protocadherin-9

Overview
Nameprotocadherin-9
Smed IDSMED30024198
Length (bp)3228
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protocadherin-9 (SMED30024198) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protocadherin-9 (SMED30024198) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024198

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024198SMESG000023091.1 SmedASXL_011773SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30024198SMESG000023091.1 dd_Smed_v4_21207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024198SMESG000023091.1 dd_Smed_v4_21207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024198SMESG000023091.1 dd_Smed_v4_21207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024198SMESG000023091.1 dd_Smed_v4_21207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024198SMESG000023091.1 dd_Smed_v4_21207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024198SMESG000023091.1 dd_Smed_v4_21207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024198SMESG000023091.1 dd_Smed_v6_21207_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30024198SMESG000023091.1 dd_Smed_v6_21207_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 286.574 bits (732), Expect = 1.045e-80
Identity = 217/771 (28.15%), Postives = 361/771 (46.82%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      DRE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +     F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL----FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENKAVTLSI--------LNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 125.561 bits (314), Expect = 1.636e-28
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +        + F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 286.189 bits (731), Expect = 8.808e-80
Identity = 217/771 (28.15%), Postives = 361/771 (46.82%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      DRE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +     F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL----FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENKAVTLSI--------LNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 126.331 bits (316), Expect = 1.295e-28
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +        + F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 285.804 bits (730), Expect = 1.113e-79
Identity = 217/771 (28.15%), Postives = 361/771 (46.82%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      DRE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +     F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL----FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENKAVTLSI--------LNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 126.331 bits (316), Expect = 1.280e-28
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +        + F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 286.189 bits (731), Expect = 1.249e-79
Identity = 217/771 (28.15%), Postives = 361/771 (46.82%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      DRE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +     F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL----FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENKAVTLSI--------LNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 126.331 bits (316), Expect = 1.095e-28
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +        + F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 277.33 bits (708), Expect = 2.765e-77
Identity = 215/775 (27.74%), Postives = 362/775 (46.71%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETI--CSFKEVGDSDPLKAQNCKLSLTVFV--PKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE---QPSDIFGLNY-------EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIP--DCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNG-DDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNGNTP 2352
            Y V EE PPN LIG++  D    +         +Y+ E    Y R+  KTG+ F     IDRE +  C  +  GD   L+    ++S+T  V       +  +I ++DIND+ P F      + I E  +I    P+ LA D D GPN +  Y+L+   +  ++FGL         +P     L +   LD +  D  +Y L ++  DGG P +     L + V D NDN P F +  Y   +SE + +G  + +V A D D G    I Y  +++    ++       ++ +N+G I +   +D +   +    + A D G +P   +A + + ++D+ND+ P I I+    +   D M ++ E+  +   + L+ V+D D G+N  V+CV+  D    L + S  G D +  Y +      D E    +TI I   D G PPLS++ ++++ + DVN++ PV   ++ EV   E+   G+    +   D D+  N      L  E   K  F+I  + G+I++K++LDRE+ + Y + +V  D      Q T   ++ V+V+D NDN P  + S    +++E N      +  V  +D D G NA V+ ++              F I    G + +  S DRE+   Y   L   D G PP++    + +N++D+NDNAP    PS  +  + LT  T  G+ ++ + A D D+  NA + Y++    P     +F++    G I + + +  +   LH   ++ SD G  P
Sbjct:   62 YKVPEEQPPNTLIGSLAADYGFPD------VGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILE---FEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQP----QLIVMGNLDRERWD--SYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRR-----LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTA--TVLVNVLDCNDNDPKFMLSGYNFSVME-NMPALSPVGMVTVIDGDKGENAQVQLSVEQ--------DNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNP---YGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 801          

HSP 2 Score: 117.472 bits (293), Expect = 6.562e-26
Identity = 144/642 (22.43%), Postives = 253/642 (39.41%), Query Frame = 1
Query:  181 ESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFE-PNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKL-----DYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPP--------IFMKSEYMVNVSEKTAVGSEIFRVIATDRDSG--------LYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKD-EEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSF-SLTVSVMDANDNKPYLLNSSKVIN-IIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQ 2031
            E    Q+ ED+E        EK  +  V G +DRE   S+        +K Q+         P+     + +T+ D ND+ P FE P+++  E+ E   I        A D D G N   EY   Q  ++         +L L   + L       D  D       + A D G   +    ++ + V D NDN P        +    + M N+SE  A  + +  V  +DRD G        + G + + + ++      S +  F + +           LD +    + + + A DSG  PL     +K+ + D+ND+ P  +           ++ PENN     I  I  +D D G N ++   +  +   K L  +S    +     I    + DRE    + + +   D G P L  + T+ + + D N++ P    +    ++ E++        V V D D   N    +    +   F I    G I    + DRE+   Y   +   D    G    +++  +T++V+D NDN PY+   S   + ++     + E + QV A D D G NA + Y+I             +F I   +G +     ++R  + ++++ + ++D+G PP+
Sbjct:  215 ELFGLQVAEDQE--------EKQPQLIVMGNLDRERWDSYDLT-----IKVQDGGSP-----PRASSALLRVTVLDTNDNAPKFERPSYEA-ELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRR------LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT---------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQS------VTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGE-----IQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDG---GVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYG------LFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPR 802          

HSP 3 Score: 106.301 bits (264), Expect = 1.420e-22
Identity = 99/370 (26.76%), Postives = 168/370 (45.41%), Query Frame = 1
Query: 1336 FTISIT-CKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETIN-------KIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWK-----FPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGT---------IQVT---EFLTLKMFVLHLQASDNGNTPLKSV 2364
            F +SIT     G P L   Q   I + D+N++ P   + +  + I E+ +IG  F      D+DA  N   S+ +Q           ++    + K  ++ +  NLDRE+ D Y + I V+D         +S  L V+V+D NDN P     S    + E N  +   + QV A D+D G+NA +EYT +      E+++ ++  ++R  G +     +DRE     + S+L  D+G  P++    ++V + D NDNAP  +       + Q+ + N+++       +A +   D D  ENA VT  +    P      F+L +   T         +Q T   ++  +K + + + A D+GN PL S 
Sbjct:  136 FEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGS--PPRASSALLRVTVLDTNDNAPKFERPSYEAELSE-NSPIGHSVIQVKANDSDQGANAEIEYTFHQAP---EVVR-RLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVP------FQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSST 489          
BLAST of protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 202.986 bits (515), Expect = 1.369e-52
Identity = 191/701 (27.25%), Postives = 313/701 (44.65%), Query Frame = 1
Query:  220 KNYFRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKN--YSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMF 2313
            KN   I  K+G    A  +DRET+   + +V  SD    +           +E    VEIT+ D+ND+ PVF  +   + I E ++I        A D D G N    Y +   S I GL  +      + L+ ++D      KN   + ++RA DG  P       L+I V D ND+ P  + ++ M+ + E  A+G E+ RV A D DSG  G I Y M  S            F I ++SG I   + LD + T  + +++ A D G   L     + ++++DIND+ P        D  +  +++ E   + + I  +   D D  ++ K++  I + + ++   + + GD   I S+       +  +    + I+  D G   L     + + I DVN   P  N++   V I E   IG    T++ ED D   N + ++    +  +F ID   G I + S+LDRE  DR    ++V  +        TS  + V + D NDN P   +SS    I E +  V     QV A+D DIG N +V+Y +N       I   ++F ++R +G L   + LDRE++ V  + +   D+G P  +    I + + D NDNAP ++  S    I   + +   G  + TI A D D  +NA++++   ++    ++ +F + E      V   LT   F
Sbjct:  315 KNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPK-----------RESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYS-TGEVTLRERID-----AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF------DKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVF-SILDIGDQGAILSVSGEL---KRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDN-ARIVYSIDSSQFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISE-DIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSI---QLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPV---GSTVGTIVARDADEGDNADISF---RIFGGADAKLFDIEEDAEQNGVVRILTRAEF 960          

HSP 2 Score: 186.808 bits (473), Expect = 1.536e-47
Identity = 197/773 (25.49%), Postives = 338/773 (43.73%), Query Frame = 1
Query:  112 EESPPNYLIGNIKKDSRLSEKNSESLTFQIY--EDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIE----DINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSK-LDYDVP-DGKNYSLI---LRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIY--FSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMF---VLHLQASDNGNTPLKSVPTTLTI 2382
            E++P   +I ++K     S  +S+ L + +   +D   +N F +   +GE  +A  +DRE +       D   LK       +T +   +  I+   T+     D+ D+ P+FE +    EI E   I        A+DLD G N   EY L + +   G N     +L +  KS  +    P D +  SLI   + A D G P +     + I V D NDN P+F    Y V + E   + + I  V ATD D G  G ++Y M  S         +    I  ++G + L  ++DAK +P     + A D  +  L     + I + DINDH P +    K      M++L EN      +G +   D D G NG +   +   E+ I+     + D  +I +       DRE  + +++ +T +D G P L+TS TI + + D+N++ P  +     V ISE++  G +  T++  D D  + I++ I+E   +++    I  +   + +   L R+    + + + +    Q G Q     ++    +D  ++ PY  +    + I E +  +   +  + A D+D G NA + Y+I+  ++         F I+  +G++   + LDRE    + + +  +D  +PP      I V + D NDN+P +   S    I     +   G     + A D D   N  V Y L +     +  +F+L  T GT++V+  L  + F   VL + A D G TP  S  + +T+
Sbjct:  176 EDTPIETIIASVKA----SHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVL-------DKHILK-------VTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGN---GKN-----LLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG-------IGGLTIDYSTGEVTLRERIDAKNSP-ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQK------MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII-----DEDSGLIKT---TKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD---HKVRVEISATDQGGLQGRCVVNV---FIDDVNSAPYFNDHPFSVKIPE-HSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF---------FRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPV---GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRG-TPSLSAASEITL 880          

HSP 3 Score: 98.2117 bits (243), Expect = 2.864e-20
Identity = 101/416 (24.28%), Postives = 188/416 (45.19%), Query Frame = 1
Query:  700 GHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSID---RKFGKIKI--KSNLDRE-KIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFT 1923
            G   +++ ++D N + P F    + V + E + +G  +  + A D D G    I Y +  S           FF+I  +SG I ++  LD +   +F + + A D    PL     +++I++DIND++PQ +            ++ E+         +   D DIG NG V   +N+      +++     DR   ++  +   DRE  ++  + I  +D G P LS +  I + +SDVN++ P       ++ I+E+  +G    T+   D D   N  ISF I    +   F I+    + G ++I  ++  D E K +++       + +    Q +++  + + V D NDNKP L +   ++N  + N  +  +I  + A D D   NA +EY +      N++I+ + +T
Sbjct:  665 GRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS----------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSY------AATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRL--DRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFF-----ELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFD-NVQMARQIGFIPAFDPD--QNATLEYFLE----ENDLIEAEKYT 1049          
BLAST of protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 197.593 bits (501), Expect = 5.586e-51
Identity = 178/650 (27.38%), Postives = 294/650 (45.23%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKN--YSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQA 2331
            VEIT+ D+ND+ PVF  +   + I E ++I        A D D G N    Y +   S I GL  +      + L+ ++D      KN   + ++RA DG  P       L+I V D ND+ P  + ++ M+ + E  A+G E+ RV A D DSG  G I Y M  S            F I ++SG I   + LD + T  + +++ A D G   L     + ++++DIND+ P        D  +  +++ E   + + I  +   D D  ++ K++  I + + ++   + + GD   I S+       +  +    + I+  D G   L     + + I DVN   P  N++   V I E   IG    T++ ED D   N + ++    +  +F ID   G I + S+LDRE  DR    ++V  +        TS  + V + D NDN P   +SS    I E +  V     QV A+D DIG N +V+Y +N       I   ++F ++R +G L   + LDRE++ V  + +   D+G P  +    I + + D NDNAP ++  S    I   + +   G  + TI A D D  +NA++++   ++    ++ +F + E      V   LT   F    +A
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYS-TGEVTLRERID-----AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF------DKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREV-FSILDIGDQGAILSVSGEL---KRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDN-ARIVYSIDSSQFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISE-DIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSI---QLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPV---GSTVGTIVARDADEGDNADISF---RIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKA 607          

HSP 2 Score: 158.303 bits (399), Expect = 8.254e-39
Identity = 143/562 (25.44%), Postives = 250/562 (44.48%), Query Frame = 1
Query:  712 LSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIY--FSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMF---VLHLQASDNGNTPLKSVPTTLTI 2382
            + I V D NDN P+F    Y V + E   + + I  V ATD D G  G ++Y M  S         +    I  ++G + L  ++DAK +P     + A D  +  L     + I + DINDH P +    K      M++L EN      +G +   D D G NG +   +   E+ I+     + D  +I +       DRE  + +++ +T +D G P L+TS TI + + D+N++ P  +     V ISE++  G +  T++  D D  + I++ I+E   +++    I  +   + +   L R+    + + + +    Q G Q     ++    +D  ++ PY  +    + I E +  +   +  + A D+D G NA + Y+I+  ++         F I+  +G++   + LDRE    + + +  +D  +PP      I V + D NDN+P +   S    I     +   G     + A D D   N  V Y L +     +  +F+L  T GT++V+  L  + F   VL + A D G TP  S  + +T+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG-------IGGLTIDYSTGEVTLRERIDAKNSP-ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQK------MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII-----DEDSGLIKT---TKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD---HKVRVEISATDQGGLQGRCVVNV---FIDDVNSAPYFNDHPFSVKIPE-HSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF---------FRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPV---GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRG-TPSLSAASEITL 521          

HSP 3 Score: 152.525 bits (384), Expect = 5.329e-37
Identity = 166/623 (26.65%), Postives = 271/623 (43.50%), Query Frame = 1
Query:  382 INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVP-FFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINK---IYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTIN---RKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEI-ILVNIIDKNDNAPIWK-FPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTL 2217
            + + I + DINDH P      K+I ++E V+I  E     A D D GPN I +Y +E   D F ++ +   I    L      D      YSL + A D G P       +++ + D NDN P F K EY V +SE+   GS+I  + A D D      I Y + E+       +++     I   SG +   ++ D K+      R+E   + +  L G+ V+ + I+D+N   P  +  P        + +PE++     +  +   D D G N ++  V + D  +      ++GD      I  +   DRE  + F++ +T  D+  PPL+TS  IE+ + D+N++ P   ++     ISED+ +G  F  V   D D   N  + + + E+ +      F +DR  G +++ S LDRE+    ++ I   D         +  +LT+S  D NDN P     S  + I E N  V   +  + A D D G NA + + I            K+F I     +NG +  LT  + + Y+          + +  Q    + + +++ D NDN P  K F    N   N+       + I  I A+D D  +NA + Y L
Sbjct:  104 VPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-FIIDEDSGLIKTTKL-----LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED--QKITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDHKV------RVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFS------VKIPEHSPIGYPVITLKAEDHDRGDNARI--VYSIDSSQFFRIDPSSGD------ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLS--DVNDNAPTFEQLSYDLYIAE-NSPVGSTVGTIVARDADEGDNADISFRI------FGGADAKLFDIEEDAEQNGVVRILTRAEFD-YEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQM----ARQIGFIPAFDPD--QNATLEYFL 678          

HSP 4 Score: 125.176 bits (313), Expect = 1.502e-28
Identity = 133/552 (24.09%), Postives = 245/552 (44.38%), Query Frame = 1
Query:  172 KNSESLTFQIYE-DEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGD-------SDPLKAQNCKLSLTVFVPKEHWIN----VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTP---QISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAES---LFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGT-----------QFTTSFSLTVSVMDAND 1740
            + S+ +T +  + DE++K  +RI E           DRE   S  ++GD       S  LK Q+ K+ + +    +  +     V + I+D+N   P F  +   ++I E   I +      A+D D G N    Y ++  S  F ++   P   ++ + S LD +  D   +S+I+ A D   P      ++ + ++D NDN P F  S Y   +SE   VG+   +V A D D G  G ++YF+ ES S    S  +  F++ + SG + ++ KLD +      + + A D G   L   + + + + D+ND+ P   Q+S           L + EN+   + +G I+  D D G N  +S  I    +  L  +  + +   +  I+    FD EA++    F +  +    GQ  LS++  + I +SDVN++ P + + +  +N  ++V + ++   +   D D    + + ++E  N +    ++  GKI +K    R     +  C+    N +  T             + SF+L+++ M  +D
Sbjct:  237 RGSQIITLKAVDNDEDQKITYRIEEA----------DREVF-SILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS-SQFFRID---PSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSS----SPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYD---------LYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQAS---SGQ--LSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLEYFLEE--NDL-IEAEKYTGKILVKQEWKRNMDVSFKTCVSDGANTECSTCRFIHVLVEPEWLSESFTLSLARMTVDD 749          
BLAST of protocadherin-9 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 154.066 bits (388), Expect = 2.346e-37
Identity = 171/691 (24.75%), Postives = 299/691 (43.27%), Query Frame = 1
Query:  394 ITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFI------------LNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVI--NNNIKEVNISEDVSIGQEFFTVEV-----EDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQ---LGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELF--ALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPL----NSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTI 2382
            I  E  N H PVF    +++E+ E   I        A D D G N    Y +    DI G ++E   +            L+  +K KL+       +  L + A D G P++   + + +R+ D N++ P F +  Y + +SE    G +IF+V A D D G  G I +    S+ N+++   V    I   +G + L + LD +        + A D G    +    + I +ED+ND+ P+  ++           +PE+    A++  +   D DIGQN K+  ++N   EK+  ++ ++     I++    +  D      F +SI   D+G P LSTS  + + + D+  +   I  ++  KE ++ E+  IG E   +E      E K    N+ + I       +FSID+K G ++    LDRE    Y I +   D+K       +      + + ++D ND++P       + ++ E N      I +V A D D   N      +  I+  +    +  F I+  +G +    +  LDREK   +++ + + D G P      I++VN++D+NDN+P +        +    +  + G+ +  I A D D  ENA +TY +T+ +       N NI       G          + + L +QA+D+G TP +    T  +
Sbjct:  596 IIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIH---DIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEV-----LDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKF----SLGNNQEKSSV--ISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQ------HSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNS--EKVPFRIDHHSGCIFIHA--PEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQK-GTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAE-NSPANVVIVKVEATDADDVDNDAAAPLMFKIERGD---PQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSV----RSKFAGK-LCRIFAVDADEGENARLTYNITEGDARFSIDNNGNIIASEAIHGD---------ESYALTVQATDHG-TPGQQFAATRVV 1242          

