerization promoting protein family member 3 [Source:HGNC Symbol;Acc:HGNC:24162])

HSP 1 Score: 79.337 bits (194), Expect = 2.800e-17
Identity = 63/176 (35.80%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  273 MDDLKNSFASFC--DTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            M  L+ SF  F      K        K   K+C DCK+   K       DI F K  G + + I++ +F + +E    + +         DA+ +L   VA   P+  G T      A  RLTD   YTG+HKERFD E+G+GKGI GR+ I   +   GYV  YK A TYD K K
Sbjct:    7 MAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQL---VAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDDS---GYVSAYKNAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Human
Match: TPPP3 (tubulin polymerization promoting protein family member 3 [Source:HGNC Symbol;Acc:HGNC:24162])

HSP 1 Score: 79.337 bits (194), Expect = 2.800e-17
Identity = 63/176 (35.80%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  273 MDDLKNSFASFC--DTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            M  L+ SF  F      K        K   K+C DCK+   K       DI F K  G + + I++ +F + +E    + +         DA+ +L   VA   P+  G T      A  RLTD   YTG+HKERFD E+G+GKGI GR+ I   +   GYV  YK A TYD K K
Sbjct:    7 MAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQL---VAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDDS---GYVSAYKNAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Human
Match: TPPP3 (tubulin polymerization promoting protein family member 3 [Source:HGNC Symbol;Acc:HGNC:24162])

HSP 1 Score: 79.337 bits (194), Expect = 2.800e-17
Identity = 63/176 (35.80%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  273 MDDLKNSFASFC--DTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            M  L+ SF  F      K        K   K+C DCK+   K       DI F K  G + + I++ +F + +E    + +         DA+ +L   VA   P+  G T      A  RLTD   YTG+HKERFD E+G+GKGI GR+ I   +   GYV  YK A TYD K K
Sbjct:    7 MAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQL---VAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDDS---GYVSAYKNAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Human
Match: TPPP3 (tubulin polymerization promoting protein family member 3 [Source:HGNC Symbol;Acc:HGNC:24162])

HSP 1 Score: 79.337 bits (194), Expect = 2.800e-17
Identity = 63/176 (35.80%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  273 MDDLKNSFASFC--DTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            M  L+ SF  F      K        K   K+C DCK+   K       DI F K  G + + I++ +F + +E    + +         DA+ +L   VA   P+  G T      A  RLTD   YTG+HKERFD E+G+GKGI GR+ I   +   GYV  YK A TYD K K
Sbjct:    7 MAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQL---VAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDDS---GYVSAYKNAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Human
Match: TPPP2 (tubulin polymerization promoting protein family member 2 [Source:HGNC Symbol;Acc:HGNC:19293])

HSP 1 Score: 72.7886 bits (177), Expect = 6.101e-15
Identity = 61/168 (36.31%), Postives = 82/168 (48.81%), Query Frame = 3
Query:  294 FASFCDTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQG-NPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            FA+F ++   G T   +K   K+C DC I   K       DI F K      + I F  F   ++  + +     ++    D V E    + +G +P+  G T  +   A  RLTD   YTG HKERFD E+G+GKGI GRE +       GYV GYKG+ TYD K K
Sbjct:   12 FAAFGESSSSG-TEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVK-ELGQKRFKGKS---PDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFD-ESGKGKGIAGREEMTDNT---GYVSGYKGSGTYDKKTK 170          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Celegans
Match: tppp-1 (Tubulin polymerization-promoting protein homolog [Source:UniProtKB/Swiss-Prot;Acc:P91127])

HSP 1 Score: 52.373 bits (124), Expect = 4.564e-8
Identity = 54/169 (31.95%), Postives = 75/169 (44.38%), Query Frame = 3
Query:  279 DLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGN-PSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYD 779
            D+K  + +F       +T  T K   K   D  +   K        I F K  G  +K   F++  + +   +AE          +D +  +  K+A+   PS  G    +A    +RLTD   YTGAHKERFD E G+GKG  GR   A      GYVG YK  ++YD
Sbjct:   13 DVKKRWDAFTKFGAATATEMTGKNFDKWLKDAGVLDNKAITGTMTGIAFSKVTG-PKKKATFDETKKVL-AFVAEDRARQSKKPIQDELDAITEKLAKLEAPSVGGAAKANAAGVYSRLTDHTKYTGAHKERFDAE-GKGKGKSGR---ADTTENTGYVGAYKNKDSYD 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Fly
Match: ringer (gene:FBgn0266417 transcript:FBtr0344399)

HSP 1 Score: 63.5438 bits (153), Expect = 9.988e-12
Identity = 57/168 (33.93%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  291 SFASFCDTVKKG---STTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQ-GNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDN 782
            +F+ F D+   G   + + +DK +K+     K+  K        I F+K    A K I  +D+ +F++         A+    E  + E+K K+A  G P     +   A AA  RLTD   YTG+HKERFD  +G+GKGI GR  +   +   GYV GY+  +TYDN
Sbjct:   43 AFSKFGDSKSDGKLITLSQSDKWMKQ----AKVIDKKITTTDTGIHFKKF--KAMK-ISLSDYNKFLDD-------LAKTKKVE--LSEIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFD-ASGKGKGIAGRRNVVDGS---GYVSGYQHKDTYDN 190          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Fly
Match: ringer (gene:FBgn0266417 transcript:FBtr0344401)

HSP 1 Score: 63.5438 bits (153), Expect = 9.988e-12
Identity = 57/168 (33.93%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  291 SFASFCDTVKKG---STTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQ-GNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDN 782
            +F+ F D+   G   + + +DK +K+     K+  K        I F+K    A K I  +D+ +F++         A+    E  + E+K K+A  G P     +   A AA  RLTD   YTG+HKERFD  +G+GKGI GR  +   +   GYV GY+  +TYDN
Sbjct:   43 AFSKFGDSKSDGKLITLSQSDKWMKQ----AKVIDKKITTTDTGIHFKKF--KAMK-ISLSDYNKFLDD-------LAKTKKVE--LSEIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFD-ASGKGKGIAGRRNVVDGS---GYVSGYQHKDTYDN 190          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Fly
Match: ringer (gene:FBgn0266417 transcript:FBtr0344398)