HSP 2 Score: 103.99 bits (258), Expect = 4.699e-22
Identity = 156/673 (23.18%), Postives = 279/673 (41.46%), Query Frame = 1
Query:  229 FRIVEKTGEFYVAGRIDR-ETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAK--DLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVP-DGKNYSLILRACDGGDPIQ----------------CGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYE-SVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSF-----FMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEK--ILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKS---NLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVV---EYTINYIKYRNEIIKEKV--------FTINRKNGELFALTSLDREKYDVYKISLLL----TDKGNPPQTKEEI-ILVNIIDKNDNAPIWKFP 2100
            F I  K G   V+ +I+R E + +FK +     L   N KL+           +V I I D NDH PVF   W             +TP+ + K  D+ +  +   + + E    ++    E P  +N         +VP  G ++   + A D G P+                     K  I     N + P+F     +V V+E   +G+ + ++ A D D+G  G I Y +++ + S+H+         + + SG I +   L   +          +++ A D+G         MK+ I+D+N+H+PQ       D     L + EN      I  +   D D G NGK+   +  ++EK  ++   +  G  +++ S+      DRE + + T +I   D G P   +   + I + DVN++PP          I ED+  G     +   D+D  +N  + FL+     K+ F ID   G I I +    LD  K   + + I V D+       +TS  L V ++D   N          + I   +   +  +++    +++IG+  ++   + T +  K + E ++ ++        F+I++K G +     LDRE    Y I++      TD    P+ ++ + + + I+D+ND+ P+ K P
Sbjct:  436 FAIGSKNGILRVSAKINRSERVYNFKVIAS---LHGINEKLAEK---------DVSIEILDSNDHAPVFSAKWM-----------RQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHE------VLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQF------DEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSL------DREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNS--EKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGD--PILSTSCHLHVELVDIAHNH---------LAIEFDDVAKEASVYE----NSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQK-GTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKP 1049          

HSP 3 Score: 103.99 bits (258), Expect = 4.944e-22
Identity = 155/665 (23.31%), Postives = 278/665 (41.80%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALA------KDLDIGPNNIQEYKLEQPSD--IFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKIS----KNSGRIIL--NRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKP-KPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSN-NGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIA 2160
            E+  YF + E +G   VA ++DRE I  +K +  +      N  L  T            I + D+ND  P FE         E  +I+   P          KD D+ PNN+ ++ + + ++  +F ++     +L      K    V +   Y L + A DG   +     K+ I +    D+     ++   V ++E +  G+ +        +S L G    F    +S++  +V V  F+      K S +I    N++L+       F RL   D+ E   + + ++ ++IE++ND+ P+I  K  K  I +   +LP + D   YI  I+  D D  +  K   V   D+   L ++ + NG    + +++     D E    F +++   D G+       TI + + D N++ P    +   + + E  SIG E         D    I + ++ +    + +++ + G + +   LD E +    + +V +D+        T   + +SVMD NDN P      K +  ++ N    EK+  V ALD D      V Y +  +           F IN  NG++    S+D EK   Y + ++  D G PP   E ++ +++ D+ND+AP +       D  N+T +   G+ I 
Sbjct: 2753 EENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFT------------IVVSDVNDSPPQFE--------KEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLLL------KRPEIVENKMQYQLKVTAFDG---VFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVVLG------ESSLLGPNVTF---KLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLE-------FHRLTIQDNSE---VCKELITVVIENLNDNRPKIIEKLLKVSIDE---NLPTSEDARQYITRIVAEDADFDEI-KFRMV---DDFGGLFQIDDING----VVTVV--KPLDSEILGFFNLTVVASD-GE--FEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGV--PPLETEAQVEISVMDENDNAPKF-EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAIN-SNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTF-------DDCNMTALVQEGEAIG 3342          

HSP 4 Score: 98.5969 bits (244), Expect = 2.394e-20
Identity = 127/529 (24.01%), Postives = 216/529 (40.83%), Query Frame = 1
Query:  712 LSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKD--ATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            L++ V D ND PP F+   Y  ++SE    G  +  V ATD D     +I Y + +         E  FF +    G I + +KL+ K   +  + ++A DS   P      +++ I   +   P+ S          + S+ E+ D    IG +   + +I +  + + V   +E    L  S    +R    II   + DRE ++ + ++I     G     T+ T++  I DVN++ P  + + +   ISED ++G         D+D   +  I F + E     YF ++   G + + S LDREKID Y +     D       F T    T+ V D ND+ P        I++   +      I      D+D+  N V ++   +I   NE   E VF I+  N  L     +   K   Y++ +   D      TK +I L +  D +   P        N  + L + +  G ++         +L   NVT+ L+      + N+F ++   G ++V E
Sbjct: 2491 LTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDEN--DTIEYSLLD-------GSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNS------HYLFSVMEDADVGNVIGRVQQMETEIDEI-RFTIVPGSEESDSFLPFSV---ERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITTVTVD--IGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVE--ENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG----GFNTDLPFTIVVSDVNDSPPQFEKEEFNIDL---HLPSTSPILHFSIKDDDLSPNNVSQF---FIPKGNE---EGVFWIDSNNDLLLKRPEIVENKMQ-YQLKVTAFDGVFETSTKVKINLKSSKDSDIRCP------EANKTVILAENSKKGTVV-----LGESSLLGPNVTFKLSDN----DGNVFVVNFRNGIVKVKE 2967          

HSP 5 Score: 91.2781 bits (225), Expect = 3.711e-18
Identity = 87/356 (24.44%), Postives = 158/356 (44.38%), Query Frame = 1
Query:  718 IRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEI--FRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVI------NKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNIS-FLIQ-ETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYL 1755
            + V D NDN P F KS Y + V E  ++G E+  FR    D++     +I Y++       K S    F  ++  +G + L + LD +   +  + + A DSG  PL  +A ++I + D ND+ P+   K K      +  + EN+     +  +   D D    G VS  +        D   +   +++NGD      ++ + + D E    + + +  KD G+PPL +   +EI + D N+H P  ++      + E  +IG       V D D  +N + F ++ +      F ++ K   +  K  L+  K D+Y++ ++ +D K      TT   LT+ +   + + P +
Sbjct: 3101 VTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNE----TIEYYL-------KPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFE-KEK-----YVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGD------VLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLELLTAK-KLEYRKKDKYLLTVIAKDVKGK----TTDCPLTIFIRQTSRHAPTM 3428          

HSP 6 Score: 73.1738 bits (178), Expect = 1.316e-12
Identity = 107/500 (21.40%), Postives = 209/500 (41.80%), Query Frame = 1
Query:  649 NYSLILRACDGGDPIQCGHQKLSIRV-NDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNN-----------GDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQE-FFTVEVEDKDATRNISFLIQETINKIY--------FSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAP 2085
            NY+  + A +   P      ++ I V +    + P+F K +Y  +  E T++G  +  + AT  D     +I Y +  S     K +E     I   +G + +  +LD + T  + ++L A  SG+  +  +A   ++IED+ND  P+  I+      D    + ++     +I ++  TD D   +      ++++ +K+L K+ +            G+  +   +  +   + + + +  +S+T    G         +EI  S   + PP    +    N  E+  + +    TV V  K     + F +  T +            +IDRK G+I +   L+  +  RY I +VVED     T      +LT+SV+D ND  P+ +      +I E +    + +  V A D+D   N  +EY++       +  + + F+++ + G +     L+ +      +++  TD  NPP      + VNI  ++   P
Sbjct: 2150 NYTFEVEAREVTRPKMIAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSDEN--DTIEYSLSGS-----KDIE-----IHPETGDVTITGQLDYEKTQKYDLKLVATSSGKQ-VSSEAEFIVLIEDVNDEMPEF-IRS-----DVSAKISDSAITGQFITIMSATDMDTTNS------LDEESQKLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVT---DGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAV--KGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVED----ATGRRAFSTLTLSVIDINDKPPFFVLPFYSTSISE-SAKEGDTVMMVSATDDD--ENDTIEYSL------LDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVP 2606          

HSP 7 Score: 69.707 bits (169), Expect = 1.350e-11
Identity = 79/333 (23.72%), Postives = 151/333 (45.35%), Query Frame = 1
Query: 1390 QTIEICISDVNEHPPVINNNIKEVNISEDVSI---GQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEG-NYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKV-EPPLNSNIFKLH-ETQGTI---QVTEFLTLKMFVLHLQASDNGNTPLKS 2361
            + I + I ++N++ P I   + +V+I E++      +++ T  V +      I F + +    + F ID   G + +   LD E +  + + +V  D      +F    ++ V+V+D NDN P    S+  + ++E  + G +   F+    D     N  +EY   Y+K  +         +N + G L     LD E     K++++  D G PP   E  + ++++D+NDNAP  KF   +  +  + + +  G+ + T+ A D D+     V+Y L  V E   ++ +      + G +   Q  ++  +K + L + A D G  PL+S
Sbjct: 2995 ELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGGL-FQIDDINGVVTVVKPLDSEILGFFNLTVVASDG-----EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ----NETIEY---YLKPSDVT---SFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAP--KF-EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRS 3308          

HSP 8 Score: 67.0106 bits (162), Expect = 8.345e-11
Identity = 140/673 (20.80%), Postives = 255/673 (37.89%), Query Frame = 1
Query:  388 VEITIED-INDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDS--GLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLD----AKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDC--MLSLPENNDKNAYIGLIIVTDGDI-------GQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDY-GQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGN 2346
            VEI ++  I  H PVFE         E  SI     L   K      N+  EY L    DI       P   ++ +  +LDY+    + Y L L A   G  +     +  + + D ND  P F++S+    +S+    G  I  + ATD D+   L       +Y+ V   +       F IS  +G + L R ++            + +   D      M  A  K+++E +       S++P P       + +  EN   N    L +   G +             +   +K+   + +       DR    I  +   +   +  + I +  +D  G+   ST   + + + D+N+ PP         +ISE    G     V   D D    I + + +     +FS+  + G I +   L+ +      + I   D+       TT  ++ V++   +   P   NS  + +++E +  V   I +V  ++ +I     + +TI  +    E      F++ R  G++   +SLDRE+ + +K+++     G         + V+I D NDNAP +       +   +++    G  +    A D D   +  + ++L +  P      F L+E  G + V   L    +  + L  +A+D G 
Sbjct: 2171 VEIIVKSGITTHAPVFEKLKYTASTPESTSIG--QRLLTIKATTSDENDTIEYSLSGSKDI----EIHPETGDVTITGQLDYE--KTQKYDLKLVATSSGKQVSS-EAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDET-----LFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDG-----MFTAYAKLVVEILRSG----SMQPPPRFEQSHYVANALENTIVNKSALLTVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAI-------DRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFST---LTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATT--TVEVNIASESVKVPRFSNSHYLFSVME-DADVGNVIGRVQQMETEIDE---IRFTI--VPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAIT--TVTVDIGDVNDNAPAFH---GDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENP-----YFDLNENSGWLTVASQLDREKIDHYKLIARATDEGG 2792          

HSP 9 Score: 66.2402 bits (160), Expect = 1.408e-10
Identity = 112/555 (20.18%), Postives = 231/555 (41.62%), Query Frame = 1
Query:  703 HQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSI-NYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDK-NAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKV-SNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPV--INNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKP----YLLNSSKVINIIEGNYGVKEKIFQ--VFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTK--EEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLN----SNIFKLHETQGTIQVTEFLTLKMFV 2316
            H  + I+V+      P F  S Y  +VSE+ AVG++I+ + A+    G    + N F  + V+   K       ++  +SG +I+   LD +        ++     ++ +   A   + I D ND++P         +     +  + +D  +  +  +   D D G+NG V+  I    E+ L K+ + +G+ R+   +      D E + + +I +  +       S    + + I + NE P     +  + +  + +    G     +     +A  + +   +   N  +F +    G + + + L + K  + + C  + ++ + G Q      +   ++  N + P     +   +   N+  G+  + + +    V A+D D GSN +V Y +   K       E++F++++ +G +    S D EK   Y   +   D G PP+      +I+V +ID+ND  P  +FPS   D I++   T  G  +    A D D++   ++ Y +     P +    +    + ++ G   +T+   L++FV
Sbjct: 1346 HSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDK------IRVEPSSGNVIVMEPLDYEAARRIRAVVQVQ---QANMKSFATFSVNINDENDNSPYF-------VGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPL------DPELQHVESI-LRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVL-----NALHHGTVSYKLEPNCTFFEVHTLSGAVHLATWLTKLKHRKSVECTAIVESTE-GQQDIAK--VIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPK------DEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPP--RFPSNSLD-ISMILPTANGVSVGGQTAQDMDSV--GSLRYFIKDQSVPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFV 1858          

HSP 10 Score: 58.9214 bits (141), Expect = 2.556e-8
Identity = 59/234 (25.21%), Postives = 102/234 (43.59%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYF---RIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQK---LSIRVNDYNDNPPIFMKSEYMVNV 783
            +SV E++    +IG +++     E   + + F I    E+ + F    +   TG+  V   +DRE    +K    +D     +   ++TV             I D+ND+ P F  +++   I E  ++     +  A D D  P+    + L + +  F LN    +   L + S+LD +  D  +Y LI RA D G     G       +I V+D ND+PP F K E+ +++
Sbjct: 2615 FSVMEDADVGNVIGRVQQ----METEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITTVTV------------DIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGW---LTVASQLDREKID--HYKLIARATDEG-----GFNTDLPFTIVVSDVNDSPPQFEKEEFNIDL 2822          

HSP 11 Score: 56.225 bits (134), Expect = 1.500e-7
Identity = 113/571 (19.79%), Postives = 234/571 (40.98%), Query Frame = 1
Query:  718 IRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILN--RKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIG---LIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQT-IEICISDVNEHPPVINNNIKEVN---------ISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSP-----QNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM----FVLHLQASDNGNTPLK 2358
            IR+ D ND+ P+  K  Y+ +V+E +     I +V ATD D     +    M++      +S    FF+I   SG I  +  R+LD +      + +   D GE  L    ++ + + D ND++P  +            ++   + ++ + G    I   D D G+N +++  I + + +    + NNG+      IIA+       +  + +++   D+G P    + T + +  +   + P    N+  E++         IS+   +G     +E  D D    + + I        F + +  G++ +   ++  K     + I V D      Q     ++ + V      +P    S    ++ E    V  +I+ + A    +G+  +V    N     +  +++K+  +   +G +  +  LD E     + +++   + N          VNI D+NDN+P +   +      ++D ++         ++AT+ A+D D  EN  VTY++         ++FK+    G +++ + L  ++     +L ++A D+    LK
Sbjct: 1034 IRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQS----FFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFT-----------QAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGDAR--FSIDNNGN------IIASEAI--HGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDE-LWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDG-----QAWDHSTVIIQVSRQISQRPKFSASHYQTDVSE-RVAVGTQIYTLKASGESLGTKPLV---FNLFSVDDVAMEDKI-RVEPSSGNVIVMEPLDYEAARRIR-AVVQVQQAN--MKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVD--------DVLATVTAFDKDRGENGIVTYSIVSGN---EESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLK 1554          

HSP 12 Score: 52.7582 bits (125), Expect = 1.757e-6
Identity = 151/735 (20.54%), Postives = 290/735 (39.46%), Query Frame = 1
Query:   61 LIHLTNQISQDLKYS-------VKEESPPNYLIGNIKKDSRLSEKNSESLTFQIY--EDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPI--FMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDI--NDHTPQISIKP-KPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLST--SQTIEICISDVNEHPPVINNNIKEVNI----SEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIK-SNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALT-SLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDND 2184
            +I ++ QISQ  K+S       V E       I  +K         ++ L F ++  +D   ++  R+   +G   V   +D E     + V     ++ Q   +        + +    + I D ND+ P F  +     +DE  +++       A D D G N I  Y       I   N E  F ++     + L   LD   P+ ++   ILR             ++S+ + + N+ P    F +  Y   + + T  G+ +  + A       +G+++Y +  + +         FF++   SG + L   L  KL       +E     ES    Q + K+I + I  N H+P    +  +  I + M +      K+    ++   D D G NG V   +   +++ +  V     D+   +I    +FD E    ++  +   D GQPP  +     I + + D N+ PP   +N  ++++    +  VS+G +      +D D+  ++ + I++    + FS+D K G + +K SN   +    + + + V D KQ     + S+ + +S +   ++K     +    ++IE        I         I S A +   +++    N     + F I+   G + +   +LDREK  + ++ +        P     +++V I + ND  PI+   +P +  I  + I   G ++      DND
Sbjct: 1350 IIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGE--SLGTKPLVFNLFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAV-----VQVQQANM--------KSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYS------IVSGNEESLFKIDAKSGEVRLAKPLD---PELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALH-----HGTVSYKLEPNCT---------FFEVHTLSGAVHLATWL-TKL--KHRKSVECTAIVESTEGQQDIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSV-----DQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQ----TAQDMDSVGSLRYFIKD--QSVPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTDGKQ-----SASYVMKISTISTENSKFKFTRNEYHTSLIENTTLPPGSI---------ILSVATIGDKLDHFSIVN---PHEAFFIHPGTGVISSSGIALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIF-MGTPYDITIGHSDI---GTVVLEPKVIDND 2011          
BLAST of protocadherin-9 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 126.331 bits (316), Expect = 6.168e-29
Identity = 138/510 (27.06%), Postives = 219/510 (42.94%), Query Frame = 1
Query:  712 LSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQT-IEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTS-FSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTI-NYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPG-----QIIATIHAYDNDTLENANVTY 2211
            +SIR+ D NDN PIF  +EY + V E       +  V A+D DSG +G ++Y +    S+         F I+  +G +   + L       F + + A D G       A + I + D +  TPQ S + K +I      LP         G+ I   G +G   KV   I   ++       N   D     I      D +      ++I       P   ++QT + I I D N++PP  ++++ E++I ED+ + + F+ V+  DKD  +N  + + I  +       ID+  G++   S LD E    Y + +   D   LG    +S  +L + V+D NDN P    S   + ++E N   K  + +V A D D   N  + Y I N  +Y         F I+ K G ++   S+DRE      IS++  DKG PP++      ++++D NDN P           +++T I  P        I TI A D D   N +V Y
Sbjct:  627 ISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS---------FSINPVTGEVFAQKPLARG---RFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFS-RSKYEIRTTEDILP---------GIAI---GSVGAMSKVKYSIYSGDQD-----HNFSIDEDTGKIYVTRYLDADVHDTVLLNIQAT---LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATD---LGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLE-NSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY---------FGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP---------SCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLY 1081          