HSP 1 Score: 63.5438 bits (153), Expect = 9.988e-12
Identity = 57/168 (33.93%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  291 SFASFCDTVKKG---STTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQ-GNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDN 782
            +F+ F D+   G   + + +DK +K+     K+  K        I F+K    A K I  +D+ +F++         A+    E  + E+K K+A  G P     +   A AA  RLTD   YTG+HKERFD  +G+GKGI GR  +   +   GYV GY+  +TYDN
Sbjct:   43 AFSKFGDSKSDGKLITLSQSDKWMKQ----AKVIDKKITTTDTGIHFKKF--KAMK-ISLSDYNKFLDD-------LAKTKKVE--LSEIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFD-ASGKGKGIAGRRNVVDGS---GYVSGYQHKDTYDN 190          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Fly
Match: ringer (gene:FBgn0266417 transcript:FBtr0344400)

HSP 1 Score: 63.5438 bits (153), Expect = 9.988e-12
Identity = 57/168 (33.93%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  291 SFASFCDTVKKG---STTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQ-GNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDN 782
            +F+ F D+   G   + + +DK +K+     K+  K        I F+K    A K I  +D+ +F++         A+    E  + E+K K+A  G P     +   A AA  RLTD   YTG+HKERFD  +G+GKGI GR  +   +   GYV GY+  +TYDN
Sbjct:   43 AFSKFGDSKSDGKLITLSQSDKWMKQ----AKVIDKKITTTDTGIHFKKF--KAMK-ISLSDYNKFLDD-------LAKTKKVE--LSEIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFD-ASGKGKGIAGRRNVVDGS---GYVSGYQHKDTYDN 190          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Zebrafish
Match: tppp2 (tubulin polymerization-promoting protein family member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-24])

HSP 1 Score: 79.7221 bits (195), Expect = 1.309e-17
Identity = 57/150 (38.00%), Postives = 79/150 (52.67%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            K   K+C DCK+   K       DI F K    + + I F  F + + G +A      ++   E+AV+ L   +A   P+  G T V+  +A  RLTD   YTG+HKERFD E+G+GKG +GR  I   +   GYV  YKG  +YD+K K
Sbjct:   36 KNFVKLCKDCKVIDGKNVTSTDVDIIFSKVKVKSARVITFEQFTQAM-GELATKRFKGKS--QEEAVQLLYGLIAGKEPTNIGVTKVAKASAVDRLTDTSKYTGSHKERFD-ESGKGKGREGRADIPDTS---GYVSAYKGQGSYDSKVK 178          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Zebrafish
Match: tppp2 (tubulin polymerization-promoting protein family member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-24])

HSP 1 Score: 79.7221 bits (195), Expect = 1.364e-17
Identity = 57/150 (38.00%), Postives = 79/150 (52.67%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            K   K+C DCK+   K       DI F K    + + I F  F + + G +A      ++   E+AV+ L   +A   P+  G T V+  +A  RLTD   YTG+HKERFD E+G+GKG +GR  I   +   GYV  YKG  +YD+K K
Sbjct:   36 KNFVKLCKDCKVIDGKNVTSTDVDIIFSKVKVKSARIITFEQFTQAM-GELATKRFKGKS--QEEAVQLLYGLIAGKEPTNIGVTKVAKASAVDRLTDTSKYTGSHKERFD-ESGKGKGREGRADIPDTS---GYVSAYKGQGSYDSKVK 178          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Zebrafish
Match: tppp3 (tubulin polymerization-promoting protein family member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1909])

HSP 1 Score: 79.337 bits (194), Expect = 1.766e-17
Identity = 67/179 (37.43%), Postives = 86/179 (48.04%), Query Frame = 3
Query:  273 MDDLKNSFASFCDTVKKGSTTCTDKTLK-----KICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            MD L NSF  F      G T  T K L      K+C DCK+   K       DI F K      + I + +F + +E    + +   +    E+A++ +   +    P+  G T V+  AA  RLTD   YTG+HKERFD ETG+GKG  GRE I       GYVG YK A  YD K K
Sbjct:    7 MDQLLNSFKKFA---VHGDTKATGKELNGKNWAKLCKDCKVIDGKNVTSTDVDIVFTKVKAKTSRVITYEEFQKALEELAPKRF---KGQSKEEALESIYKLIEGKEPTNIGVTKVAKTAAVDRLTDTSKYTGSHKERFD-ETGKGKGKGGREEIV---EHTGYVGAYKNAGKYDEKTK 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Zebrafish
Match: tppp3 (tubulin polymerization-promoting protein family member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1909])

HSP 1 Score: 79.337 bits (194), Expect = 1.766e-17
Identity = 67/179 (37.43%), Postives = 86/179 (48.04%), Query Frame = 3
Query:  273 MDDLKNSFASFCDTVKKGSTTCTDKTLK-----KICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            MD L NSF  F      G T  T K L      K+C DCK+   K       DI F K      + I + +F + +E    + +   +    E+A++ +   +    P+  G T V+  AA  RLTD   YTG+HKERFD ETG+GKG  GRE I       GYVG YK A  YD K K
Sbjct:    7 MDQLLNSFKKFA---VHGDTKATGKELNGKNWAKLCKDCKVIDGKNVTSTDVDIVFTKVKAKTSRVITYEEFQKALEELAPKRF---KGQSKEEALESIYKLIEGKEPTNIGVTKVAKTAAVDRLTDTSKYTGSHKERFD-ETGKGKGKGGREEIV---EHTGYVGAYKNAGKYDEKTK 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Zebrafish
Match: TPPP (tubulin polymerization-promoting protein [Source:NCBI gene;Acc:100333482])

HSP 1 Score: 63.929 bits (154), Expect = 3.431e-12
Identity = 51/145 (35.17%), Postives = 69/145 (47.59%), Query Frame = 3
Query:  360 ICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAE-AYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            I T+    C GF      I     I +AR  I ++ F       +AE A    +    EDA +E+   +   +P   G T   A    +RLTD   +TG+HKERFD ETG+GKG  GR     +    GYV GYK A +Y+ K +
Sbjct:    5 ILTNLSAACLGF------ISLFSRIKSAR-TITYSQF----REALAELARKRFKEKSSEDAAEEVYKMIEGKSPVIAGVTRAVASPTVSRLTDTSKFTGSHKERFD-ETGRGKGKAGR---VEQLDTSGYVSGYKHAGSYEKKTQ 134          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Xenopus
Match: rabep1 (rabaptin, RAB GTPase binding effector protein 1 [Source:Xenbase;Acc:XB-GENE-967240])

HSP 1 Score: 65.0846 bits (157), Expect = 3.365e-12
Identity = 62/167 (37.13%), Postives = 80/167 (47.90%), Query Frame = 3
Query:  294 FASFCDTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            FA + DT   G    T K   K+C DCK+   K       DI F K  G + + I   +F + +E    + +   +    E+A + +   V    P   G T  +A  A  RLTD   YTG+HKERFD E+G+GKG  GRE I       GYV  YK A TYD K K
Sbjct:   17 FAIYGDTKATGQE-MTGKNWAKLCKDCKVIDGKSVTGTDVDIVFSKVKGKSARVITCEEFKKALEELSGKRF---KGKSKEEAYEAICKLVVGKEPVSAGITKPAATGAVDRLTDTSKYTGSHKERFD-ESGKGKGKGGRETIV---ENTGYVSSYKLAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Mouse
Match: Tppp2 (tubulin polymerization-promoting protein family member 2 [Source:MGI Symbol;Acc:MGI:2684923])

HSP 1 Score: 80.8777 bits (198), Expect = 3.952e-18
Identity = 59/167 (35.33%), Postives = 84/167 (50.30%), Query Frame = 3
Query:  294 FASFCDTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            FA F ++    S   T+K   K+C DC I   K       DI F K      + I+F  F   ++  + +     +N   ++A++ +   +   +P+  G T  +      RLTD   YTG HKERFD E+G+GKGI+GRE     +   GYV GYKGA TYD KN+
Sbjct:   12 FAVFGES-SSSSKEITNKNFSKLCKDCDIMDGKAVTSTDVDIVFSKVKAKNARTINFQQFQEAMK-ELGQKRFKGKNP--DEALQGVFKLMEGKDPATTGVTKSTTVGGVDRLTDTSKYTGTHKERFD-ESGKGKGIEGREETTDNS---GYVSGYKGAGTYDKKNQ 170          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Mouse
Match: Tppp2 (tubulin polymerization-promoting protein family member 2 [Source:MGI Symbol;Acc:MGI:2684923])

HSP 1 Score: 80.8777 bits (198), Expect = 3.952e-18
Identity = 59/167 (35.33%), Postives = 84/167 (50.30%), Query Frame = 3
Query:  294 FASFCDTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            FA F ++    S   T+K   K+C DC I   K       DI F K      + I+F  F   ++  + +     +N   ++A++ +   +   +P+  G T  +      RLTD   YTG HKERFD E+G+GKGI+GRE     +   GYV GYKGA TYD KN+
Sbjct:   12 FAVFGES-SSSSKEITNKNFSKLCKDCDIMDGKAVTSTDVDIVFSKVKAKNARTINFQQFQEAMK-ELGQKRFKGKNP--DEALQGVFKLMEGKDPATTGVTKSTTVGGVDRLTDTSKYTGTHKERFD-ESGKGKGIEGREETTDNS---GYVSGYKGAGTYDKKNQ 170          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Mouse
Match: Tppp3 (tubulin polymerization-promoting protein family member 3 [Source:MGI Symbol;Acc:MGI:1915221])

HSP 1 Score: 76.6406 bits (187), Expect = 1.669e-16
Identity = 55/150 (36.67%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            K   K+C DCK+   K       DI F K    + + I++ +F + +E    + +         DA+ +L   +A   P+  G T      A  RLTD   YTG+HKERFD E+G+GKGI GR+ I   +   GYV  YK A TYD K K
Sbjct:   33 KNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQL---IAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFD-ESGKGKGIAGRQDILDDS---GYVSAYKNAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Mouse
Match: Tppp3 (tubulin polymerization-promoting protein family member 3 [Source:MGI Symbol;Acc:MGI:1915221])

HSP 1 Score: 76.6406 bits (187), Expect = 1.669e-16
Identity = 55/150 (36.67%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            K   K+C DCK+   K       DI F K    + + I++ +F + +E    + +         DA+ +L   +A   P+  G T      A  RLTD   YTG+HKERFD E+G+GKGI GR+ I   +   GYV  YK A TYD K K
Sbjct:   33 KNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQL---IAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFD-ESGKGKGIAGRQDILDDS---GYVSAYKNAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Mouse
Match: Tppp3 (tubulin polymerization-promoting protein family member 3 [Source:MGI Symbol;Acc:MGI:1915221])