HSP 2 Score: 114.005 bits (284), Expect = 3.519e-25
Identity = 166/765 (21.70%), Postives = 318/765 (41.57%), Query Frame = 1
Query:   97 KYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPN-NIQEYKLEQPS--DIFGL---NYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENND----KNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSN-----NGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGN 2346
            K++V E +     IG I   S   E+++    F ++ DE+   + ++ E++GE      +D E    F  V     +K +               I++ + ++D ND+ P F      +EI E   +     L    D D GP  ++  + + Q +  ++F L           +L +  +LD +  D   Y L++ A DGG P + G  + SI + D NDN P+F +S Y  +VS   ++GS +  V ATD D G    I+Y + ++ +    +     F IS+ SG I     L    T    +   A D G   L   AV+ I +      +P + I          + L E+N     +N+ +G I+          +VS      + K+ L  S+       D   +Y ++     DRE  S   +    +  GQ  +   Q   + I D+N++ P  +++  +++IS + + G    T+  +D D  +N  ++    ++    SID++ G+I + + +D          +  ED        +T   +   ++D     P    +   + I E +  +   + +V A ++  G++  + Y++          +++  T++  +G +    + D EK   Y+ +++ T+  +  +T   +I + + D NDN PI+    P    + + +   P + +  + A D D+     V+Y +        S+ F ++   G +   + L    F L + A D G 
Sbjct:   28 KFTVPESAQIGTRIGWI---SGKREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVA----VKVEESG----------ETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGD-GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRD--KYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSN-----FAISQ-SGVITTTASLLPASTHDVIVV--ASDHGSPSLSSSAVVTITVLGSTLSSPPLDI----------IWLVESNSAHLMENSTLGSIV---------ARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQL--LTIGDINDNAPQWHSS--QIHISLNRTQGGS-RTLTAKDPDLGQN-GWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGS--PALSTDLQVVADLLDTESKPPQFEKALWQVEIPE-DTPIGTCLVKVVANNSQCGNSKRIRYSLQN--------QDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANS--ETSTSLISIRLKDVNDNWPIFY---PNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILS-----ESSSFSINPVTGEVFAQKPLARGRFHLVVSAKDGGG 718          

HSP 3 Score: 98.5969 bits (244), Expect = 2.033e-20
Identity = 130/501 (25.95%), Postives = 209/501 (41.72%), Query Frame = 1
Query:   97 KYSVK--EESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL--EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQ-ISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSI 1584
            KY ++  E+  P   IG++   S++         + IY  ++  N F I E TG+ YV   +D        +V D+  L  Q      T+   + +   V I IED ND+ P F  +   I I E + ++    +  A D D   N    Y +    P     ++    F   L   S LDY+    +NY L ++A D G P +  +  L I V D NDN P F KS Y + V E +   + + +V+A D+DS   G I Y     ++N  +     +F I +  G +   R +D ++     + + A D G  P    A  +I + D+ND+ P  +SI P        + +P  +  +  IG I+  D D G NG  S +     +  L  V +NGD      +      +   E    +S+   D G P  S    + + IS  +    +     K + I +    G    T+     +AT   S+LIQ +    +F+I
Sbjct:  745 KYEIRTTEDILPGIAIGSVGAMSKVK--------YSIYSGDQDHN-FSIDEDTGKIYVTRYLD-------ADVHDTVLLNIQ-----ATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQ---FTGQLSTGSLLDYEAT--RNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVY----RITNGSE-----YFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITP--------IVVPAGSPLSTAIGTIVAMDPDKGLNG--SVLYRAQLQSSLFVVKSNGD------VYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQEPFQKYIEIPKSCPTGCRLTTL-----NATGVSSWLIQSSEISNHFAI 1189          

HSP 4 Score: 88.9669 bits (219), Expect = 1.676e-17
Identity = 126/561 (22.46%), Postives = 227/561 (40.46%), Query Frame = 1
Query:  610 LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTP-------QISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVN-EHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGEL----FALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNI--IDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNI 2250
            +++ L+ D    + YSL +     G  I     ++ +RVN+ NDN P F  S+    V E   VGS +  V A D D+     + YF+    S    +     F I + +G I L   LD ++ P   + ++A D           + I + DIND+ P       Q ++ P    P    +  E +D +A   L       +GQ       +  +   + +KV     +R                  + +++T  D G P  STS  + + I +      P          + E+  IG +   +  E+   +R   + IQ+      FSID KFG++ +   +DRE+  R      VE + ++ T         V V+D NDN P   + +  ++ ++ +    +KI Q+ A D D G N  V Y    I   N++    + T+N   G +    +    LD      ++I +   D G+P +     + V++     + +AP +  P  +  ++  T +   G ++  I A +   + N  + Y+L + +  L  ++
Sbjct: 1882 IRTNLELDREILERYSLKVIGTGSGQQIGT---RVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDN--LAPLRYFLVSDSSGQTPT----HFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTY----SLGQGSSSIFRVAPESGALFMKVLPPAGER------------------YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEE---SREFHYRIQDPEASKIFSID-KFGRLFVAGPIDREQ--RATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLS-LKDSMAHGQKIGQIMASDQDSGENGRVSY---RILSGNDL---NIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSV---GTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDV 2391          

HSP 5 Score: 78.5666 bits (192), Expect = 2.569e-14
Identity = 121/543 (22.28%), Postives = 216/543 (39.78%), Query Frame = 1
Query:  379 WINVEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQ-PSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYN-DNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVS-----------CVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICI--SDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINI-IEGNYGVKEKIFQVFALDNDIGSNAVVEYTIN------YIKYRNEIIKEKVFTINRKN 1938
            + N+ I + DIND+ P F +P ++        S     P A  +  D+       Y L Q  S IF +  E   +    L        P G+ Y + + A D G P       +S+ + +    + P F K+E+   V E + +G +I           L G  +   +  + + + S     F I K  GR+ +   +D +   +   ++E  +   +    Q    +I+ D ND+ P  +           LSL ++      IG I+ +D D G+NG+VS             +N D   I L   N+               D    + + I +  +D+G P  +    +++ +  S  +   P     + EV++ ED S+G     +   ++   RN   L     ++    ID K G++ +K++LD E      + + V D    G   +    L + V   ++  P    SS  + I I    G  E + Q+ A+D D G + VV+Y+I+       I+    II+ +   ++R+N
Sbjct: 2012 FTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPG--QPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGALFMKVLP-------PAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQI---------GNLSGEESREFHYRIQDPEAS---KIFSIDK-FGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVA------YYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQ------------LDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSD----GNGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAG--ESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPLVSRRN 2508          

HSP 6 Score: 77.7962 bits (190), Expect = 4.020e-14
Identity = 112/472 (23.73%), Postives = 204/472 (43.22%), Query Frame = 1
Query:   91 DLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICS--FKEVGDSDPLKAQ--NCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSD--IFGLNYEPPFI-LNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQC--GHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDS-GESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTI--EICISDVNEHPPVINNNIKEVNIS 1470
            + ++ V E S     IGN      LS + S    ++I +D E    F I +K G  +VAG IDRE   +  F+   D++ + +Q   CK  + V               D ND++PVF      + + + ++   +    +A D D G N    Y++   +D  I  LN +   I LN +  ++LD + P+   + +++ A D G P +   G  ++S++++ ++ + P F+   Y V+V E T+VG+ + ++ A++R     G  N  +  S+  H+         I   +G + L   LD +  P   M L   D  G S ++    +KI++E +++  P  +           L +P +      +G +   D D G +G V   I+  +  + ++  + G  R+   +++      E        IT   Y  P   +  T+  EI   DV    P +  + K V I+
Sbjct: 2135 EFRFEVMENSKIGLQIGN------LSGEESREFHYRI-QDPEASKIFSI-DKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVL--------------DENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLD-EFPNA-TWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNR----LGMRNDGLLYSLKEHQGK-----LGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVP---LKIVVEPVDEFAPVFTKS------SYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIE-EHTGIIRLQKPLVSRRNLTIE-------QITVVAYSSPTKQSKTTVYLEIGPFDVQPSLPKLLLHSKPVQIA 2556          

HSP 7 Score: 62.7734 bits (151), Expect = 1.594e-9
Identity = 122/503 (24.25%), Postives = 211/503 (41.95%), Query Frame = 1
Query:  910 VPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESL--FTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEV---NISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIV-VEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTL-----KMFVLHLQASDNGNTPLK-SVPTTLTI 2382
             P F I+  +G I +   LD + +    + +   D G         +++ + D ND+ PQ+      +     L + E++     +     +D DIGQNGK S  + +D    L  V   GD  +           R   SL  + I +   D+G P L   + +EI   +           +K+     I E +  GQ  F  +++ + A   +++ I E      FS+D + G I+    LDRE ++RY + ++     +Q+GT+      + V V + NDN P     SK   + E N  V   +  V A   D+ + A + Y   ++   +       F I++  G +     LD E    + +++  TD      T   I + +I   NDNAP +  P  Q  +   T    PGQ  A I A+D D      +TY+L +     +S+IF++    G +    F+ +     + +++ + A+DNG      SVP ++ I
Sbjct: 1670 APKFSINSTTGSISV-LPLDREASQEHLLIIILTDGGSR--NDSCTVRVTVADQNDNKPQLDASTPSE-----LEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVL-----------RRLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQ--FIAKLQPELA--GLTYSIVEGNIDSAFSVDSE-GVIRTNLELDREILERYSLKVIGTGSGQQIGTR------VDVRVNNLNDNVPS-FPMSKPRRVPE-NLRVGSYVATVGA--KDVDNLAPLRY---FLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDI---NDNAPTFSKPLYQTTVSPAT--FSPGQPFAKIEAHDLDA--RGALTYSLGQG----SSSIFRVAPESGAL----FMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVII 2120          

HSP 8 Score: 54.6842 bits (130), Expect = 4.986e-7
Identity = 145/638 (22.73%), Postives = 252/638 (39.50%), Query Frame = 1
Query:  106 VKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVP-VFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGR------IILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV--------SCVINKDEEKILLKVSNN---GDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVE-DKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTS 1962
            V E SPP  ++G +    + S +N + + ++I    E   YF I EK G  Y    IDRE I S  ++     + A++  +      P+    +  I++ D+ND+ P        V+     +S    T +A+  D D G N    Y+ +  S +F +        ++YL+ +L+    D ++  L +   D G P +     + +R++  + +  I    +  + + +    G  +  + AT   S L  S        +SNH    E   F IS    R      I+L+ K D +   S  +R+ A         G+A  K       + T +IS                  D N+ IG  I   G+   +G          SC +  D+   LL +++    GD          H F    E   T   + ++           +++ IS      P  +     VNI ED   G    TV      D+   IS+     I+   FSID+  G I +   L       Y + +     +   +   T+  +TV+V D ND+ P++++   V  ++  +Y     + +V A+D D   +  + Y++ Y    +E+ KE  F I+ K+GE+F + S
Sbjct:  951 VLENSPPKTIVGKVVARDKDSLENGQ-IVYRITNGSE---YFGIDEKLGNVYTKRSIDREVI-SHVDIS----IVAEDKGVP-----PRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAM--DPDKGLNGSVLYRAQLQSSLFVVKSNG----DVYLRRQLN--ASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQEPFQKYIEIPKSCPTGCRLTTLNATGVSSWLIQS------SEISNHFAIREGVLFMISHPIHRPPYSLVIVLSDKNDRQ--KSIQLRVLAS--------GEAANK-------EETIRIS------------------DSNS-IGTKIGRLGEKSADGSFFYRFSSEESCPLELDQTGGLLYLADGLRRGD---------THNFSCFFEKFNTTDGSAEEM---------RVDLEISRTKSDKPRFDTGHLRVNIREDTPTGSIITTVNATVSDDSASPISYRFPLLIDN--FSIDQFTGDITLIDTLHWHVTPTYNLIV-----EAFTSGPGTTLLVTVNVDDVNDHTPFIVSQPTV--LLPSSYRKGGMVHRVVAIDLD--KDPEIRYSLKYAG--SEVAKE-FFKIDEKSGEIFVVES 1492          
BLAST of protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 120.168 bits (300), Expect = 4.840e-27
Identity = 167/669 (24.96%), Postives = 279/669 (41.70%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVF----VPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFIL-----NLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNV-SEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLD---AKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDK-----NAYIGLIIVTDGD--IGQNGKVSCVINKDE----EKILLKVSNNGDDRMIYSIIANHTFDRE--AESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEF--FTVEVEDKDATRNI-SFLIQETINKIYFSIDR-----KFGKIKIKSNLDREKI---DRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAP-IWKFPSP 2106
            E+  +FRI E TGE +   + DRE I       D   L  +    S++       P +  + V+I I D+ND+ P FE    +  + E      +     A DLD   N    Y L     I       PF +      +++K  LD++  D   Y L+L A DG          + I + D NDN P F + +Y   V  E   +   +F V ATD D     S   +  E     + + EV  F+I K SG I L + LD       PS+   ++A D   + L+G A +++ + DIND++P          P+ +    E N +       Y   +   D D    +N  +   I +++    E +     N G       I A  + DRE  +E  F I +   D G P       + I ++D+N++ P       E ++ E   IG     F+    D++A  N+ ++ + E  +  Y + D+       G +++K  LD E +   D + + I V D +          ++ V+++D ND+ P++  +++  + +  +      I +  A D D G  A   + IN      +   ++ FTI+ ++G L    +LDRE   VY + +   D  N      +++ V + D NDN P  +  P P
Sbjct: 1266 EETKHFRIDELTGEIFPNEKFDREKI-------DMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHL-----IGAGGGRIPFGVRTDSGTIFVKEPLDFEASD--QYHLVLIASDGR---HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEG----QGADEV--FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPI--------FPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTG------KIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH-----DAEAAVHVALVDRNDHAPHIHGATE--HRVREDVPRGTSIGRYTATDRDAGDTA--RFRIN-----RQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPEPYTVPRP 1878          

HSP 2 Score: 118.242 bits (295), Expect = 2.245e-26
Identity = 145/572 (25.35%), Postives = 253/572 (44.23%), Query Frame = 1
Query:  736 NDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATD----RDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKL---DAKLTPSFFMRLEAH-DSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQP-PLSTSQTIEICISDVNEHPPV-INNNIKEVNISEDVSIGQEFFTVEVEDKDATR-NISFL---IQETINKIYFSIDRKFGKIKIK---SNLDREKIDRYI-ICIVVEDNKQL----GTQFTTSFSLTVSVMDANDNKPYLLNSSK---VINIIEGNYGVK-EKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL--DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTL----TKVEPPLNS-NIFKL-HETQGTIQVTEFLTLKM--FVLHLQASDNG 2343
            ++ PP F K EY V VSE   V   +  V A       D    G I Y    S+       E  +F+I  ++G I L R L   D  L     +++ A  D+ ES       + I I+D+ND+ P  +       P     + E+   N  I  +   D D G N +++  ++         +++NG+      + A+   +R    ++  ++T +D+G+P  LS+S  I I   + N+   V +  +     ++ED   G     ++  D D      SF+    + T     FSID   G +K++   S  D  + +  I + ++V+D+           T+  +L + + D N+NKP   + +K   +  I+EG Y      I +V A D+D  +N  + Y++ Y +  +     K F I+R+ G L     +  DRE      +++  TD+G+ P        V ++D NDN+P ++ PS +  +     +   G  + T+ A+DND   NA +TY+L    T  E   N  + F+L +   G I + + + +K   F+ ++ A DNG
Sbjct:  524 DERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITY----SLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRES----HVDLTIRIDDVNDNVPTFT------RPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN----FSINSNGEISAKVRLDADQLNERHF--VYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES----RKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAV---GTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNG 1068          

HSP 3 Score: 95.9005 bits (237), Expect = 1.398e-19
Identity = 151/602 (25.08%), Postives = 243/602 (40.37%), Query Frame = 1
Query:  520 GPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAV--------GSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQ-------AVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSC-VINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVN-ISEDVSIGQEFFTVEVEDKD----ATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDRE---KIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNY------GVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEII-KEKVFTINRKNGELFALTSLDRE--KYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANV-TYTLTK 2223
            GP N  E K  Q +     N      + + +   LDY+  +  NY+L L A D    +    +   + V D ND  P F    +   + E+           G  I  V A D DS   G  N   Y  V       E   F+I + +G I  N K D +    + + +EA D   S L G          ++I+I D+ND+ P  S + +  I     S  E +D      +I +   D+ ++  +   +I     +I   V  +       +I      D EA   + + +   D G+   +T+  + I I DVN++ P           I EDV I +  F V   D D    ++R +  L  +  +++ F I +  G I++   LDR+    +  +   +   D+   G        + V+V D NDN P      ++   IE N       GV     Q    D+    NA +EY I     RN++I  E VF I++  G++FA+ SLDRE      + I +   D+G P +     + + + D NDNAP ++    +  +     I   G  + +  A+D D     NV TY L++
Sbjct: 1140 GPGNKAESKFRQFNKFENGNE----WVEVVIMEGLDYEQVN--NYTLTLTATDMTSRV-ASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSD--GPQNEVHYRIVG-EANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAP--SFEEQKYIGRVKESEGEGHD------VITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSG-----TIFVKEPLDFEASDQYHLVLIASD-GRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV-FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDD--GNGLVGYADVQVNVRDINDNSPIF--PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGI----VRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPI---GAAVMSFSAFDADEEAKDNVFTYQLSE 1703          

HSP 4 Score: 94.7449 bits (234), Expect = 2.845e-19
Identity = 182/818 (22.25%), Postives = 343/818 (41.93%), Query Frame = 1
Query:   88 QDLKYSVKEESPPNYLIGNIKKDSRLSEKNSES---LTFQIYED--EEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVP-KEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKN--YSLILRACDGGDPIQCGHQKL-SIRVNDYNDNPPIFM-KSEYMVNVSEKTAVGSEIFRVIA--TDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLD----AKLTPSFFMRLEAHDSGESPL------MGQAVMKIIIEDINDHTPQISIKPKPDIPDC-----MLSLPENNDKNAYIGLIIV--TDGDIGQNGKV--SCVINKDEEKILLKVSNNGDDRM--IYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLI-------QETINKIYFS--IDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNS--SKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINR-KNG----ELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWK---FPSPQNDII----NLTKITYPGQIIATIHAYDNDTLENAN-VTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPL 2355
            Q+ + +V E++  +Y + ++K  S  S ++  S   +T+ +  D  E++  +FRI   TG  ++   +D +           DP   +  KL +T     +E  +++ I I+D+ND+VP F       ++ E + +N       A D D G N+   Y ++  +     N E      +  K +LD D  + ++  Y   + A D G+P+      +  IR  + ND   +F+  S+Y   V+E    G+ + ++ A   DRD   Y     FM +   N + + ++  F I +++G + L   +     A+      + +   D G   +         A + I IED+N++        KP+ PDC     +  + E   K     ++ V  TD D   NG +  S    + E +    +     DR   + +   +  FDRE      +++   D G  PL       + + D+N++ P       E ++S   ++G    TV   D DA  N  I++ +       +E  N + F   ++R+ G+I +   +   K  ++I  ++ +DN  +     +S  +T++V+D     P    S   K    ++ N  + + I +  A+ +    N+ V Y +          + K    N+ +NG    E+  +  LD E+ + Y ++L  TD  +   + +  + V + D ND  P +    F    ++ +    +L K    G+ I T+ A D D+    N V Y +        +  F++ E  G I   E      + M++L ++ASD   + L
Sbjct:  533 QEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFD-----------DPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGE------ISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYS----FMDK---NGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNN--------KPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVI-----DRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNG-IPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTN--GKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSAL 1308          