HSP 1 Score: 76.6406 bits (187), Expect = 1.669e-16
Identity = 55/150 (36.67%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            K   K+C DCK+   K       DI F K    + + I++ +F + +E    + +         DA+ +L   +A   P+  G T      A  RLTD   YTG+HKERFD E+G+GKGI GR+ I   +   GYV  YK A TYD K K
Sbjct:   33 KNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQL---IAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFD-ESGKGKGIAGRQDILDDS---GYVSAYKNAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. UniProt/SwissProt
Match: sp|Q2VPM9|TPPP3_XENLA (Tubulin polymerization-promoting protein family member 3 OS=Xenopus laevis OX=8355 GN=tppp3 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.565e-19
Identity = 65/174 (37.36%), Postives = 86/174 (49.43%), Query Frame = 3
Query:  273 MDDLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            ++D    FA + DT   G    T K   K+C DCK+   K       DI F K    + + I + +F + +E   A+ +   +    E+A + +   VA   P   G T  +A  A  RLTD   YTG+HKERFD +TG+GKG  GRE I       GYVG YK A TYD K K
Sbjct:   10 LEDSFRKFAIYGDTKATGQE-MTGKNWSKLCKDCKVNDGKAVTGTDVDIVFSKVKAKSARVITYEEFTKALEELSAKRF---KGKSKEEAYEAICKLVAGKEPVSAGITKAAATGAVDRLTDTSKYTGSHKERFD-QTGKGKGKSGRETIV---ENTGYVGSYKLAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. UniProt/SwissProt
Match: sp|Q0P5Y3|TPPP2_MOUSE (Tubulin polymerization-promoting protein family member 2 OS=Mus musculus OX=10090 GN=Tppp2 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.764e-17
Identity = 59/167 (35.33%), Postives = 84/167 (50.30%), Query Frame = 3
Query:  294 FASFCDTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            FA F ++    S   T+K   K+C DC I   K       DI F K      + I+F  F   ++  + +     +N   ++A++ +   +   +P+  G T  +      RLTD   YTG HKERFD E+G+GKGI+GRE     +   GYV GYKGA TYD KN+
Sbjct:   12 FAVFGES-SSSSKEITNKNFSKLCKDCDIMDGKAVTSTDVDIVFSKVKAKNARTINFQQFQEAMK-ELGQKRFKGKNP--DEALQGVFKLMEGKDPATTGVTKSTTVGGVDRLTDTSKYTGTHKERFD-ESGKGKGIEGREETTDNS---GYVSGYKGAGTYDKKNQ 170          
BLAST of Tubulin polymerization-promoting protein vs. UniProt/SwissProt
Match: sp|Q9BW30|TPPP3_HUMAN (Tubulin polymerization-promoting protein family member 3 OS=Homo sapiens OX=9606 GN=TPPP3 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.345e-16
Identity = 63/176 (35.80%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  273 MDDLKNSFASFC--DTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            M  L+ SF  F      K        K   K+C DCK+   K       DI F K  G + + I++ +F + +E    + +         DA+ +L   VA   P+  G T      A  RLTD   YTG+HKERFD E+G+GKGI GR+ I   +   GYV  YK A TYD K K
Sbjct:    7 MAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQL---VAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD-ESGKGKGIAGRQDILDDS---GYVSAYKNAGTYDAKVK 175          
BLAST of Tubulin polymerization-promoting protein vs. UniProt/SwissProt
Match: sp|Q4R3A0|TPPP2_MACFA (Tubulin polymerization-promoting protein family member 2 OS=Macaca fascicularis OX=9541 GN=TPPP2 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.597e-16
Identity = 64/170 (37.65%), Postives = 84/170 (49.41%), Query Frame = 3
Query:  288 NSFASFCDTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQG-NPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            N FA+F ++   G T   +K   K+C DC I   K       DI F K      + I F  F   ++  + +     ++    D V E    + +G +P+  G T  +   A  RLTD   YTG HKERFD E+G+GKGI GRE +   N   GYV GYKGA TYD K K
Sbjct:   10 NRFAAFGESSSSG-TEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVK-ELGQKRFKGKS---PDEVLESIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFD-ESGKGKGIAGREVM---NDNTGYVSGYKGAGTYDKKTK 170          
BLAST of Tubulin polymerization-promoting protein vs. UniProt/SwissProt
Match: sp|Q3T077|TPPP2_BOVIN (Tubulin polymerization-promoting protein family member 2 OS=Bos taurus OX=9913 GN=TPPP2 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.396e-16
Identity = 62/166 (37.35%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  294 FASFCDTVKKGSTTCTDKTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQG-NPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNK 785
            FA F ++   G T   +K   K+C DC I   K       DI F K      + I F  F    +  M E           D   E   K+ +G +P+  G T  +     +RLTD   YTG HKERFD E+G+GKGI GRE +   +   GYV GYKGA TYD K
Sbjct:   12 FAVFGESSSSG-TEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQF----QEAMKELGQKRFKGKSPDEALENIYKLMEGKDPATTGVTKATTVGGVSRLTDTSKYTGTHKERFD-ESGKGKGIAGREDVTDNS---GYVSGYKGAGTYDKK 168          
BLAST of Tubulin polymerization-promoting protein vs. TrEMBL
Match: A0A0X3PSS5 (Tubulin polymerization-promoting protein family member 3 OS=Schistocephalus solidus OX=70667 GN=TPPP3 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.292e-78
Identity = 115/169 (68.05%), Postives = 137/169 (81.07%), Query Frame = 3
Query:  273 MDDLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYD 779
            M DLK+ F +FCD+VKKGSTT TDKTLKKICTDCKIYCKG D NR DIQFRKH+GNA+KD+DF  FV+FIEG +++AYM A+++  EDAVK+LK K++ G+P+GHG T  S D AT RLTDVK YTG+HKERFD+ETG+GKGI GRE +    A  GYVGGYKG  TYD
Sbjct:    1 MGDLKSVFLAFCDSVKKGSTTATDKTLKKICTDCKIYCKGMDANRVDIQFRKHLGNAKKDVDFGSFVQFIEGALSDAYMEAKSISKEDAVKQLKDKISAGSPAGHGVTAASKDDATNRLTDVKNYTGSHKERFDMETGKGKGIAGREDVVDAKAAAGYVGGYKGQGTYD 169          
BLAST of Tubulin polymerization-promoting protein vs. TrEMBL
Match: A0A0R3W115 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3399 PE=4 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 7.296e-75
Identity = 110/170 (64.71%), Postives = 136/170 (80.00%), Query Frame = 3
Query:  282 LKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            ++ SF +FCD VKKGSTTCTDKTLKKICTDC IYCKG DQNR DIQFRKH+G  R+D+DF  F  F+EG +AEAYM AR++ ++ AVK+L++KVA G P  HG T VS D+ATARLTD +GYTG+HKERFD+ETG+GKG++GRE +  K AQ+GYVG YK  + YD  +K
Sbjct:    1 MEESFYAFCDFVKKGSTTCTDKTLKKICTDCNIYCKGMDQNRVDIQFRKHLGAGRRDVDFEGFCAFLEGELAEAYMEARHIDHDAAVKDLQSKVAGGQPGAHGATSVSKDSATARLTDHRGYTGSHKERFDMETGKGKGMEGRENLPDKKAQQGYVGNYKNMDKYDQLHK 170          
BLAST of Tubulin polymerization-promoting protein vs. TrEMBL
Match: A0A4S2LGH0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009070 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 7.863e-75
Identity = 109/166 (65.66%), Postives = 130/166 (78.31%), Query Frame = 3
Query:  282 LKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYD 779
            ++  F +FCD  KKGS TCTDKTLKKICTDC+IY K  + N  DI FRKH+GN + D+DFN FVRFIEG +AEAY  ++++  E AV E+K K+  GNP  HG T VS+DAATARLTDVKGYTGAHKERFDLETG+GKGI+GREY+  +NA  GYV GYKG +TYD
Sbjct:    1 MEEIFLAFCDAAKKGSKTCTDKTLKKICTDCQIYNKNLNANSVDIAFRKHVGNQKLDVDFNSFVRFIEGTLAEAYAKSKSISQEQAVAEIKEKILHGNPKAHGATKVSSDAATARLTDVKGYTGAHKERFDLETGKGKGIEGREYVMDENAAAGYVSGYKGKDTYD 166          
BLAST of Tubulin polymerization-promoting protein vs. TrEMBL
Match: A0A068X3G3 (Tubulin polymerization promoting protein family OS=Echinococcus granulosus OX=6210 GN=EgrG_000333800 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.432e-74
Identity = 109/170 (64.12%), Postives = 136/170 (80.00%), Query Frame = 3
Query:  282 LKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            ++ SF +FCD+VKKGSTTCTDKTLKKICTDC IYCKG DQNR DIQFRKH+G  R+D+DF  F  F+EG +A+AYM AR++ ++ AV EL++KVA+G PS HG T VS D+ATARLTD +GYTG+HKERFDLE+G+GKG +GRE +  K AQ+GYV  YK  + YD  +K
Sbjct:   15 MEESFYAFCDSVKKGSTTCTDKTLKKICTDCNIYCKGMDQNRVDIQFRKHLGAGRRDVDFEGFCAFLEGDLADAYMDARHMDHDAAVAELQSKVAKGQPSAHGATSVSKDSATARLTDHRGYTGSHKERFDLESGKGKGKEGRENLPDKKAQQGYVANYKNLDKYDQLHK 184          
BLAST of Tubulin polymerization-promoting protein vs. TrEMBL
Match: W6UNL3 (Tubulin polymerization-promoting protein OS=Echinococcus granulosus OX=6210 GN=EGR_05198 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.764e-74
Identity = 109/170 (64.12%), Postives = 136/170 (80.00%), Query Frame = 3
Query:  282 LKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            ++ SF +FCD+VKKGSTTCTDKTLKKICTDC IYCKG DQNR DIQFRKH+G  R+D+DF  F  F+EG +A+AYM AR++ ++ AV EL++KVA+G PS HG T VS D+ATARLTD +GYTG+HKERFDLE+G+GKG +GRE +  K AQ+GYV  YK  + YD  +K
Sbjct:    1 MEESFYAFCDSVKKGSTTCTDKTLKKICTDCNIYCKGMDQNRVDIQFRKHLGAGRRDVDFEGFCAFLEGDLADAYMDARHMDHDAAVAELQSKVAKGQPSAHGATSVSKDSATARLTDHRGYTGSHKERFDLESGKGKGKEGRENLPDKKAQQGYVANYKNLDKYDQLHK 170          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Cavefish
Match: tppp2 (tubulin polymerization promoting protein family member 3 [Source:NCBI gene;Acc:103026174])

HSP 1 Score: 82.0333 bits (201), Expect = 1.646e-18
Identity = 60/151 (39.74%), Postives = 79/151 (52.32%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAE-AYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            K   K+C DCK+   K       DI F K    + + I F  F++     M E A    +  G E+A++ L   +A   PS  G T V+  AA  RLTD   YTG+HKERFD E+G+GKG  GRE I   +   GYV  YKG  +Y++K K
Sbjct:   29 KNFVKLCKDCKVIDGKNITSTDVDIVFSKVKVKSARVITFEQFIQ----AMTELATKRFKGKGQEEALQLLYGLIAGKEPSNVGVTKVAKAAAVDRLTDSSKYTGSHKERFD-ESGKGKGKVGREDIPDTS---GYVSAYKGQGSYEDKLK 171          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Cavefish
Match: tppp2 (tubulin polymerization promoting protein family member 3 [Source:NCBI gene;Acc:103026174])

HSP 1 Score: 81.6481 bits (200), Expect = 2.176e-18
Identity = 60/151 (39.74%), Postives = 79/151 (52.32%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAE-AYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            K   K+C DCK+   K       DI F K    + + I F  F++     M E A    +  G E+A++ L   +A   PS  G T V+  AA  RLTD   YTG+HKERFD E+G+GKG  GRE I   +   GYV  YKG  +Y++K K
Sbjct:   36 KNFVKLCKDCKVIDGKNITSTDVDIVFSKVKVKSARVITFEQFIQ----AMTELATKRFKGKGQEEALQLLYGLIAGKEPSNVGVTKVAKAAAVDRLTDSSKYTGSHKERFD-ESGKGKGKVGREDIPDTS---GYVSAYKGQGSYEDKLK 178          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Cavefish
Match: TPPP (tubulin polymerization promoting protein [Source:NCBI gene;Acc:103029217])

HSP 1 Score: 65.0846 bits (157), Expect = 4.391e-12
Identity = 50/150 (33.33%), Postives = 73/150 (48.67%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            K   K+C DC +   K       DI F K    + + I ++   +F E     A    ++   E+A +E+   +   +P   G T   A    +RLTD   +TG+HKERFD ETG+GKG  GR  +   +   GYV GYK A +Y+ K +
Sbjct:   79 KNWSKLCKDCGVIDGKSITLTDVDIVFSKVKNKSGRTITYS---QFREALSELARKRFKDKSGEEAAEEVFKMIEGKSPVIAGVTRAVASPTVSRLTDTSKFTGSHKERFD-ETGRGKGKAGRVDMVDTS---GYVSGYKHAGSYEKKTQ 221          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Sea Lamprey
Match: TPPP (tubulin polymerization promoting protein [Source:HGNC Symbol;Acc:HGNC:24164])