HSP 5 Score: 94.3597 bits (233), Expect = 3.761e-19
Identity = 139/580 (23.97%), Postives = 247/580 (42.59%), Query Frame = 1
Query:  658 LILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFM-YESVSNHKKSVEVPFFK-ISKNSGRIILNRKLDAKLTPSFFMRLEAHDSG-ESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCM--LSLPENNDKNAYI-GLIIVTDGDIGQNGKVSCVI-------NKDEEKIL-LKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSI--------GQEFFTVEVEDKDA---TRNISFLIQETINK---IYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTS-----FSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL 2298
            + ++A D GD    G  + S+ V D NDN P F +  Y  +VS   AVG+ +  V A D D+     I Y +  ++ +  +   ++ FF+ +++ SG I L + +  K T  F   + A D+G    L   A + + + D     P+         PDC   +++ EN + N  I     V+ GD  +N  V   +       NK E K        NG++ +   ++     D E  + +T+++T  D     +++++T  + + DVN+  P    ++    I E+++         G+   TV+  D D+      + + I    N     +F ID   G+I      DREKID YI+ +   D                  + + + D NDN P      K I  ++ + G    +  + A D D  SN  + Y +  I      I    F +   +G +F    LD E  D Y + L+ +D  +   T    + ++I D NDNAP ++       +I    +  P +++  +HA D D  E +  +  + ++E      +F++ +  GTI++ + L
Sbjct:  947 VTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK-TQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTS-----PDCKPGITVDENVELNKVILRCRAVSSGD-SRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWV--EVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPS-FEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHL--IGAGGGRIP---FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQFEQQKYATTVIE-EDVDIP-KVLFNVHATDADQDEKS--SRIVYRLEGQGADEVFRIGKYSGTIELVKAL 1501          

HSP 6 Score: 70.0922 bits (170), Expect = 1.101e-11
Identity = 80/306 (26.14%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  220 KNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDI-GPNNIQEYKLEQPSDIFGL----NYEPPFILNLYLKSKLDY-DVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPP-IFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDI 1116
            ++ FRI + TG+ +    +DRE I S +E      ++A +  +       +E + NV I + D+ND+ P FE       ++E   I        A D D    +N+  Y+L + SD F +    + +   +  L +K  LDY DV     + L +R  DG    +     + + + D ND+ P I   +E+   V E    G+ I R  ATDRD+G       F     S+ K+      F I ++ G + +   LD +    + + +EA+D+  +  +G+ ++ + ++D+ND+ P+    P+P I
Sbjct: 1599 ESVFRIDQNTGKIFAMRSLDRE-ISSEREF--IIEVRANDRGVP-----SREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAA---VHVALVDRNDHAPHIHGATEH--RVREDVPRGTSIGRYTATDRDAG---DTARFRINRQSDPKRQ-----FTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSNN--IGRQMVAVYLQDVNDNGPEPYTVPRPCI 1880          
BLAST of protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 228.409 bits (581), Expect = 1.589e-60
Identity = 204/720 (28.33%), Postives = 334/720 (46.39%), Query Frame = 1
Query:  247 TGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL--EQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIG-QNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQET--INKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINY-IKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIW---KFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVT--EFLTLK---MFVLHLQASDNGN 2346
            TGE     ++DRET  S+  V  + PL  +N              I V +T++D ND+ P F      IE  E      +  L  A+DLD+ P N Q Y +     +D F L+     +    L+L +   LD +   G  YSL++ A DGG P   G   ++I + D NDN PIF +S Y   V E   VG+ + +V A+D D+   G + Y +     N ++S +   F+I   +G I +N+ LD +      + + A D GE PL   A + I + D+ND+ P I++    D  D    + E+     ++  I V D D   +   V+  +N  +    L   +N     IY +I +   DRE  S +T+S+   D G PPL  S++I + I+DVN++PP    ++   N+ E    G     V   D+D   N  +++ + ET   +  +F ID + G I  +S++D E      + +V  D        +++ ++ V++ D NDN+P    S   +++ E N  V   I +V A D D G NA+V YTI    K+  E      F +   +GE+     LD E+   Y+  +L TD+G    T   +I + + D NDN P++   ++     +    +       I+A + A D D      V+Y +        + IF++  + G I V   + L+++   M +L++ A+D GN
Sbjct:  129 TGEIRTKVKLDRETRASYSLV--AIPLSGRN--------------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPG--YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI-----NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSD--DASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNS----IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGV--PPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAE-NEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE------FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTA--MIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGN---EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN 804          

HSP 2 Score: 212.231 bits (539), Expect = 2.067e-55
Identity = 214/801 (26.72%), Postives = 365/801 (45.57%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQ---NCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL--EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYES----VSNHKKSVEVP-FFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHT-FDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKE-VNISEDVSIGQEFFTVEVEDKDATRNISFLI-----QETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDN--DIGSNAV--------VEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISL--LLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNS------NIFKLHETQGTIQVT---EFLTLKMFVLHLQASDNGNTPLKSVPTTLTIR 2385
            Y VKE+ P   ++G++   S      S  + + IY  +    YF I   +G   +A  +D E              K+Q   N + +L    P      V I +ED+ND+ P FE +   I + E   +      A A D D G +    Y L  E    +F ++       +L L   LDY+    + ++LI+ A DGG P    +  + + V D NDNPP+F K EY VNVSE  ++ ++I +V A+D D+G    I Y + ++    V+N   S +V   F I  NSG I L   LD +    + + + A D+G      +  + + + D ND+ P+   K K +       + EN  + + +G++  +D D+G+N  +           LL ++++     +   I+     DRE   L+ + +  +D G P  S    + I +SDVN++ P I +  ++ V++ E+   G E   V   D+D  +N S        +++     FSID   G I+ +  LD E+   Y + +   D      +  T   L V V+D NDN+P   +SS V  + E +  +   +  +  ++   D+  N+V        V YT+N +    + + E  F I+R +G L     LDRE    +++ +  L T   N PQ+    + + + D NDNAP W    PQ+ I + +++ T  G II    A D DT  N ++ Y L +  P LN       ++F++    G + +    +F  ++ ++L +QA D  +   + + T++T+R
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRS-PVRYSIYSGD-PDGYFSIETNSGNIRIAKPLDHEA-------------KSQVLLNIQATLGE-PPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG---HLILSQHLDYE--SSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ-KSKYE-----FRIEENLRRGSVVGVVTASDLDLGENAAI--------RYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRE--TVRMLRVEVLDLNDNRPTFTSSSLVFRVRE-DAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPL---TKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW----PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVR 1589          

HSP 3 Score: 207.994 bits (528), Expect = 4.772e-54
Identity = 197/736 (26.77%), Postives = 327/736 (44.43%), Query Frame = 1
Query:  229 FRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFE---TPLA--LAKDLDIGPNNIQEYKLEQPSD--IFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLI-----QETINKI-------YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQ---VTEFLTLKMFVLHLQASDNGNTPLKSV 2364
            F +   +GE  +AG +D E   S+    +   L      LS T  +        ++ + D+ND+ PVF P    + + E    + +   TP+   +A D D G      Y++   ++  IF ++        +++       V     + L + A DGG+        + + + D    PPIF K+ Y   V E    G+ +  VIA   D      + Y +Y    +        +F I  NSG I + + LD +      + ++A   GE P+ G   + I +ED+ND+ P+       +     +S+PE+ +  A +      D D G +G+V+  + K+  K L  +    D R  + I++ H  D E+    T+ +T  D G P LST+ TI + + DVN++PPV   +   VN+SE  SI  +   V   D D   N  I++ I         N I       +F I    G I +++ LDRE  DRY + ++  DN        T   + V V+DANDN P     SK    IE N      +  V A D D+G NA + Y++  I           F ++   GE+     LDRE  ++Y + +   D+G P ++    + +++ D NDNAP  +   PQ D++++ +   PG  +  + A D D  +NA++TY++ K        +F +  T G I+   V +     ++ L + ASD GN P ++V
Sbjct:  660 FEVRSASGEICIAGELDFERRSSY----EFPVLATDRGGLSTTAMI--------KMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTG---EIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG-------YFSIETNSGNIRIAKPLDHEAKSQVLLNIQA-TLGEPPVYGHTQVNIEVEDVNDNAPEF------EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI----DARSGHLILSQH-LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKT--RVIVRVLDANDNDPK-FQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN--------SSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAP--EIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETV 1348          

HSP 4 Score: 164.466 bits (415), Expect = 1.938e-40
Identity = 186/777 (23.94%), Postives = 322/777 (41.44%), Query Frame = 1
Query:  112 EESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE-----------QPSDI---FGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANH-------TFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVE----------------VEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYT-INYIKYRNEIIKE--KVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEI---ILVNIIDKNDNAPIWKFPSPQND-----IINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL 2298
            E   P Y      KDS  S + + SL       E  K  F I  ++G   ++  +D E+      +  +      +   +LT+ V           ++D+ND+ PVFE +   + + E  SIN +     A DLD G N    Y++              SD+   FG+     +I   YL++ LD +  D   Y L + A D G P      ++ +RV D NDN P F KS+Y   + E    GS +  V A+D D G   +I Y +    S+         F++   +G I     LD +L   + + +EA D G      +  ++I + D+ND+ P+I+  P+ D+    +S+ E       +  +   D D GQN  ++  I K           + D   ++SI             D E  S++ + +   D G PP  T + + + + D+N++ P   ++     + ED ++G    ++                  ED   T  ++ L ++ I +  F IDR  G + +   LDRE    + + I   D        +++ ++ + V D NDN P        + + E    V   I    A D D G+N  ++Y  I Y    NE  ++   +F ++   G L     LD E    Y + +   D+ +    + +    + + I+D ND+AP   F SP +       + ++  T  G+++A I A D D+ +N  +TY +T          F+++   G I++ + L
Sbjct:  945 ELGAPLYAAHAHDKDSGSSGQVTYSLV-----KESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILV----------DVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWI---YLRAPLDRETRD--RYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS---------FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIA-DPQEDV----VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK---------GRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLI-EAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEAT-PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAP--HFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN---GEGRFRINSQTGIIELVKSL 1671          

HSP 5 Score: 147.132 bits (370), Expect = 4.202e-35
Identity = 200/799 (25.03%), Postives = 314/799 (39.30%), Query Frame = 1
Query:  223 NYFRIVEKTGEFYVAGRIDRETICSF-----------KEVGDSDPLKAQNCKLSLTVFVPKEHW--INVEITIEDINDHVPVFEPN----WKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLK--SKLDYDVPDGKNYSLILRACDGGDP-IQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAV-MKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVI--NNNIKEVNISEDVSIGQEFFTVEVEDKDATRN-ISFLIQETINKIYFSIDRKFGKIKIK---------------SNLDREKIDRYIICIVVED----NKQLGTQ---FTTSFSLT----------------------------VSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFT-INRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKSVPTTLTIR 2385
            + F +  + G     G+ DRE+  S+           +    S  ++ Q    S+      +H+    + IT+ D+ND+ P F P       V E  E   I+      +A DLD GPN    Y       I G N    F ++      S    D      Y+L ++A D G P  + GH  ++I V D NDN P F  S+Y  +V E   +G+ + ++ A D D G+   + Y    S++N  +      F I   SG I    KLD +L  S+   + A D G   +    V ++I + DIND+ P     P       +  +P        +  +   D D+G N ++   +N +   +  K   N       ++ A+ +   E+  L  + +  +D G PP S+   IE+ I +  +  PV+   N    V + E+   G     V     D  R  + F           S+D   G+I++                S L R +   Y   I        N    +Q    ++SF+LT                            + + D NDN P       V  + EGN      + QV A D+D GSNA + Y I    + N  + E  F+ I R N        LDRE  D+YK+ ++ TD+G P  T    I V I+D NDN P +    P N+++ +++ T  G +I +I A D DT                 N +IF L    G + +   L  ++   + L + ASD  +       T LT+R
Sbjct: 1765 DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIH----TVVASDLDEGPNADLIYS------ITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVY----SLANETQWQ----FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY------IGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTG---ALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGN-NKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTN------IVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF----PPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH----EARTVLTVR 2521          

HSP 6 Score: 130.568 bits (327), Expect = 4.026e-30
Identity = 191/830 (23.01%), Postives = 345/830 (41.57%), Query Frame = 1
Query:   85 SQDLKYSVKEESPPNYLIGNIKKDSRLSE--KNSESLTFQIYEDEEKKN---------YFRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL-----------EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQK---LSIRVNDYNDNPPIFMKSEYM------VNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKL-----DAKLTPSFFMRLEAHDSGE-SPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYG-QPPLSTSQ----------------------TIEICISDVNEHPPVIN-NNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKI--YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTI-NYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEI-ILVNIIDKNDNAPIW-KFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKSV 2364
            S  L + V+E++   +++G+I    R ++  +NS   +F+        N          F I   +G   VA  +DRE    F+ E+   D   + N         P+   I V+I + D+ND+ P +  +   +++ E   +        A D D G N   +Y+L           EQ   +F ++        L L++ LD++    + Y LI++A D    +    Q    + +R+ D ND+ P F+           + +S+ T +G  +  ++A D DSG  G + Y +       +       F+I+  +G I L + L     D +    F + + A D G+  P      + +I++  +++ P+              ++ EN    +++  +        +N  +S  I       L  V     D     I     FDRE+++ + + +  +D   Q  LS+S                       TI I + DVN++ P     +   +++ E+   G    TV   D D   N   +   T   +   FSID   G++  +  LDRE+  RY + I   D  Q  ++     ++T+ V D NDN P     SK    ++ +  +   + Q+ A+D D+G NA + Y++ N  +++        F I+ ++G +  +  LDRE    Y   +L TD G        + + +N++D NDN PI+ ++P     I  +  +  PGQ +  + A D D   NA + Y+L   E    S  F+++ + G +  ++ L   + K+  L + A D GN P  S+
Sbjct: 1367 SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNN---------PQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMD---SLTGALSLQAPLDFEAV--QEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR-------FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVY------RATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHV-----DWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQASDRGQPKSR-QGHCNITIFVEDQNDNAPRF-KLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--------FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY----IGQVPALIQPGQTLLKVQALDADLGANAEIVYSLN-AENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSL 2147          

HSP 7 Score: 128.257 bits (321), Expect = 2.603e-29
Identity = 180/752 (23.94%), Postives = 307/752 (40.82%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEY-----KLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKIL-LKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQE-----FFTVEVEDKDATR--NISFLIQETINKIYFSIDRKFGKIKI--KSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQ------VFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP-----GQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKSVPTTLTI 2382
            +K+  FRI  +TG  Y+   +D ET    KE+ +   +   + +       P E    V I + D+ND+ P     +   +   ++S + +    +A+     P++  EY      L      F L      I  + +   LD ++    NY+L + A D G P     + + +R+ D NDNPP F +  Y  NV E    G+ + +V+A DRD GL  ++ Y + E+   H +     +F+I   +G I     +D +  P   + + A D G  PL   A + + I D+ND+ P        D     +S+ EN      I  +  +D D G N  V+  I +  + +   +V +   +     I      D E  S +   +   D G   LST+  I++ ++DVN++ PV      +V++ E      +        V   D D      +S+ I        F IDR  G+I +     L       +++ I   D   L +       L  S++DA    P       +      NY VKE I +      V A   D+   + V Y+I    Y  +   +  F+I   +G +     LD E      +++  T  G PP      + + + D NDNAP ++         ++ +I+ P     G  +   HA+D D+  +  VTY+L K        +F +    G + +++ L   + +   L + A+D G   + S+ T LTI
Sbjct:  331 DKEQMFRIDPRTGAIYINKALDFET----KELHELVVVAKDHGEQ------PLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIV--SNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQ-----WFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF------DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGE-----ICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFL--SIIDAMQRPP-------IFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI----YSGD--PDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFE--------ASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKES---GKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGG---VPSLSTNLTI 1022          

HSP 8 Score: 125.946 bits (315), Expect = 1.168e-28
Identity = 161/672 (23.96%), Postives = 272/672 (40.48%), Query Frame = 1
Query:  196 QIYEDEEKK-NYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF-EPNWK-----VIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE--QPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDP-IQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSG-ESPLMGQAVMK----------------------IIIEDINDHTPQISIKPKPDIPDCM-LSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQ-TIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDA---TRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKF 2097
            Q+ E +E+  + FR+   TG   +   +D E +  +        L  Q    S  V    +  + V + I D NDH P F  PN        + I +   I       +A D D G N    Y++        F +N +   I  +        DV  G  ++LI+ A D G P  +     L + V   ++NPP F+++ Y   + E    GS + +V A         +++Y +   V+N         F +    G I    + D +   S+ + +   D+  +S L   AV K                      I + D+ND++P+     +P    C  LS+PEN++    I  ++ +D D G N  +   I          + ++  +      ++    DRE  S +T+ I   D GQP        I I + D N++ P    +    ++ ED  +G     +   D D     R +  L  ET  +  F+ID + G I     LDRE    Y   ++  D  +   + + +  + ++V+D NDN+P +      I  +       + + +V ALD D+G+NA + Y++N     N  +  K F IN   G L A  SL  E   +  + ++  DKGNPPQ+   +I + I +     P+ +F
Sbjct: 1530 QLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYL-------LIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAND-------LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF----RPG--SCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGE------LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANET--QWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVR-SATVPVQINVLDINDNRP-IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNA---ENSAVSAK-FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF 2166          

HSP 9 Score: 96.6709 bits (239), Expect = 1.167e-19
Identity = 85/286 (29.72%), Postives = 135/286 (47.20%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKV-IEIDERVSINFETPLALAKDLDI--GPNNIQEYKLEQPSDIFGLNYEPPFILNL-----YLKSKLDYDVPDGKNYSLILRACDGGD--PIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV 1215
            V ITI D ND+ P+F+ + K   EI E   + +      A D D    PN+   Y      DI   N E  F ++L     ++ ++LDYD    K+Y LI+RACD     P+ C  Q   + ++D NDN P F  +EY+  ++E   VGS +FR  A+D D G +G +NY +  + S+         F++   SG +      D +    + M L A D G         +++ IE  ++ TPQ + +    +    ++LP+       +G +  TD D G +G+V
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY------DITSGNDEHMFTIDLVTGVLFVNNRLDYD-SGAKSYELIIRACDSHHQRPL-CSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSW---KMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK--ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQ----GYVVGQVTATDSDSGPDGRV 3006          

HSP 10 Score: 96.2857 bits (238), Expect = 1.313e-19
Identity = 156/667 (23.39%), Postives = 278/667 (41.68%), Query Frame = 1
Query:  394 ITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDK-NAYIGLIIV--TDGDI-GQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNK----QLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGS--NAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREK-YDVYKISLLLTDKGNP-PQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP-GQIIATIHAYDNDTLENANVTYTLTKVEPPLNS-NIFKLHETQGTIQ---VTEFLTLKMFVLHLQASDNG 2343
            I +ED ND+ P F     V  + E  +         A D D G N    Y +   +       EP F   +     LD ++ D   Y L + A D G P   G   + +++ D NDN P F  +  +V VSE T +G+ I  + A D D+  Y ++ Y +    +   +++ +  F + + SG+++L R+LD +L   + + + A D+       + V+ + + D ND+ P    +  P     + ++ E ++  +    L+ V  TD D  G N KV  +I   +E   +  SN     ++   ++       +   + + I  KD G+P L +S  + +  +D          N     ISE   +G     +  +  D +  I    +E+  ++  S       I +   LDRE+ D Y + +V+              ++  S+ ++++DANDN P    S+K    I     ++  I Q+ A+D D  +  N+ V Y I           E +FTI+   G LF    LD +     Y++ +   D  +  P    +   + + D+NDN P  KF  P  + ++      P G  +   HA D D      + Y++       +S  +F++    G +    V ++   + + + L ASD G
Sbjct: 2310 IELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRD--IYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNN-LVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSI--FALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHE---ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNG----VVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQS-----KAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGN------DEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEP--KF--PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 11 Score: 88.9669 bits (219), Expect = 2.518e-17
Identity = 140/677 (20.68%), Postives = 271/677 (40.03%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY-----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSE---------YMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILN-RKLDAKLTPS--FFMRLEAHDSGESPLMGQAVMKIIIED---------INDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPP------LSTSQTIEICISDVNEHPPVINNNIK-EVNISEDVSIGQEFFTVEVEDKD----ATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP-GQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTL 2304
            + + I D+ND+ P F PN  ++ + E   +        A D+D  P        E   DI  ++    F L+ Y     LK +LDY++   + Y L + A D           L++RVND NDN P+F+  +          +  +SE  +V  ++  V ATD DS    S   ++ E             F +  ++G + +N  +L   ++ S  +F+R+ A D+G+  L    ++++   D          N +  QIS                   + A +G +++  G    +  ++ +   +E    L  S         +I+     DRE   L+ + +       PP       S+  ++ I I D N++ P+ + + K E  ISE   +      ++  D D        + + I    ++  F+ID   G + + + LD +   +    I+   +        +     + + D NDN+P     ++ ++ +  N  V   +F+  A D D G    + Y+I      ++    K+F ++ ++G + +    D E+   Y + LL +D G   +     + V I  +++  P  +F       +    +  P G ++  + A D+D+  +  V Y L+        + FK++ + G + +   L L
Sbjct: 2414 IRVQIVDVNDNQPTFPPN-NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSI---FALDRYSGKLVLKRRLDYELQ--QEYELDVIASDAAHE---ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--------FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQIS-------------------EAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSK--------AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPK-FPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIG--PAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTP--QFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPH-----SHFKVNRSSGAVLIKRKLKL 3034          

HSP 12 Score: 84.3445 bits (207), Expect = 5.733e-16
Identity = 119/555 (21.44%), Postives = 233/555 (41.98%), Query Frame = 1
Query:  637 PDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPV-----------INNNIKEVNISEDVSIGQEFFTVEVEDKDATRNIS---FLIQETINKIYFSIDRKFGKIKIKSNLDREKIDR---YIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDN---DIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPP------QTKEEIILVNIIDKNDNAPIW-KFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLT 2220
            P+     L+ R  D   P    + +L I + D NDN P F + +++  VSE    G+ + +V A D D+G    + Y + +   ++   +E  F      SG +  N  LD ++   + +++ A D G   + G A +++ I D+ND+ P          P+ ++++ E  +  A I  I  +  D+     ++  +  +    +  +S    DR    ++     D E +  + + +   D           + + ++D N++ PV           I   I E  ISE +S+  +  TV   D D+  N S   ++I+       FS+    G + +  +  +  +     Y + I+ +D  +   +     S T+  + AND      N S     ++  Y  + +I +   L +    +G +A ++ ++  I    E   E +     ++  +  +  LDRE+ D+YK+ L+L+    PP       +    +++ I+D NDN PI+ +    + +I  L  + Y    +  I A D +   N+ V Y +T
Sbjct: 2285 PNEIRVVLVARTADA--PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAF------SGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-------PNNLVTVSEATELGAVITSI--SANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISE--ISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALK-----SSTLLRVQAND------NGSGRSQFLQNQY--RAQISEAAPLGSVVLQLGQDA-LDQSLAIIAGNEESAFELL-----QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDA-DQENTPNSEVVYDIT 2795          

HSP 13 Score: 56.225 bits (134), Expect = 2.117e-7
Identity = 68/274 (24.82%), Postives = 112/274 (40.88%), Query Frame = 1
Query: 1576 FSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTS----LDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWK----FPS-PQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNGNTPLKS 2361
             +IDR  G+I+ K  LDRE    Y +  +    + +         + V+V D NDN P    +S  I   E N   + K   + A D D+       Y I      +     ++ +   ++G L+        LDRE    Y + +   D G PP      + + I D NDN PI+     F + P+N  +        G  +  ++A D D  EN  V Y + + +      +F++    G I + + L  +   LH   + A D+G  PL++
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNI--------RVLVTVKDENDNAPTFPQTSMHIEFPE-NTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAF---RLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATV--------GTSVLQVYASDTDADENGLVEYAINRRQSD-KEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLET 375          
BLAST of protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 228.409 bits (581), Expect = 1.589e-60
Identity = 204/720 (28.33%), Postives = 334/720 (46.39%), Query Frame = 1
Query:  247 TGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL--EQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIG-QNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQET--INKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINY-IKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIW---KFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVT--EFLTLK---MFVLHLQASDNGN 2346
            TGE     ++DRET  S+  V  + PL  +N              I V +T++D ND+ P F      IE  E      +  L  A+DLD+ P N Q Y +     +D F L+     +    L+L +   LD +   G  YSL++ A DGG P   G   ++I + D NDN PIF +S Y   V E   VG+ + +V A+D D+   G + Y +     N ++S +   F+I   +G I +N+ LD +      + + A D GE PL   A + I + D+ND+ P I++    D  D    + E+     ++  I V D D   +   V+  +N  +    L   +N     IY +I +   DRE  S +T+S+   D G PPL  S++I + I+DVN++PP    ++   N+ E    G     V   D+D   N  +++ + ET   +  +F ID + G I  +S++D E      + +V  D        +++ ++ V++ D NDN+P    S   +++ E N  V   I +V A D D G NA+V YTI    K+  E      F +   +GE+     LD E+   Y+  +L TD+G    T   +I + + D NDN P++   ++     +    +       I+A + A D D      V+Y +        + IF++  + G I V   + L+++   M +L++ A+D GN
Sbjct:  129 TGEIRTKVKLDRETRASYSLV--AIPLSGRN--------------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPG--YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI-----NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSD--DASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNS----IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGV--PPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAE-NEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE------FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTA--MIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGN---EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN 804          

HSP 2 Score: 212.231 bits (539), Expect = 2.067e-55
Identity = 214/801 (26.72%), Postives = 365/801 (45.57%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQ---NCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL--EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYES----VSNHKKSVEVP-FFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHT-FDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKE-VNISEDVSIGQEFFTVEVEDKDATRNISFLI-----QETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDN--DIGSNAV--------VEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISL--LLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNS------NIFKLHETQGTIQVT---EFLTLKMFVLHLQASDNGNTPLKSVPTTLTIR 2385
            Y VKE+ P   ++G++   S      S  + + IY  +    YF I   +G   +A  +D E              K+Q   N + +L    P      V I +ED+ND+ P FE +   I + E   +      A A D D G +    Y L  E    +F ++       +L L   LDY+    + ++LI+ A DGG P    +  + + V D NDNPP+F K EY VNVSE  ++ ++I +V A+D D+G    I Y + ++    V+N   S +V   F I  NSG I L   LD +    + + + A D+G      +  + + + D ND+ P+   K K +       + EN  + + +G++  +D D+G+N  +           LL ++++     +   I+     DRE   L+ + +  +D G P  S    + I +SDVN++ P I +  ++ V++ E+   G E   V   D+D  +N S        +++     FSID   G I+ +  LD E+   Y + +   D      +  T   L V V+D NDN+P   +SS V  + E +  +   +  +  ++   D+  N+V        V YT+N +    + + E  F I+R +G L     LDRE    +++ +  L T   N PQ+    + + + D NDNAP W    PQ+ I + +++ T  G II    A D DT  N ++ Y L +  P LN       ++F++    G + +    +F  ++ ++L +QA D  +   + + T++T+R
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRS-PVRYSIYSGD-PDGYFSIETNSGNIRIAKPLDHEA-------------KSQVLLNIQATLGE-PPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG---HLILSQHLDYE--SSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ-KSKYE-----FRIEENLRRGSVVGVVTASDLDLGENAAI--------RYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRE--TVRMLRVEVLDLNDNRPTFTSSSLVFRVRE-DAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPL---TKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW----PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVR 1589          

HSP 3 Score: 207.994 bits (528), Expect = 4.772e-54
Identity = 197/736 (26.77%), Postives = 327/736 (44.43%), Query Frame = 1
Query:  229 FRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFE---TPLA--LAKDLDIGPNNIQEYKLEQPSD--IFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLI-----QETINKI-------YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQ---VTEFLTLKMFVLHLQASDNGNTPLKSV 2364
            F +   +GE  +AG +D E   S+    +   L      LS T  +        ++ + D+ND+ PVF P    + + E    + +   TP+   +A D D G      Y++   ++  IF ++        +++       V     + L + A DGG+        + + + D    PPIF K+ Y   V E    G+ +  VIA   D      + Y +Y    +        +F I  NSG I + + LD +      + ++A   GE P+ G   + I +ED+ND+ P+       +     +S+PE+ +  A +      D D G +G+V+  + K+  K L  +    D R  + I++ H  D E+    T+ +T  D G P LST+ TI + + DVN++PPV   +   VN+SE  SI  +   V   D D   N  I++ I         N I       +F I    G I +++ LDRE  DRY + ++  DN        T   + V V+DANDN P     SK    IE N      +  V A D D+G NA + Y++  I           F ++   GE+     LDRE  ++Y + +   D+G P ++    + +++ D NDNAP  +   PQ D++++ +   PG  +  + A D D  +NA++TY++ K        +F +  T G I+   V +     ++ L + ASD GN P ++V
Sbjct:  660 FEVRSASGEICIAGELDFERRSSY----EFPVLATDRGGLSTTAMI--------KMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTG---EIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG-------YFSIETNSGNIRIAKPLDHEAKSQVLLNIQA-TLGEPPVYGHTQVNIEVEDVNDNAPEF------EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI----DARSGHLILSQH-LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKT--RVIVRVLDANDNDPK-FQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN--------SSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAP--EIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETV 1348          

HSP 4 Score: 164.466 bits (415), Expect = 1.938e-40
Identity = 186/777 (23.94%), Postives = 322/777 (41.44%), Query Frame = 1
Query:  112 EESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE-----------QPSDI---FGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANH-------TFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVE----------------VEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYT-INYIKYRNEIIKE--KVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEI---ILVNIIDKNDNAPIWKFPSPQND-----IINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL 2298
            E   P Y      KDS  S + + SL       E  K  F I  ++G   ++  +D E+      +  +      +   +LT+ V           ++D+ND+ PVFE +   + + E  SIN +     A DLD G N    Y++              SD+   FG+     +I   YL++ LD +  D   Y L + A D G P      ++ +RV D NDN P F KS+Y   + E    GS +  V A+D D G   +I Y +    S+         F++   +G I     LD +L   + + +EA D G      +  ++I + D+ND+ P+I+  P+ D+    +S+ E       +  +   D D GQN  ++  I K           + D   ++SI             D E  S++ + +   D G PP  T + + + + D+N++ P   ++     + ED ++G    ++                  ED   T  ++ L ++ I +  F IDR  G + +   LDRE    + + I   D        +++ ++ + V D NDN P        + + E    V   I    A D D G+N  ++Y  I Y    NE  ++   +F ++   G L     LD E    Y + +   D+ +    + +    + + I+D ND+AP   F SP +       + ++  T  G+++A I A D D+ +N  +TY +T          F+++   G I++ + L
Sbjct:  945 ELGAPLYAAHAHDKDSGSSGQVTYSLV-----KESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILV----------DVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWI---YLRAPLDRETRD--RYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS---------FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIA-DPQEDV----VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK---------GRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLI-EAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEAT-PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAP--HFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN---GEGRFRINSQTGIIELVKSL 1671          

HSP 5 Score: 147.132 bits (370), Expect = 4.202e-35
Identity = 200/799 (25.03%), Postives = 314/799 (39.30%), Query Frame = 1
Query:  223 NYFRIVEKTGEFYVAGRIDRETICSF-----------KEVGDSDPLKAQNCKLSLTVFVPKEHW--INVEITIEDINDHVPVFEPN----WKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLK--SKLDYDVPDGKNYSLILRACDGGDP-IQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAV-MKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVI--NNNIKEVNISEDVSIGQEFFTVEVEDKDATRN-ISFLIQETINKIYFSIDRKFGKIKIK---------------SNLDREKIDRYIICIVVED----NKQLGTQ---FTTSFSLT----------------------------VSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFT-INRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKSVPTTLTIR 2385
            + F +  + G     G+ DRE+  S+           +    S  ++ Q    S+      +H+    + IT+ D+ND+ P F P       V E  E   I+      +A DLD GPN    Y       I G N    F ++      S    D      Y+L ++A D G P  + GH  ++I V D NDN P F  S+Y  +V E   +G+ + ++ A D D G+   + Y    S++N  +      F I   SG I    KLD +L  S+   + A D G   +    V ++I + DIND+ P     P       +  +P        +  +   D D+G N ++   +N +   +  K   N       ++ A+ +   E+  L  + +  +D G PP S+   IE+ I +  +  PV+   N    V + E+   G     V     D  R  + F           S+D   G+I++                S L R +   Y   I        N    +Q    ++SF+LT                            + + D NDN P       V  + EGN      + QV A D+D GSNA + Y I    + N  + E  F+ I R N        LDRE  D+YK+ ++ TD+G P  T    I V I+D NDN P +    P N+++ +++ T  G +I +I A D DT                 N +IF L    G + +   L  ++   + L + ASD  +       T LT+R
Sbjct: 1765 DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIH----TVVASDLDEGPNADLIYS------ITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVY----SLANETQWQ----FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY------IGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTG---ALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGN-NKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTN------IVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF----PPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH----EARTVLTVR 2521          

HSP 6 Score: 130.568 bits (327), Expect = 4.026e-30
Identity = 191/830 (23.01%), Postives = 345/830 (41.57%), Query Frame = 1
Query:   85 SQDLKYSVKEESPPNYLIGNIKKDSRLSE--KNSESLTFQIYEDEEKKN---------YFRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL-----------EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQK---LSIRVNDYNDNPPIFMKSEYM------VNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKL-----DAKLTPSFFMRLEAHDSGE-SPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYG-QPPLSTSQ----------------------TIEICISDVNEHPPVIN-NNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKI--YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTI-NYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEI-ILVNIIDKNDNAPIW-KFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKSV 2364
            S  L + V+E++   +++G+I    R ++  +NS   +F+        N          F I   +G   VA  +DRE    F+ E+   D   + N         P+   I V+I + D+ND+ P +  +   +++ E   +        A D D G N   +Y+L           EQ   +F ++        L L++ LD++    + Y LI++A D    +    Q    + +R+ D ND+ P F+           + +S+ T +G  +  ++A D DSG  G + Y +       +       F+I+  +G I L + L     D +    F + + A D G+  P      + +I++  +++ P+              ++ EN    +++  +        +N  +S  I       L  V     D     I     FDRE+++ + + +  +D   Q  LS+S                       TI I + DVN++ P     +   +++ E+   G    TV   D D   N   +   T   +   FSID   G++  +  LDRE+  RY + I   D  Q  ++     ++T+ V D NDN P     SK    ++ +  +   + Q+ A+D D+G NA + Y++ N  +++        F I+ ++G +  +  LDRE    Y   +L TD G        + + +N++D NDN PI+ ++P     I  +  +  PGQ +  + A D D   NA + Y+L   E    S  F+++ + G +  ++ L   + K+  L + A D GN P  S+
Sbjct: 1367 SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNN---------PQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMD---SLTGALSLQAPLDFEAV--QEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR-------FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVY------RATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHV-----DWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQASDRGQPKSR-QGHCNITIFVEDQNDNAPRF-KLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--------FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY----IGQVPALIQPGQTLLKVQALDADLGANAEIVYSLN-AENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSL 2147          