HSP 1 Score: 76.2554 bits (186), Expect = 5.772e-17
Identity = 63/176 (35.80%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  294 FASFCDTVKK----GSTTCTDKTL-----KKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
             AS  D+ KK    G T  T K L      K+C DCK+   K       DI F K    A + I F +F   ++    + +   ++   ++A++E    +A  +P  HG T  +      RLTD   YTG HK RFD ETG+GKG  GRE I       GYV  Y+ A TYD K K
Sbjct:   15 IASLEDSFKKFAVLGDTKATGKELNGKNFAKLCKDCKVIDGKAITSTDVDIAFSKVKQKAARVITFEEFKEALQQLSCKRF---KDKDEQEALEETYKLIAGKSPIIHGVTKATNKGGVGRLTDPSKYTGTHKMRFD-ETGKGKGKAGREDIPD---TRGYVHSYRDAGTYDQKVK 183          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Nematostella
Match: EDO48995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHK7])

HSP 1 Score: 82.0333 bits (201), Expect = 4.632e-19
Identity = 59/171 (34.50%), Postives = 86/171 (50.29%), Query Frame = 3
Query:  273 MDDLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGN-PSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDN 782
            + ++  SF +F    K       +    K+  D KIY K F Q   DI F +    ++ +   N    F +   A +  + +  G  + V +L  K+ +G  P    TT V    A  RLTD + YTG+HKERFD ETG+G+GI+GR      +A+ GYVG Y+G +TYD 
Sbjct:    6 LHEIFKSFCAFGAGCKDAQPLMDNAKFAKLFRDLKIYDKKFTQIDSDIIFNRPEVKSKSERKVN----FSQFKAALSLCAEKKYGKREDVIKLVDKICEGKGPVASKTTKVVKAGAVDRLTDTRKYTGSHKERFD-ETGKGRGIEGR-VDRDPHAEAGYVGNYRGRDTYDQ 170          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Nematostella
Match: EDO36688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU5])

HSP 1 Score: 79.337 bits (194), Expect = 5.147e-18
Identity = 64/174 (36.78%), Postives = 86/174 (49.43%), Query Frame = 3
Query:  276 DDLKNSFASFC--DTVKKGSTTCTDKT-LKKICTDCKIYCKGFDQNRCDIQFRKHIGNAR--KDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGN-PSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYD 779
            D L+  F SFC      KG+    D     K+  D  +Y + F     DI F +     +  + I+FN F       +A    + +  G +D V +L  K+ +G  P+  G T         RLTD K YTG+HKERFD ++G+GKGI+GR     K AQ GYVG YKG  TYD
Sbjct:    4 DQLQAKFESFCAFGAGAKGAQPLMDNAKFGKMFRDLHLYDQKFTSTDTDIIFSRTEVKPKTERKINFNQF------KVALGLCAEKKFGSKDQVGKLTEKICKGKGPATSGATKAVKVGGVERLTDTKCYTGSHKERFD-KSGKGKGIEGRVDRDDKAAQ-GYVGNYKGEGTYD 169          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Medaka
Match: tppp3 (tubulin polymerization-promoting protein family member 3 [Source:NCBI gene;Acc:101170163])

HSP 1 Score: 77.411 bits (189), Expect = 7.480e-17
Identity = 64/181 (35.36%), Postives = 87/181 (48.07%), Query Frame = 3
Query:  276 DDLKNSFASFC---DTVKKGSTTCTDKTLKKICTDCKI----YCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK*E 797
            D L  +F  F    DT K        K   K+C DCKI    +  G D    DI F K      + I + +F R ++    + +   +    E+A++ +   V    P+  G T  +  AA  RLTD   YTG+HKERFD E+G+GKG +GRE +       GYVG YK A T+D K K E
Sbjct:    8 DKLLTAFQKFAVHGDT-KASGKELNGKNWAKLCKDCKIIDGKHVTGTD---VDIIFTKVKQKTARVITYEEFQRALQELALKRF---KGQSQEEALQSICKLVEGQGPANVGVTKAAKIAAVDRLTDPSRYTGSHKERFD-ESGRGKGREGREELV---ENTGYVGAYKNAGTFDIKKKTE 177          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Medaka
Match: tppp2 (tubulin polymerization-promoting protein family member 3 [Source:NCBI gene;Acc:101167683])

HSP 1 Score: 76.6406 bits (187), Expect = 1.504e-16
Identity = 56/150 (37.33%), Postives = 76/150 (50.67%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            K   KIC DC I   K       DI F K    + + I F  F + +     + +   +    ++A+++L   +A   P+  G T V+  AA  RLTD   YTG+HKERFD E+G+GKG  GR  I   +   GYV  YKG  TYD+K K
Sbjct:   34 KNFAKICKDCHITDGKNVTTTDVDIVFSKVKAKSARVITFEQFNQALTELAPKRF---KGKSKDEALQQLYGLLAGKEPANVGVTKVAKAAAVDRLTDTTKYTGSHKERFD-ESGKGKGKAGRADIPDTS---GYVAAYKGTGTYDDKVK 176          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Medaka
Match: TPPP (tubulin polymerization promoting protein [Source:NCBI gene;Acc:101162550])