HSP 7 Score: 128.257 bits (321), Expect = 2.603e-29
Identity = 180/752 (23.94%), Postives = 307/752 (40.82%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEY-----KLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKIL-LKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQE-----FFTVEVEDKDATR--NISFLIQETINKIYFSIDRKFGKIKI--KSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQ------VFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP-----GQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKSVPTTLTI 2382
            +K+  FRI  +TG  Y+   +D ET    KE+ +   +   + +       P E    V I + D+ND+ P     +   +   ++S + +    +A+     P++  EY      L      F L      I  + +   LD ++    NY+L + A D G P     + + +R+ D NDNPP F +  Y  NV E    G+ + +V+A DRD GL  ++ Y + E+   H +     +F+I   +G I     +D +  P   + + A D G  PL   A + + I D+ND+ P        D     +S+ EN      I  +  +D D G N  V+  I +  + +   +V +   +     I      D E  S +   +   D G   LST+  I++ ++DVN++ PV      +V++ E      +        V   D D      +S+ I        F IDR  G+I +     L       +++ I   D   L +       L  S++DA    P       +      NY VKE I +      V A   D+   + V Y+I    Y  +   +  F+I   +G +     LD E      +++  T  G PP      + + + D NDNAP ++         ++ +I+ P     G  +   HA+D D+  +  VTY+L K        +F +    G + +++ L   + +   L + A+D G   + S+ T LTI
Sbjct:  331 DKEQMFRIDPRTGAIYINKALDFET----KELHELVVVAKDHGEQ------PLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIV--SNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQ-----WFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF------DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGE-----ICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFL--SIIDAMQRPP-------IFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI----YSGD--PDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFE--------ASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKES---GKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGG---VPSLSTNLTI 1022          

HSP 8 Score: 125.946 bits (315), Expect = 1.168e-28
Identity = 161/672 (23.96%), Postives = 272/672 (40.48%), Query Frame = 1
Query:  196 QIYEDEEKK-NYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF-EPNWK-----VIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE--QPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDP-IQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSG-ESPLMGQAVMK----------------------IIIEDINDHTPQISIKPKPDIPDCM-LSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQ-TIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDA---TRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKF 2097
            Q+ E +E+  + FR+   TG   +   +D E +  +        L  Q    S  V    +  + V + I D NDH P F  PN        + I +   I       +A D D G N    Y++        F +N +   I  +        DV  G  ++LI+ A D G P  +     L + V   ++NPP F+++ Y   + E    GS + +V A         +++Y +   V+N         F +    G I    + D +   S+ + +   D+  +S L   AV K                      I + D+ND++P+     +P    C  LS+PEN++    I  ++ +D D G N  +   I          + ++  +      ++    DRE  S +T+ I   D GQP        I I + D N++ P    +    ++ ED  +G     +   D D     R +  L  ET  +  F+ID + G I     LDRE    Y   ++  D  +   + + +  + ++V+D NDN+P +      I  +       + + +V ALD D+G+NA + Y++N     N  +  K F IN   G L A  SL  E   +  + ++  DKGNPPQ+   +I + I +     P+ +F
Sbjct: 1530 QLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYL-------LIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAND-------LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF----RPG--SCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGE------LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANET--QWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVR-SATVPVQINVLDINDNRP-IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNA---ENSAVSAK-FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF 2166          

HSP 9 Score: 96.6709 bits (239), Expect = 1.167e-19
Identity = 85/286 (29.72%), Postives = 135/286 (47.20%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKV-IEIDERVSINFETPLALAKDLDI--GPNNIQEYKLEQPSDIFGLNYEPPFILNL-----YLKSKLDYDVPDGKNYSLILRACDGGD--PIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV 1215
            V ITI D ND+ P+F+ + K   EI E   + +      A D D    PN+   Y      DI   N E  F ++L     ++ ++LDYD    K+Y LI+RACD     P+ C  Q   + ++D NDN P F  +EY+  ++E   VGS +FR  A+D D G +G +NY +  + S+         F++   SG +      D +    + M L A D G         +++ IE  ++ TPQ + +    +    ++LP+       +G +  TD D G +G+V
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY------DITSGNDEHMFTIDLVTGVLFVNNRLDYD-SGAKSYELIIRACDSHHQRPL-CSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSW---KMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK--ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQ----GYVVGQVTATDSDSGPDGRV 3006          

HSP 10 Score: 96.2857 bits (238), Expect = 1.313e-19
Identity = 156/667 (23.39%), Postives = 278/667 (41.68%), Query Frame = 1
Query:  394 ITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDK-NAYIGLIIV--TDGDI-GQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNK----QLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGS--NAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREK-YDVYKISLLLTDKGNP-PQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP-GQIIATIHAYDNDTLENANVTYTLTKVEPPLNS-NIFKLHETQGTIQ---VTEFLTLKMFVLHLQASDNG 2343
            I +ED ND+ P F     V  + E  +         A D D G N    Y +   +       EP F   +     LD ++ D   Y L + A D G P   G   + +++ D NDN P F  +  +V VSE T +G+ I  + A D D+  Y ++ Y +    +   +++ +  F + + SG+++L R+LD +L   + + + A D+       + V+ + + D ND+ P    +  P     + ++ E ++  +    L+ V  TD D  G N KV  +I   +E   +  SN     ++   ++       +   + + I  KD G+P L +S  + +  +D          N     ISE   +G     +  +  D +  I    +E+  ++  S       I +   LDRE+ D Y + +V+              ++  S+ ++++DANDN P    S+K    I     ++  I Q+ A+D D  +  N+ V Y I           E +FTI+   G LF    LD +     Y++ +   D  +  P    +   + + D+NDN P  KF  P  + ++      P G  +   HA D D      + Y++       +S  +F++    G +    V ++   + + + L ASD G
Sbjct: 2310 IELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRD--IYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNN-LVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSI--FALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHE---ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNG----VVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQS-----KAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGN------DEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEP--KF--PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 11 Score: 88.9669 bits (219), Expect = 2.518e-17
Identity = 140/677 (20.68%), Postives = 271/677 (40.03%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY-----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSE---------YMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILN-RKLDAKLTPS--FFMRLEAHDSGESPLMGQAVMKIIIED---------INDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPP------LSTSQTIEICISDVNEHPPVINNNIK-EVNISEDVSIGQEFFTVEVEDKD----ATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP-GQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTL 2304
            + + I D+ND+ P F PN  ++ + E   +        A D+D  P        E   DI  ++    F L+ Y     LK +LDY++   + Y L + A D           L++RVND NDN P+F+  +          +  +SE  +V  ++  V ATD DS    S   ++ E             F +  ++G + +N  +L   ++ S  +F+R+ A D+G+  L    ++++   D          N +  QIS                   + A +G +++  G    +  ++ +   +E    L  S         +I+     DRE   L+ + +       PP       S+  ++ I I D N++ P+ + + K E  ISE   +      ++  D D        + + I    ++  F+ID   G + + + LD +   +    I+   +        +     + + D NDN+P     ++ ++ +  N  V   +F+  A D D G    + Y+I      ++    K+F ++ ++G + +    D E+   Y + LL +D G   +     + V I  +++  P  +F       +    +  P G ++  + A D+D+  +  V Y L+        + FK++ + G + +   L L
Sbjct: 2414 IRVQIVDVNDNQPTFPPN-NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSI---FALDRYSGKLVLKRRLDYELQ--QEYELDVIASDAAHE---ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--------FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQIS-------------------EAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSK--------AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPK-FPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIG--PAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTP--QFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPH-----SHFKVNRSSGAVLIKRKLKL 3034          

HSP 12 Score: 84.3445 bits (207), Expect = 5.733e-16
Identity = 119/555 (21.44%), Postives = 233/555 (41.98%), Query Frame = 1
Query:  637 PDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPV-----------INNNIKEVNISEDVSIGQEFFTVEVEDKDATRNIS---FLIQETINKIYFSIDRKFGKIKIKSNLDREKIDR---YIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDN---DIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPP------QTKEEIILVNIIDKNDNAPIW-KFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLT 2220
            P+     L+ R  D   P    + +L I + D NDN P F + +++  VSE    G+ + +V A D D+G    + Y + +   ++   +E  F      SG +  N  LD ++   + +++ A D G   + G A +++ I D+ND+ P          P+ ++++ E  +  A I  I  +  D+     ++  +  +    +  +S    DR    ++     D E +  + + +   D           + + ++D N++ PV           I   I E  ISE +S+  +  TV   D D+  N S   ++I+       FS+    G + +  +  +  +     Y + I+ +D  +   +     S T+  + AND      N S     ++  Y  + +I +   L +    +G +A ++ ++  I    E   E +     ++  +  +  LDRE+ D+YK+ L+L+    PP       +    +++ I+D NDN PI+ +    + +I  L  + Y    +  I A D +   N+ V Y +T
Sbjct: 2285 PNEIRVVLVARTADA--PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAF------SGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-------PNNLVTVSEATELGAVITSI--SANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISE--ISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALK-----SSTLLRVQAND------NGSGRSQFLQNQY--RAQISEAAPLGSVVLQLGQDA-LDQSLAIIAGNEESAFELL-----QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDA-DQENTPNSEVVYDIT 2795          

HSP 13 Score: 56.225 bits (134), Expect = 2.117e-7
Identity = 68/274 (24.82%), Postives = 112/274 (40.88%), Query Frame = 1
Query: 1576 FSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTS----LDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWK----FPS-PQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNGNTPLKS 2361
             +IDR  G+I+ K  LDRE    Y +  +    + +         + V+V D NDN P    +S  I   E N   + K   + A D D+       Y I      +     ++ +   ++G L+        LDRE    Y + +   D G PP      + + I D NDN PI+     F + P+N  +        G  +  ++A D D  EN  V Y + + +      +F++    G I + + L  +   LH   + A D+G  PL++
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNI--------RVLVTVKDENDNAPTFPQTSMHIEFPE-NTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAF---RLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATV--------GTSVLQVYASDTDADENGLVEYAINRRQSD-KEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLET 375          
BLAST of protocadherin-9 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332722)

HSP 1 Score: 205.682 bits (522), Expect = 3.108e-53
Identity = 195/712 (27.39%), Postives = 328/712 (46.07%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVP-VFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKV-SNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASD 2337
            +K+  F+I  K+GE ++A  +DRE +  +        + A + K +           NVEI ++DIND+ P   +P +  I  +E +SI        A D D   + ++ Y   + +D F +  E      L + S LD +      Y L+    DG D  Q    ++ I VND NDN PIF  ++Y V+V E   + + I +V A D+D G+   I Y +     NH       +FKISK++G I L++ LD +    F + ++A D G   L   A + + I DIND+ P+ S++           + EN      +  +  T  DIG N  +   I    E+   K+ S  GD      ++ N T D E    + ++I   D G PPLS +  + I I D+N++ P    N+  +N++ED+ +G +   V+  D+D+  N  +++ I+   N   FSID K G I +   LDRE I  Y + I   D  Q   Q   S  + ++++D NDN P + +SS    +++ N  +   +F  F + +   +     YT + I+  NE     +F +  ++G L   +  +    D + I + + D G PP   +  ++V II+++   PI    +P    IN  +  + G  I  +HA D D  +  N +      +   +S +F +    G I     L + ++ L++  SD
Sbjct: 3009 DKQAQFQI-GKSGELFIAKPLDREQLMFYNL-----SIIATDGKFTAKA--------NVEIDVKDINDNTPYCLKPRYH-ISTNESISIGTTLVEVKAIDFDF-QSKLRFYLSGKGADDFSIGKESGI---LKVASALDRETT--PKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMG--ENHD------YFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYS------CKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGD------LVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACD--QGDPQRCNSVPININILDTNDNAP-IFSSSNYSVVLQENR-LLGYVFLTFKISDADETPNTTPYTFD-IRSGNE---GGLFRL-EQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIV---TPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLDIGLYKLNVSVSD 3667          

HSP 2 Score: 166.777 bits (421), Expect = 3.415e-41
Identity = 204/782 (26.09%), Postives = 342/782 (43.73%), Query Frame = 1
Query:  229 FRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDE-RVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY-----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQ-KLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYE------------------SVSNHKKSVEVPFFKISKNSGR-----IILNRKL-------DAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQI----SIKP--------KPDIPDC--MLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLT-VSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVF-------------ALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY---PGQIIATIHAYDNDTLE-NANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPL 2355
            FRI   +G  Y A ++D E   S+   V   D            V   K+    V+I+++D+ND+ P+FE   KVI I+E  ++ +F   L  AKD D G N+   Y +   + +       PF ++ +       S LD++    +NY LI+RA D G P +   + KLSI V D NDN P F +      V++   +G+E+F   A D D+G    I+Y + +                  S    K ++     K+S   G      +I+N  L       D+ +    F   E  ++G +  + + +      ++   +P +    S+ P        +P+  +    LS+ E+      +  I   D D+G NGK+   I+  +   + ++     DR    II     DRE ++ + ++IT  D G P  STS+ + I I DVN++ PVI   +    ++E   IG     +   D D+  N       ++    F+++   G +++   LDREK D Y + I  +D    G+   +S +L  V V D NDN P               +GV+E IF+V              A+D DIG NA +++++     + E   E++F I++  G +     LD E   V+ + +   D G+P  T +  I++ IID N+N    +F    +D +   K+      G  +  + A D DT++ N+ +TY++T  +      IF +++ QG+I     L   T   + L L A D    PL
Sbjct:  448 FRINPDSGMLYTAKQLDAEKKSSYTLTVSAID---------QANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLT-AKDRDSGENSYISYSIANLNAV-------PFEIDHFSGIVKTTSLLDFETMK-RNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHG-FGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRID---PDRGELQIIG--YLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDG---GSPVLSSEALVYVLVDDVNDNAPV--------------FGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSL-----KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNEN----RFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGD---GLGIFAVND-QGSITSLSQLDAETKNFYWLTLCAQDCAIVPL 1173          

HSP 3 Score: 163.31 bits (412), Expect = 3.932e-40
Identity = 186/719 (25.87%), Postives = 320/719 (44.51%), Query Frame = 1
Query:  187 LTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVF----VPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLS--LPENNDKNAYIGLIIVTDGD-IGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEV--EDKDATRNISFLIQETINKIYFSIDRKFGKIK-IKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINI-IEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQT---KEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL 2298
            L F I  D +  + FRI    GE  + G +DRE              +     L++TV+      K     + ITI D+ND+ PV +       + E   I        A D D G N    Y L      F +N        L L   LD +  D  NY+L + A DGG P+      + + V+D NDN P+F   EY+  V E    G+ +  + A D D G    I + + E   + +       F+I K++G I     LD +      + + A D G+  L     + I+I D+N++      +  P+  D +    + EN  K  ++  +   D D +  N K++  I   +   +  V++ G      SI +    D E ++ + +++  +D    PLS    + I + + N++ P+ +  +  VN++E      E  T++    D D T+ I++ I       YF ID K G IK  +  LDRE    +I+ + + DN   G+   +S S + VSV+D NDN P      +V  + +  +  V + IFQV A+D+D G N  + Y+I   K +N+      F I+ + G +     LD +  + ++I +   D G P ++   +  I++V +   + NAP+    + +N +++LT+   PG ++  I A D+D   N  + Y ++      + N F + +  G I ++++L
Sbjct:  807 LVFAI-SDGDYDSVFRIDPDRGELQIIGYLDRE--------------RQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGC---LRLNKPLDREKQD--NYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEE------LFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNEN------RFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQG------SITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDN---GSPVLSSTSRIVVSVLDINDNSPEF--DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNK------FRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSEN-VVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGN---DDNTFYIGQDNGNILLSKYL 1467          

HSP 4 Score: 155.606 bits (392), Expect = 1.068e-37
Identity = 164/673 (24.37%), Postives = 299/673 (44.43%), Query Frame = 1
Query:  412 NDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVI---NKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEH--PPVINNNIKEVNISEDVSIGQEFFTVEVEDKDAT---RNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTI---NYIKYRNEIIKEKVFTINRKNGELFAL-TSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAP-----IWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL-TLKMFVLHLQASDNGNTPLKS 2361
            N H P F    + + I+E V +        AKD D+G N    + +         +Y+  F ++     L +   LD +  +   Y L +   D G+P +   + L I + D NDN P+  K+     ++E   +G+ +  + ATD DSG+   + Y +         SVE   F ++  +G + LN+ LD +   ++ + + A D G   L  +A++ ++++D+ND+ P   ++      + +  + E+  +   + +I   D DIG N ++   +    +DEE  L ++     D+   +I      D E + +  + ++  D G P L++  +I I I DVNE+   P  ++ + E  + E+   G     V   D D       I++ I        F+++ + G I   S LD E  + Y + +  +D   +    +    + + V + NDN P        +N+ E +    E I  + A D DI     + Y I   N + Y         F I+ K G +      LDRE    + + + ++D G+P  +    I+V+++D NDN+P     ++K   P +  +N        Q I  +HA D+D+ EN  +TY+   ++     N F++   +G I + + L +   F +H++A DNG  P KS
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDG------DYDSVFRIDPDRGELQIIGYLDRERQN--EYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL---------SVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQ------EYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEE--LFRI-----DKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQ-GSITSLSQLDAETKNFYWLTLCAQDCAIV--PLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVE-IITLKAFDPDIDPTQTITYNIVSGNLVGY---------FEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVN--------QSIFQVHAIDSDSGENGRITYS---IKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNG-IPKKS 1383          

HSP 5 Score: 152.14 bits (383), Expect = 1.012e-36
Identity = 156/578 (26.99%), Postives = 251/578 (43.43%), Query Frame = 1
Query:  652 YSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIII--EDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQ-FTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKS 2361
            Y+L + A DG    +     + I V D NDN P  +K  Y ++ +E  ++G+ +  V A D D      + +++    ++         F I K SG + +   LD + TP +  +L AH         +   +III   DIND+ P  S+          +S+PE+   N  I  +   D D G N ++   +  +         + G  R+      + + DRE  SLF +++  +D G P L +  T+ + I D+N++PP  +       I E+ + G E   V     D   N  I + I     +  F +D   G + + + LD E    Y + I   D    GT   + +  + +S++D NDN P  L +   IN+ E  + V  KI  V A D D   N +V Y I     R + I +  F+I+ KNG +     LDRE    Y + +   D+G+P +     I +NI+D NDNAPI+   S  N  + L +    G +  T    D D  E  N T     +       +F+L E  G+++        +   FV+ ++  DNG  PL S
Sbjct: 3036 YNLSIIATDGKFTAKA---NVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD--FQSKLRFYLSGKGADD--------FSIGKESGILKVASALDRETTPKY--KLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMA------QYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRL------HKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDG---GTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIF-VGSKILDVKATDEDSDVNGLVTYNIE----RGDNIGQ--FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIF---SSSNYSVVLQENRLLGYVFLTFKISDAD--ETPNTTPYTFDIRSGNEGGLFRL-EQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYS 3570          