HSP 1 Score: 60.8474 bits (146), Expect = 7.045e-11
Identity = 58/178 (32.58%), Postives = 81/178 (45.51%), Query Frame = 3
Query:  270 LMDDLKNSFASFCDTVKKGSTTCTDKTL-----KKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNK 785
            +M++  N   SF      G T  T K +      K+C DC +   K       DI F K      + I +++F +   G +A      ++   E+A  E+   +    P   G T   A    +RLTD   +TG+HKERFD ETG+GKG  GR  I   +   GYV GYK   TY+ K
Sbjct:    1 MMENFTN-LESFRRFAIHGDTRATGKDMHGKNWSKLCKDCGVIDGKNITLTDVDIVFSKVKKKTCRTITYDEF-KVALGELARK--KYKDKTGEEAEAEVFKLIEGKAPVIAGVTRAVASPTVSRLTDPTKFTGSHKERFD-ETGRGKGKAGRVDIVDTS---GYVSGYKHRGTYEKK 170          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Medaka
Match: TPPP (tubulin polymerization promoting protein [Source:NCBI gene;Acc:101162550])

HSP 1 Score: 60.077 bits (144), Expect = 2.962e-10
Identity = 51/148 (34.46%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNK 785
            K   K+C DC +   K       DI F K      + I +++F +   G +A      ++   E+A  E+   +    P   G T   A    +RLTD   +TG+HKERFD ETG+GKG  GR  I   +   GYV GYK   TY+ K
Sbjct:   87 KNWSKLCKDCGVIDGKNITLTDVDIVFSKVKKKTCRTITYDEF-KVALGELARKKY--KDKTGEEAEAEVFKLIEGKAPVIAGVTRAVASPTVSRLTDPTKFTGSHKERFD-ETGRGKGKAGRVDIVDTS---GYVSGYKHRGTYEKK 227          
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Medaka
Match: TPPP (tubulin polymerization promoting protein [Source:NCBI gene;Acc:101162550])

HSP 1 Score: 60.077 bits (144), Expect = 2.962e-10
Identity = 51/148 (34.46%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  345 KTLKKICTDCKIY-CKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNK 785
            K   K+C DC +   K       DI F K      + I +++F +   G +A      ++   E+A  E+   +    P   G T   A    +RLTD   +TG+HKERFD ETG+GKG  GR  I   +   GYV GYK   TY+ K
Sbjct:   87 KNWSKLCKDCGVIDGKNITLTDVDIVFSKVKKKTCRTITYDEF-KVALGELARKKY--KDKTGEEAEAEVFKLIEGKAPVIAGVTRAVASPTVSRLTDPTKFTGSHKERFD-ETGRGKGKAGRVDIVDTS---GYVSGYKHRGTYEKK 227          
BLAST of Tubulin polymerization-promoting protein vs. Planmine SMEST
Match: SMESG000026839.1 (SMESG000026839.1)

HSP 1 Score: 354.755 bits (909), Expect = 4.654e-125
Identity = 173/173 (100.00%), Postives = 173/173 (100.00%), Query Frame = 3
Query:  273 MDDLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 791
            MDDLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK
Sbjct:    1 MDDLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNKNK 173          
BLAST of Tubulin polymerization-promoting protein vs. Planmine SMEST
Match: SMESG000023000.1 (SMESG000023000.1)

HSP 1 Score: 205.682 bits (522), Expect = 2.432e-66
Identity = 102/170 (60.00%), Postives = 122/170 (71.76%), Query Frame = 3
Query:  279 DLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTK-VAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNK 785
            +LK  F  FCD VKKGSTT TDKT+ +IC DCKI+ K FD NRCDI+FR  IGNA++D++F  F  FIE   ++AY +A  +    AV  +K K V  G P GHGTT +S D+AT RLTDVK YTGAHKERFDL++G+GKG DGREY+    AQEGYV GYK  NTYD K
Sbjct:    5 ELKTIFLRFCDAVKKGSTTATDKTITRICKDCKIFNKNFDSNRCDIEFRGFIGNAKRDVEFVKFKEFIETRFSKAYATAMKIDQNKAVDLIKDKIVLSGGPVGHGTTKLSTDSATQRLTDVKSYTGAHKERFDLDSGKGKGKDGREYLVDSKAQEGYVSGYKEMNTYDKK 174          
BLAST of Tubulin polymerization-promoting protein vs. Planmine SMEST
Match: SMESG000002261.1 (SMESG000002261.1)

HSP 1 Score: 181.8 bits (460), Expect = 5.337e-57
Identity = 95/173 (54.91%), Postives = 116/173 (67.05%), Query Frame = 3
Query:  273 MDDLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQFRKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAV--KELKTKVAQGNPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIAGKNAQEGYVGGYKGANTYDNK 785
            M D+K+ F +FCD  KKGSTT TDKT+KKICTD K+Y K F  N  DI+FRK IGN +K+IDF  F  F+      AY  A++   E++   +++K K+    P  HG T  S D AT RLTDVKGYTGA KE FD ETG+GKG +GREY+    A EGYVGGYKG N+YD K
Sbjct:    1 MSDIKSVFLAFCDATKKGSTTATDKTIKKICTDAKLYTKTFTANDVDIEFRKCIGNQKKEIDFAGFENFLNKFFIPAY--AKSCKKEESAVGEDIKQKIISNGPKSHGATKASKDGATERLTDVKGYTGARKEAFDAETGKGKGKEGREYVVDSKAAEGYVGGYKGMNSYDQK 171          
The following BLAST results are available for this feature:
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPPP32.800e-1735.80tubulin polymerization promoting protein family me... [more]
TPPP32.800e-1735.80tubulin polymerization promoting protein family me... [more]
TPPP32.800e-1735.80tubulin polymerization promoting protein family me... [more]
TPPP32.800e-1735.80tubulin polymerization promoting protein family me... [more]
TPPP26.101e-1536.31tubulin polymerization promoting protein family me... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tppp-14.564e-831.95Tubulin polymerization-promoting protein homolog ... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ringer9.988e-1233.93gene:FBgn0266417 transcript:FBtr0344399[more]
ringer9.988e-1233.93gene:FBgn0266417 transcript:FBtr0344401[more]
ringer9.988e-1233.93gene:FBgn0266417 transcript:FBtr0344398[more]
ringer9.988e-1233.93gene:FBgn0266417 transcript:FBtr0344400[more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tppp21.309e-1738.00tubulin polymerization-promoting protein family me... [more]
tppp21.364e-1738.00tubulin polymerization-promoting protein family me... [more]
tppp31.766e-1737.43tubulin polymerization-promoting protein family me... [more]
tppp31.766e-1737.43tubulin polymerization-promoting protein family me... [more]
TPPP3.431e-1235.17tubulin polymerization-promoting protein [Source:N... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rabep13.365e-1237.13rabaptin, RAB GTPase binding effector protein 1 [S... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tppp23.952e-1835.33tubulin polymerization-promoting protein family me... [more]
Tppp23.952e-1835.33tubulin polymerization-promoting protein family me... [more]
Tppp31.669e-1636.67tubulin polymerization-promoting protein family me... [more]
Tppp31.669e-1636.67tubulin polymerization-promoting protein family me... [more]
Tppp31.669e-1636.67tubulin polymerization-promoting protein family me... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2VPM9|TPPP3_XENLA3.565e-1937.36Tubulin polymerization-promoting protein family me... [more]
sp|Q0P5Y3|TPPP2_MOUSE2.764e-1735.33Tubulin polymerization-promoting protein family me... [more]
sp|Q9BW30|TPPP3_HUMAN1.345e-1635.80Tubulin polymerization-promoting protein family me... [more]
sp|Q4R3A0|TPPP2_MACFA1.597e-1637.65Tubulin polymerization-promoting protein family me... [more]
sp|Q3T077|TPPP2_BOVIN3.396e-1637.35Tubulin polymerization-promoting protein family me... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PSS52.292e-7868.05Tubulin polymerization-promoting protein family me... [more]
A0A0R3W1157.296e-7564.71Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A4S2LGH07.863e-7565.66Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A068X3G31.432e-7464.12Tubulin polymerization promoting protein family OS... [more]
W6UNL31.764e-7464.12Tubulin polymerization-promoting protein OS=Echino... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tppp21.646e-1839.74tubulin polymerization promoting protein family me... [more]
tppp22.176e-1839.74tubulin polymerization promoting protein family me... [more]
TPPP4.391e-1233.33tubulin polymerization promoting protein [Source:N... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TPPP5.772e-1735.80tubulin polymerization promoting protein [Source:H... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO489954.632e-1934.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366885.147e-1836.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tppp37.480e-1735.36tubulin polymerization-promoting protein family me... [more]
tppp21.504e-1637.33tubulin polymerization-promoting protein family me... [more]
TPPP7.045e-1132.58tubulin polymerization promoting protein [Source:N... [more]
TPPP2.962e-1034.46tubulin polymerization promoting protein [Source:N... [more]
TPPP2.962e-1034.46tubulin polymerization promoting protein [Source:N... [more]
back to top
BLAST of Tubulin polymerization-promoting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000026839.14.654e-125100.00SMESG000026839.1[more]
SMESG000023000.12.432e-6660.00SMESG000023000.1[more]
SMESG000002261.15.337e-5754.91SMESG000002261.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024199 ID=SMED30024199|Name=Tubulin polymerization-promoting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=910bp
ACTCTGCGAAAAATTCTATCAATTTCTGCCATTGGATAAATTTTTTTTAT
TAAATATCCATTATTATATATTAAATATAAAAATGTTCCGATTAAAAAAT
AACTCGCGTTACGCAATAAGTGGATTGTTACGAGAATTCCATTCGTAATC
TCAAATAAAAATGAATTCATTGAATTTTTCTACAAAATTAATGGAATAAT
GGATCCATTTCAAATTTAAATTATTTCCATAGAAAGTTCTATTATAAATC
AATCTATAATTGTCAGAATTTAATGGATGACCTAAAGAATTCATTTGCGT
CCTTCTGCGACACTGTTAAGAAAGGCTCCACGACTTGTACCGATAAAACG
TTGAAGAAAATCTGTACCGACTGTAAAATCTATTGTAAAGGATTTGATCA
AAACCGATGCGATATTCAGTTTCGGAAACATATTGGAAACGCAAGAAAGG
ACATAGATTTTAATGATTTTGTTCGGTTCATTGAAGGCCCAATGGCCGAG
GCGTACATGAGTGCAAGAAATTTGGGGTATGAAGACGCGGTAAAGGAACT
GAAAACAAAAGTCGCTCAAGGCAATCCGTCTGGTCATGGAACAACTGGAG
TTTCTGCAGACGCTGCTACAGCTCGTTTAACAGATGTTAAAGGTTATACA
GGAGCCCATAAAGAACGATTCGATCTGGAAACCGGTCAAGGTAAAGGCAT
TGACGGTAGAGAATATATTGCCGGGAAAAATGCACAAGAAGGTTACGTCG
GTGGTTACAAAGGTGCCAATACTTATGATAACAAAAATAAATAAGAAATT
GAAAATTTTATTTTTCCATTACCAAATTTTGGTTCATTGATTTGATTTCA
ACTTATTTTTTTATTTATCTATTTATTTTTAATTTAATAAATTATTAATT
CTAAAAAAAA
back to top

protein sequence of SMED30024199-orf-1

>SMED30024199-orf-1 ID=SMED30024199-orf-1|Name=SMED30024199-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=174bp
MDDLKNSFASFCDTVKKGSTTCTDKTLKKICTDCKIYCKGFDQNRCDIQF
RKHIGNARKDIDFNDFVRFIEGPMAEAYMSARNLGYEDAVKELKTKVAQG
NPSGHGTTGVSADAATARLTDVKGYTGAHKERFDLETGQGKGIDGREYIA
GKNAQEGYVGGYKGANTYDNKNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR008907P25-alpha
IPR011992EF-hand-dom_pair
Vocabulary: biological process
TermDefinition
GO:0001578microtubule bundle formation
GO:0046785microtubule polymerization
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
Vocabulary: molecular function
TermDefinition
GO:0015631tubulin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008907P25-alphaPFAMPF05517p25-alphacoord: 6..164
e-value: 3.4E-41
score: 141.0
IPR008907P25-alphaPANTHERPTHR12932P25 ALPHA-RELATEDcoord: 2..168
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1..102
e-value: 7.8E-10
score: 40.9
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 1..132