HSP 6 Score: 145.206 bits (365), Expect = 1.467e-34
Identity = 197/780 (25.26%), Postives = 343/780 (43.97%), Query Frame = 1
Query:  112 EESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAK----DLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY-----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYS-----IIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKD--ATRNISF-LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGT-QFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGN-TPLKSVPTTLTI 2382
            E +PP  ++      ++L    + +  F I  D++   +F ++  +GE  +   +DRE         +S  L       ++ VF     + +V I + D ND+ P F+  +    + E    N E  ++L K    D D GPN    Y LE  ++    N +  F +++Y     L + LD +V    N+ +I  A D G P       ++I++ DYNDN P+F      ++V E    G+ +  ++  D D      +++F+   VS  K++     F+I K SG + + + LD +    + + + A D        +A ++I ++DIND+TP   +KP+  I         + +++  IG  +V         +V  +    + K+   +S  G D          +      DRE    + +    +D           I I ++D+N++ P+ +     V++ ED  +      V   DKD    R I + L+ E  N  YF I +  G I++  +LDRE I  + + +  ED    G  +  +  ++ V+++D NDN P          I+E N     ++ +V+A   DIG NA + Y   +I   NE  K   F ++   G+L    +LD E    Y +++   D G PP +    + ++I+D NDN+P +     QN   IN+ +  + G  I  + A D D+  N  VTY + + +   N   F +    GTI V+  L   T+  + L +QA D G+     SVP  + I
Sbjct: 2774 ESTPPGTVL------TKLHMIGNYTFKFSIAADQD---HF-MISDSGELILQQTLDREQ-------QESHNLIVVAETSTVPVFFA---YADVLIDVRDENDNYPKFDNTFYSASVAE----NSEKVISLVKVSATDADTGPNGDIRYYLESDTE----NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVI--AADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIE-KQEMDFFI---VSGDKQAQ----FQIGK-SGELFIAKPLDREQLMFYNLSIIATD---GKFTAKANVEIDVKDINDNTP-YCLKPRYHI---------STNESISIGTTLV---------EVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE--NHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAED---CGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILE-NATHGTEVCKVYATSIDIGVNADIHY---FIMSGNEQGK---FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFL----QNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGD---NIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININI 3473          

HSP 7 Score: 134.42 bits (337), Expect = 3.334e-31
Identity = 184/723 (25.45%), Postives = 315/723 (43.57%), Query Frame = 1
Query:  379 WINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGD--PIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAK-LTPSFFMRLEAHDSGESPLMGQAVMK--IIIEDINDHTPQIS--------IKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNG-----------KVSCVINKD--EEKILLKVSNNG----DDRMIYSIIANHTFDREAESLFTI-SITCKDYG-----QPPLSTSQTIEI------CISDVNEHPPVINNNIKE---VNISEDVSI------GQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQF-TTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNGNTPLKS 2361
            + +V I I+  + ++P+F      + I E   IN         D D+G N +         +I G N    F +N     LY   +LD +     +Y+L + A D  +    +    K+ I V D NDN PIF     +++++E    GS + ++ A DRDSG    I+Y    S++N      VP F+I   SG +     LD + +  ++ + + A D G  P   Q  +K  I+++DIND+ PQ           K  P   +  ++   + D    I   + +DG+  ++G            +SC + K     +IL   + +G    DD +I   +       ++  L    S  C++ G        LS ++   +        SD++  P     N+     VN  +++SI      G+    +E +D+D   N  + F I +      F ID   G+++I   LDRE+ + Y++ I V D   LG    +TS  L ++++D NDN+P +  +     + E +  +   +  + A D D G NA V Y ++        ++   FT+N   G L     LDREK D Y + +   D G+P  + E ++ V + D NDNAP++     Q  I  + +    G ++A I A D D   NA + ++L   E   +  +F++ +  G I+   +L  +   +H   + A D G+  L S
Sbjct:  383 YKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYL------EIVGGNEGDEFRINPDSGMLYTAKQLDAE--KKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISY----SIANLNA---VP-FEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWG-LPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRL-SDGN--EDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYD---LGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTE-SARIGTVVHCLHATDADSGINAQVTYALS--------VECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGV---QEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLK--EETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTS 1068          

HSP 8 Score: 132.109 bits (331), Expect = 1.422e-30
Identity = 141/500 (28.20%), Postives = 216/500 (43.20%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWI-NVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGK-VSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIY-----FSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNK 1677
            E  +YF+I + TG   +   +DRETI  F        +KA++C       VPK H I  V + I DIND+ P F       +I E  +   E     A  +DIG N    Y       I   N +  F ++     L L + LDY++   K Y L ++A DGG P    +  ++I + D NDN P F+++ Y +NV+E   VGS+I  V ATD DS + G + Y       N ++   +  F I   +G I ++R LD +    + + ++A D G+        + I I D ND+ P  S        +  + L EN           ++D D   N    +  I    E  L ++  +G  R       NH    E    F I +   D G PPL +   + + I + +++PP++      +N  ED   G     V   D+D    ++F +    + +Y     F+I    GKI   SNLD   I  Y + + V D K
Sbjct: 3211 ENHDYFKISKSTGIIRLHKSLDRETISLFNLT-----VKAEDCG------VPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYF------IMSGNEQGKFKMDSTTGDLVLNATLDYEM--SKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTY-------NIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSS------NYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRF--NHNLQDE----FVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD---IGLYKLNVSVSDGK 3669          

HSP 9 Score: 107.842 bits (268), Expect = 4.125e-23
Identity = 118/474 (24.89%), Postives = 208/474 (43.88%), Query Frame = 1
Query:  712 LSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSG-----ESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNG---KVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINK---IYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDV-YKISLLLTDKGNPPQTKEEIILVNII-DKNDNAPIWK 2094
            + I+V D ND  P+F  ++Y V + E T     I +V A D D G+ G I Y +          ++  +F I   +G I L ++L       F + + A+D G     ++    +  + I ++ +N + P+I  K    +       P +N      G++ V D D G NG   ++  V    +   LLK +   D+  I      H    +   ++ +++  +D G P     +++ I I   +++ P+    I EV+I E   I      ++V D D  +N + +  E +       F I+   G +     LD EK   Y + +   D   +G++  +S  + +SV D NDN P   N +KVI+I E N      + ++ A D D G N+ + Y+I         +    F I+  +G +   + LD E     Y++ +  +D G P + + EI L  ++ D NDN P ++
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLL---------MDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVT------PTSNP--LIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHL--NQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKN-ALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLA-GSFVVKLTAKDRDSGENSYISYSIAN-------LNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFE 614          

HSP 10 Score: 105.916 bits (263), Expect = 1.812e-22
Identity = 146/587 (24.87%), Postives = 249/587 (42.42%), Query Frame = 1
Query:  385 NVEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSII------ANHTFDREAESL----FTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFP 2100
            NV IT++D+ND+ P F EP++        V   F   L  A D DI   +  EYK+     ++G   +   I  L     L++ L++   D  +  L +   DG   +   + +L I +   N   P+F +S Y   V E    G  I  V A+D D G Y ++    YE VS   K +    F I + +G I      D +    + + L+  D G     G A +K+I+ D+ND+ P   +K      +  + +    + N  I  +   D DI  NG V             ++    +D+ +  +I       +  F  +AES     +   +   D G+P   +   + I I + + + P    +   + I E    G     + +       N +F      ++ +F I    G++ ++  LDRE+ + + + +V E +      F     + + V D NDN P   N+    ++ E +  V   + +V A D D G N  + Y   Y++   E I + +F I+  +G +  LTSLDRE    Y   ++  D G+P    +  + + I+D NDNAP++K P
Sbjct: 2434 NVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQF-VALPKAYDKDISDTDSLEYKI-----VYGNELQTYSIDKLTGVISLQNMLNF--TDKSSTVLNISVSDG---VHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANL---YYEIVSEEMKKI----FLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGK--FGFASLKVIVVDVNDNVPYFLLK------EYKMVVSTTVEANQTILTVKAKDDDIVDNGSVH-----------FQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHM-----IGNYTFKFSIAADQDHFMISDS-GELILQQTLDREQQESHNLIVVAETSTV--PVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVI-SLVKVSATDADTGPNGDIRY---YLESDTENI-QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLP 2970          

HSP 11 Score: 95.1301 bits (235), Expect = 2.874e-19
Identity = 133/625 (21.28%), Postives = 263/625 (42.08%), Query Frame = 1
Query:  652 YSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGE--SPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQP-PLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDN---------------KQLG----------------TQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYG--VKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEII---KEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGN-------------PPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKS 2361
            Y+L L A D G P +  ++ + I++   + N PIF +  Y V++ E   +   + R+  +D D G     N  +Y  +    +  E   F+I+ +SG +   ++LDA+   S+ + + A D     S     A +KI ++D+ND+ P      K      ++S+ ENN   +++  +   D D G+N  +S  I  +   +  ++ +        S++   T  R  E +    I   D+G P    T   + I + D+N++ P          +++   +G E F     D DA   IS+ + +      F++D   G + I  +L +  +   I+ +   D                + LG                T      + T+S+ + N+ K    +    +++    YG  V    F  F  +  I  +  +  T+ +I+ ++  +    + VF I+  +G+  ++  +D ++ ++  I  L  ++ N             P ++  +++ + I+D NDN P+ +          LT+    G ++  +HA D D+  NA VTY L+     +  + F ++ T G +++ + L  +    + LH+ A D G+  L S
Sbjct:  366 YNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGK----NALVYLEIVGGNEGDE---FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNK------VISINENNLAGSFVVKLTAKDRDSGENSYISYSI-ANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELI----IRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAIS--DGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLAT---FRLTESARIGTVVHCLHATDADSGINAQVTYALS-----VECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSS 962          

HSP 12 Score: 90.5077 bits (223), Expect = 8.357e-18
Identity = 175/747 (23.43%), Postives = 302/747 (40.43%), Query Frame = 1
Query:  208 DEEKKNYFRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEH---WINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLD--------IGPNNIQEYKLEQPSDIFGL-NYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKL-DAKLTPSFFMRLEAHD---SGESPLMGQAVMKIIIE--DINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEF-FTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINI-IEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP---GQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTL 2376
            D+  KN+F+I   TG   +  ++D ET   +  +V  SD  K            PK H     +V I + ++ND  PVF      + +      N       AKD D        +  N  + +++E+ + I    N+E   ILN            + ++Y+L +RA DG   I      + I+V    D+   F +  Y  +  E     + I          GL   I   + E+V  ++       F I  +SG +     + D ++   + + +EA      G +  + +AV  I I   D+ND+ P     P         ++  ++ K   I  +   D D  +NG+V   + K   + L K+     +  I   +  H  + E      +++   D    P S+   +++ +  ++   PV       V++ EDV +      ++E E       I  +  E+ +   F ID   G I + + LD EKI  + + I   D+    +       L+VS+MD ND  P +   S + N+ I  N     +I ++ A DND G+NA + Y I  I  +N     ++F I+  +G L+  T LD E+   + I + + D G+P  +    + + + D NDNAP +  PS        TK++     GQ +A   AYD D  +  ++ Y +         +I KL        +  F      VL++  SD  +T    +  +L
Sbjct: 1866 DDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGK------------PKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFE---ILN----------NENDRDYALHVRASDG---IFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATI----------GLVNVIGNTLDENVE-YRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPY------YATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGE-LFKLDRKSGELSIKQHVEGHNRNYE------LTVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQS---FEIDYNTGSIFVVNELDYEKISSHDVSIRATDSL---SGVYAEVVLSVSIMDVNDCYPEI--ESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQN---NSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPS------YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISL 2541          

HSP 13 Score: 88.1965 bits (217), Expect = 3.885e-17
Identity = 169/749 (22.56%), Postives = 305/749 (40.72%), Query Frame = 1
Query:  226 YFRIVEKTGEFYVAGR-IDRETICS-FKEVGDSD---PLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE--QPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDY---NDNPPIFMK--SEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKI-LLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVED--NKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAP-------IWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQV---TEFLTLKMFVLHLQASDNGNTPLKSVPTT-LTIR 2385
            YF I  KTG      R +DRE       EV  SD   P+ +   ++ ++V               DIND+ P F+     +++    ++N       A D D G N    Y ++  +  + F ++ +   I   ++   LD D      + + ++A D G P +    +++I V      + N P+ ++  SE +V+++E    G  + +++A D D       N  ++ ++SN         F I +++G I+L++ LD +   S+ + +   D   +      V  I   DIND+ PQ +     D+    +++ EN ++ + I  +  TD D  +         +D   + L ++     D +  ++I     D E  +   + +  KD G P       I + + D N+H P     I +  + E  +IG +   V   D+D+  N      +I   +  + F ID  FG I +  NL+  KI  Y++ +   D  N  L +Q      +T+S  D     P    ++  I I E N  +   + QV A  +      ++   IN           + F IN   G +    ++D E   V+ +++  T+     ++  + I+++I+D NDN P       +   P        + K+    +   T+   D D   N  V Y +      L  N FK+  T G I++    ++ T   +   +  SD G   L S  T  +TIR
Sbjct: 1240 YFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVL--------------DINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHI---HIAKPLDSD----NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD-------NDQLWYNISNGNDD---NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVI---DINDNPPQFA----KDV--YHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRI-----DSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSV-FEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDP----PKFPTNNIAIEIFE-NLPIGTFVTQVTARSSSSIFFNIISGNIN-----------ESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMA--AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD---DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIR 1921          

HSP 14 Score: 87.4261 bits (215), Expect = 7.699e-17
Identity = 130/529 (24.57%), Postives = 216/529 (40.83%), Query Frame = 1
Query:  223 NYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLT--VFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLK-VSNNGDDRMIYS-----IIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIG----------QEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKP 1749
            N F I +  G   ++  +D ET  S+            N  +S+T   F     + N+ + + DIND+ P F  +   + I E +          A D D            Q      L        N+ +  +LD++      + LI+   D G P +  + K+ + V+D+ND+ P F        V E  A+GS++  V A DRDSG    I Y +   ++ +  SV    F+I    G I L   L+      + ++++A D G  PL  Q  + II+  ++++ P     PK          P NN     I + I  +  IG    V+ V  +    I    +S N ++    +     I+ N   D E+  +F  ++T K       S+ Q I I I D N++ P    N     + E  +IG          ++  T++V+D D   N  + + I + + K +F ID   G I++   LD E    Y   + V D  +     TT+  +T+ V++ ND  P
Sbjct: 1450 NTFYIGQDNGNILLSKYLDYETQQSY------------NLTISVTDGTFTA---FTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFE--KTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSI---ITGNVGSV----FEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVT-MSENDP-----PK---------FPTNN-----IAIEIFENLPIGT--FVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVF--NLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPP 1930          

HSP 15 Score: 65.0846 bits (157), Expect = 4.695e-10
Identity = 124/571 (21.72%), Postives = 231/571 (40.46%), Query Frame = 1
Query:  754 FMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINY-FMYESVSNHKKSV---------EVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEA----HDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYG-----QPPLSTSQTIEICISDVNEHPPVINN---------------NIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSF-SLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEI--ILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVT---EFLTLKM-FVLHLQASDNG 2343
            F  S Y V + E + +G    + +  +R +GL   +N    Y  +S  K+ +         +  F  I   +  ++LNR    + T  + +R++A    HD   S    +A + I + D ND +P     P        + +PE+  K   I  +   D D+G NG++   +  D E   +  +          I           S F +++   D G     Q   ++   + I +  VN + P I                  I  VN  +D  I      +E+ D +          ET ++ Y  ++ +F  +  +  +       Y + ++ ED   LGT    ++ S+ + +   + N P        ++I E    +   + ++   D D+G NA+V   I      +E      F IN  +G L+    LD EK   Y +++   D+ N    K+    + +++ D NDN PI++     N +I++ +    G  +  + A D D+ EN+ ++Y++      LN+  F++    G ++ T   +F T+K  + L ++ASD G
Sbjct:   62 FSHSVYNVTIPENS-LGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNR----EKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPL--FYPT----QYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTG-------EITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVN-DKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELN-QFAHLNQQHFI-------YNLTLLAED---LGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPE-TAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE------FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFE---NVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIAN----LNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWG 588          
BLAST of protocadherin-9 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 205.297 bits (521), Expect = 3.962e-53
Identity = 195/712 (27.39%), Postives = 328/712 (46.07%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVP-VFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKV-SNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASD 2337
            +K+  F+I  K+GE ++A  +DRE +  +        + A + K +           NVEI ++DIND+ P   +P +  I  +E +SI        A D D   + ++ Y   + +D F +  E      L + S LD +      Y L+    DG D  Q    ++ I VND NDN PIF  ++Y V+V E   + + I +V A D+D G+   I Y +     NH       +FKISK++G I L++ LD +    F + ++A D G   L   A + + I DIND+ P+ S++           + EN      +  +  T  DIG N  +   I    E+   K+ S  GD      ++ N T D E    + ++I   D G PPLS +  + I I D+N++ P    N+  +N++ED+ +G +   V+  D+D+  N  +++ I+   N   FSID K G I +   LDRE I  Y + I   D  Q   Q   S  + ++++D NDN P + +SS    +++ N  +   +F  F + +   +     YT + I+  NE     +F +  ++G L   +  +    D + I + + D G PP   +  ++V II+++   PI    +P    IN  +  + G  I  +HA D D  +  N +      +   +S +F +    G I     L + ++ L++  SD
Sbjct: 3009 DKQAQFQI-GKSGELFIAKPLDREQLMFYNL-----SIIATDGKFTAKA--------NVEIDVKDINDNTPYCLKPRYH-ISTNESISIGTTLVEVKAIDFDF-QSKLRFYLSGKGADDFSIGKESGI---LKVASALDRETT--PKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMG--ENHD------YFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYS------CKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGD------LVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACD--QGDPQRCNSVPININILDTNDNAP-IFSSSNYSVVLQENR-LLGYVFLTFKISDADETPNTTPYTFD-IRSGNE---GGLFRL-EQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIV---TPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLDIGLYKLNVSVSD 3667          

HSP 2 Score: 166.392 bits (420), Expect = 4.337e-41
Identity = 204/782 (26.09%), Postives = 342/782 (43.73%), Query Frame = 1
Query:  229 FRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDE-RVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY-----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQ-KLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYE------------------SVSNHKKSVEVPFFKISKNSGR-----IILNRKL-------DAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQI----SIKP--------KPDIPDC--MLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLT-VSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVF-------------ALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY---PGQIIATIHAYDNDTLE-NANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPL 2355
            FRI   +G  Y A ++D E   S+   V   D            V   K+    V+I+++D+ND+ P+FE   KVI I+E  ++ +F   L  AKD D G N+   Y +   + +       PF ++ +       S LD++    +NY LI+RA D G P +   + KLSI V D NDN P F +      V++   +G+E+F   A D D+G    I+Y + +                  S    K ++     K+S   G      +I+N  L       D+ +    F   E  ++G +  + + +      ++   +P +    S+ P        +P+  +    LS+ E+      +  I   D D+G NGK+   I+  +   + ++     DR    II     DRE ++ + ++IT  D G P  STS+ + I I DVN++ PVI   +    ++E   IG     +   D D+  N       ++    F+++   G +++   LDREK D Y + I  +D    G+   +S +L  V V D NDN P               +GV+E IF+V              A+D DIG NA +++++     + E   E++F I++  G +     LD E   V+ + +   D G+P  T +  I++ IID N+N    +F    +D +   K+      G  +  + A D DT++ N+ +TY++T  +      IF +++ QG+I     L   T   + L L A D    PL
Sbjct:  448 FRINPDSGMLYTAKQLDAEKKSSYTLTVSAID---------QANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLT-AKDRDSGENSYISYSIANLNAV-------PFEIDHFSGIVKTTSLLDFETMK-RNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHG-FGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRID---PDRGELQIIG--YLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDG---GSPVLSSEALVYVLVDDVNDNAPV--------------FGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSL-----KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNEN----RFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGD---GLGIFAVND-QGSITSLSQLDAETKNFYWLTLCAQDCAIVPL 1173          

HSP 3 Score: 162.925 bits (411), Expect = 5.166e-40
Identity = 186/719 (25.87%), Postives = 320/719 (44.51%), Query Frame = 1
Query:  187 LTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVF----VPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLS--LPENNDKNAYIGLIIVTDGD-IGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEV--EDKDATRNISFLIQETINKIYFSIDRKFGKIK-IKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINI-IEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQT---KEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL 2298
            L F I  D +  + FRI    GE  + G +DRE              +     L++TV+      K     + ITI D+ND+ PV +       + E   I        A D D G N    Y L      F +N        L L   LD +  D  NY+L + A DGG P+      + + V+D NDN P+F   EY+  V E    G+ +  + A D D G    I + + E   + +       F+I K++G I     LD +      + + A D G+  L     + I+I D+N++      +  P+  D +    + EN  K  ++  +   D D +  N K++  I   +   +  V++ G      SI +    D E ++ + +++  +D    PLS    + I + + N++ P+ +  +  VN++E      E  T++    D D T+ I++ I       YF ID K G IK  +  LDRE    +I+ + + DN   G+   +S S + VSV+D NDN P      +V  + +  +  V + IFQV A+D+D G N  + Y+I   K +N+      F I+ + G +     LD +  + ++I +   D G P ++   +  I++V +   + NAP+    + +N +++LT+   PG ++  I A D+D   N  + Y ++      + N F + +  G I ++++L
Sbjct:  807 LVFAI-SDGDYDSVFRIDPDRGELQIIGYLDRE--------------RQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGC---LRLNKPLDREKQD--NYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEE------LFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNEN------RFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQG------SITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDN---GSPVLSSTSRIVVSVLDINDNSPEF--DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNK------FRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSEN-VVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGN---DDNTFYIGQDNGNILLSKYL 1467          

HSP 4 Score: 155.221 bits (391), Expect = 1.378e-37
Identity = 164/673 (24.37%), Postives = 299/673 (44.43%), Query Frame = 1
Query:  412 NDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVI---NKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEH--PPVINNNIKEVNISEDVSIGQEFFTVEVEDKDAT---RNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTI---NYIKYRNEIIKEKVFTINRKNGELFAL-TSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAP-----IWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL-TLKMFVLHLQASDNGNTPLKS 2361
            N H P F    + + I+E V +        AKD D+G N    + +         +Y+  F ++     L +   LD +  +   Y L +   D G+P +   + L I + D NDN P+  K+     ++E   +G+ +  + ATD DSG+   + Y +         SVE   F ++  +G + LN+ LD +   ++ + + A D G   L  +A++ ++++D+ND+ P   ++      + +  + E+  +   + +I   D DIG N ++   +    +DEE  L ++     D+   +I      D E + +  + ++  D G P L++  +I I I DVNE+   P  ++ + E  + E+   G     V   D D       I++ I        F+++ + G I   S LD E  + Y + +  +D   +    +    + + V + NDN P        +N+ E +    E I  + A D DI     + Y I   N + Y         F I+ K G +      LDRE    + + + ++D G+P  +    I+V+++D NDN+P     ++K   P +  +N        Q I  +HA D+D+ EN  +TY+   ++     N F++   +G I + + L +   F +H++A DNG  P KS
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDG------DYDSVFRIDPDRGELQIIGYLDRERQN--EYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL---------SVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQ------EYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEE--LFRI-----DKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQ-GSITSLSQLDAETKNFYWLTLCAQDCAIV--PLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVE-IITLKAFDPDIDPTQTITYNIVSGNLVGY---------FEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVN--------QSIFQVHAIDSDSGENGRITYS---IKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNG-IPKKS 1383          

HSP 5 Score: 152.14 bits (383), Expect = 1.209e-36
Identity = 156/578 (26.99%), Postives = 251/578 (43.43%), Query Frame = 1
Query:  652 YSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIII--EDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQ-FTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKS 2361
            Y+L + A DG    +     + I V D NDN P  +K  Y ++ +E  ++G+ +  V A D D      + +++    ++         F I K SG + +   LD + TP +  +L AH         +   +III   DIND+ P  S+          +S+PE+   N  I  +   D D G N ++   +  +         + G  R+      + + DRE  SLF +++  +D G P L +  T+ + I D+N++PP  +       I E+ + G E   V     D   N  I + I     +  F +D   G + + + LD E    Y + I   D    GT   + +  + +S++D NDN P  L +   IN+ E  + V  KI  V A D D   N +V Y I     R + I +  F+I+ KNG +     LDRE    Y + +   D+G+P +     I +NI+D NDNAPI+   S  N  + L +    G +  T    D D  E  N T     +       +F+L E  G+++        +   FV+ ++  DNG  PL S
Sbjct: 3036 YNLSIIATDGKFTAKA---NVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD--FQSKLRFYLSGKGADD--------FSIGKESGILKVASALDRETTPKY--KLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMA------QYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRL------HKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDG---GTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIF-VGSKILDVKATDEDSDVNGLVTYNIE----RGDNIGQ--FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIF---SSSNYSVVLQENRLLGYVFLTFKISDAD--ETPNTTPYTFDIRSGNEGGLFRL-EQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYS 3570          

HSP 6 Score: 144.821 bits (364), Expect = 1.926e-34
Identity = 197/780 (25.26%), Postives = 343/780 (43.97%), Query Frame = 1
Query:  112 EESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAK----DLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY-----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYS-----IIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKD--ATRNISF-LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGT-QFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGN-TPLKSVPTTLTI 2382
            E +PP  ++      ++L    + +  F I  D++   +F ++  +GE  +   +DRE         +S  L       ++ VF     + +V I + D ND+ P F+  +    + E    N E  ++L K    D D GPN    Y LE  ++    N +  F +++Y     L + LD +V    N+ +I  A D G P       ++I++ DYNDN P+F      ++V E    G+ +  ++  D D      +++F+   VS  K++     F+I K SG + + + LD +    + + + A D        +A ++I ++DIND+TP   +KP+  I         + +++  IG  +V         +V  +    + K+   +S  G D          +      DRE    + +    +D           I I ++D+N++ P+ +     V++ ED  +      V   DKD    R I + L+ E  N  YF I +  G I++  +LDRE I  + + +  ED    G  +  +  ++ V+++D NDN P          I+E N     ++ +V+A   DIG NA + Y   +I   NE  K   F ++   G+L    +LD E    Y +++   D G PP +    + ++I+D NDN+P +     QN   IN+ +  + G  I  + A D D+  N  VTY + + +   N   F +    GTI V+  L   T+  + L +QA D G+     SVP  + I
Sbjct: 2774 ESTPPGTVL------TKLHMIGNYTFKFSIAADQD---HF-MISDSGELILQQTLDREQ-------QESHNLIVVAETSTVPVFFA---YADVLIDVRDENDNYPKFDNTFYSASVAE----NSEKVISLVKVSATDADTGPNGDIRYYLESDTE----NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVI--AADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIE-KQEMDFFI---VSGDKQAQ----FQIGK-SGELFIAKPLDREQLMFYNLSIIATD---GKFTAKANVEIDVKDINDNTP-YCLKPRYHI---------STNESISIGTTLV---------EVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE--NHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAED---CGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILE-NATHGTEVCKVYATSIDIGVNADIHY---FIMSGNEQGK---FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFL----QNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGD---NIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININI 3473          

HSP 7 Score: 134.035 bits (336), Expect = 4.263e-31
Identity = 184/723 (25.45%), Postives = 315/723 (43.57%), Query Frame = 1
Query:  379 WINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGD--PIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAK-LTPSFFMRLEAHDSGESPLMGQAVMK--IIIEDINDHTPQIS--------IKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNG-----------KVSCVINKD--EEKILLKVSNNG----DDRMIYSIIANHTFDREAESLFTI-SITCKDYG-----QPPLSTSQTIEI------CISDVNEHPPVINNNIKE---VNISEDVSI------GQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQF-TTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNGNTPLKS 2361
            + +V I I+  + ++P+F      + I E   IN         D D+G N +         +I G N    F +N     LY   +LD +     +Y+L + A D  +    +    K+ I V D NDN PIF     +++++E    GS + ++ A DRDSG    I+Y    S++N      VP F+I   SG +     LD + +  ++ + + A D G  P   Q  +K  I+++DIND+ PQ           K  P   +  ++   + D    I   + +DG+  ++G            +SC + K     +IL   + +G    DD +I   +       ++  L    S  C++ G        LS ++   +        SD++  P     N+     VN  +++SI      G+    +E +D+D   N  + F I +      F ID   G+++I   LDRE+ + Y++ I V D   LG    +TS  L ++++D NDN+P +  +     + E +  +   +  + A D D G NA V Y ++        ++   FT+N   G L     LDREK D Y + +   D G+P  + E ++ V + D NDNAP++     Q  I  + +    G ++A I A D D   NA + ++L   E   +  +F++ +  G I+   +L  +   +H   + A D G+  L S
Sbjct:  383 YKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYL------EIVGGNEGDEFRINPDSGMLYTAKQLDAE--KKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISY----SIANLNA---VP-FEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWG-LPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRL-SDGN--EDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYD---LGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTE-SARIGTVVHCLHATDADSGINAQVTYALS--------VECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGV---QEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLK--EETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTS 1068          

HSP 8 Score: 132.109 bits (331), Expect = 1.601e-30
Identity = 141/500 (28.20%), Postives = 216/500 (43.20%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWI-NVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGK-VSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIY-----FSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNK 1677
            E  +YF+I + TG   +   +DRETI  F        +KA++C       VPK H I  V + I DIND+ P F       +I E  +   E     A  +DIG N    Y       I   N +  F ++     L L + LDY++   K Y L ++A DGG P    +  ++I + D NDN P F+++ Y +NV+E   VGS+I  V ATD DS + G + Y       N ++   +  F I   +G I ++R LD +    + + ++A D G+        + I I D ND+ P  S        +  + L EN           ++D D   N    +  I    E  L ++  +G  R       NH    E    F I +   D G PPL +   + + I + +++PP++      +N  ED   G     V   D+D    ++F +    + +Y     F+I    GKI   SNLD   I  Y + + V D K
Sbjct: 3211 ENHDYFKISKSTGIIRLHKSLDRETISLFNLT-----VKAEDCG------VPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYF------IMSGNEQGKFKMDSTTGDLVLNATLDYEM--SKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTY-------NIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSS------NYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRF--NHNLQDE----FVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD---IGLYKLNVSVSDGK 3669          

HSP 9 Score: 107.457 bits (267), Expect = 5.094e-23
Identity = 118/474 (24.89%), Postives = 208/474 (43.88%), Query Frame = 1
Query:  712 LSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSG-----ESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNG---KVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINK---IYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDV-YKISLLLTDKGNPPQTKEEIILVNII-DKNDNAPIWK 2094
            + I+V D ND  P+F  ++Y V + E T     I +V A D D G+ G I Y +          ++  +F I   +G I L ++L       F + + A+D G     ++    +  + I ++ +N + P+I  K    +       P +N      G++ V D D G NG   ++  V    +   LLK +   D+  I      H    +   ++ +++  +D G P     +++ I I   +++ P+    I EV+I E   I      ++V D D  +N + +  E +       F I+   G +     LD EK   Y + +   D   +G++  +S  + +SV D NDN P   N +KVI+I E N      + ++ A D D G N+ + Y+I         +    F I+  +G +   + LD E     Y++ +  +D G P + + EI L  ++ D NDN P ++
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLL---------MDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVT------PTSNP--LIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHL--NQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKN-ALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLA-GSFVVKLTAKDRDSGENSYISYSIAN-------LNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFE 614          

HSP 10 Score: 105.531 bits (262), Expect = 2.219e-22
Identity = 146/587 (24.87%), Postives = 249/587 (42.42%), Query Frame = 1
Query:  385 NVEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSII------ANHTFDREAESL----FTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFP 2100
            NV IT++D+ND+ P F EP++        V   F   L  A D DI   +  EYK+     ++G   +   I  L     L++ L++   D  +  L +   DG   +   + +L I +   N   P+F +S Y   V E    G  I  V A+D D G Y ++    YE VS   K +    F I + +G I      D +    + + L+  D G     G A +K+I+ D+ND+ P   +K      +  + +    + N  I  +   D DI  NG V             ++    +D+ +  +I       +  F  +AES     +   +   D G+P   +   + I I + + + P    +   + I E    G     + +       N +F      ++ +F I    G++ ++  LDRE+ + + + +V E +      F     + + V D NDN P   N+    ++ E +  V   + +V A D D G N  + Y   Y++   E I + +F I+  +G +  LTSLDRE    Y   ++  D G+P    +  + + I+D NDNAP++K P
Sbjct: 2434 NVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQF-VALPKAYDKDISDTDSLEYKI-----VYGNELQTYSIDKLTGVISLQNMLNF--TDKSSTVLNISVSDG---VHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANL---YYEIVSEEMKKI----FLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGK--FGFASLKVIVVDVNDNVPYFLLK------EYKMVVSTTVEANQTILTVKAKDDDIVDNGSVH-----------FQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHM-----IGNYTFKFSIAADQDHFMISDS-GELILQQTLDREQQESHNLIVVAETSTV--PVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVI-SLVKVSATDADTGPNGDIRY---YLESDTENI-QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLP 2970          

HSP 11 Score: 94.7449 bits (234), Expect = 3.766e-19
Identity = 133/625 (21.28%), Postives = 263/625 (42.08%), Query Frame = 1
Query:  652 YSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGE--SPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQP-PLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDN---------------KQLG----------------TQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYG--VKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEII---KEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGN-------------PPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKS 2361
            Y+L L A D G P +  ++ + I++   + N PIF +  Y V++ E   +   + R+  +D D G     N  +Y  +    +  E   F+I+ +SG +   ++LDA+   S+ + + A D     S     A +KI ++D+ND+ P      K      ++S+ ENN   +++  +   D D G+N  +S  I  +   +  ++ +        S++   T  R  E +    I   D+G P    T   + I + D+N++ P          +++   +G E F     D DA   IS+ + +      F++D   G + I  +L +  +   I+ +   D                + LG                T      + T+S+ + N+ K    +    +++    YG  V    F  F  +  I  +  +  T+ +I+ ++  +    + VF I+  +G+  ++  +D ++ ++  I  L  ++ N             P ++  +++ + I+D NDN P+ +          LT+    G ++  +HA D D+  NA VTY L+     +  + F ++ T G +++ + L  +    + LH+ A D G+  L S
Sbjct:  366 YNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGK----NALVYLEIVGGNEGDE---FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNK------VISINENNLAGSFVVKLTAKDRDSGENSYISYSI-ANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELI----IRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAIS--DGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLAT---FRLTESARIGTVVHCLHATDADSGINAQVTYALS-----VECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSS 962          

HSP 12 Score: 90.1225 bits (222), Expect = 1.058e-17
Identity = 175/747 (23.43%), Postives = 301/747 (40.29%), Query Frame = 1
Query:  208 DEEKKNYFRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEH---WINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLD--------IGPNNIQEYKLEQPSDIFGL-NYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRI-ILNRKLDAKLTPSFFMRLEAHD---SGESPLMGQAVMKIIIE--DINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEF-FTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINI-IEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP---GQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTL 2376
            D+  KN+F+I   TG   +  ++D ET   +  +V  SD  K            PK H     +V I + ++ND  PVF      + +      N       AKD D        +  N  + +++E+ + I    N+E   ILN            + ++Y+L +RA DG   I      + I+V    D+   F +  Y  +  E     + I          GL   I   + E+V  ++       F I  +SG +       D ++   + + +EA      G +  + +AV  I I   D+ND+ P     P         ++  ++ K   I  +   D D  +NG+V   + K   + L K+     +  I   +  H  + E      +++   D    P S+   +++ +  ++   PV       V++ EDV +      ++E E       I  +  E+ +   F ID   G I + + LD EKI  + + I   D+    +       L+VS+MD ND  P +   S + N+ I  N     +I ++ A DND G+NA + Y I  I  +N     ++F I+  +G L+  T LD E+   + I + + D G+P  +    + + + D NDNAP +  PS        TK++     GQ +A   AYD D  +  ++ Y +         +I KL        +  F      VL++  SD  +T    +  +L
Sbjct: 1866 DDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGK------------PKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFE---ILN----------NENDRDYALHVRASDG---IFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATI----------GLVNVIGNTLDENVE-YRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPY------YATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGE-LFKLDRKSGELSIKQHVEGHNRNYE------LTVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQS---FEIDYNTGSIFVVNELDYEKISSHDVSIRATDSL---SGVYAEVVLSVSIMDVNDCYPEI--ESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQN---NSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPS------YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISL 2541          

HSP 13 Score: 88.1965 bits (217), Expect = 4.561e-17
Identity = 169/749 (22.56%), Postives = 305/749 (40.72%), Query Frame = 1
Query:  226 YFRIVEKTGEFYVAGR-IDRETICS-FKEVGDSD---PLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE--QPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDY---NDNPPIFMK--SEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKI-LLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVED--NKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAP-------IWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQV---TEFLTLKMFVLHLQASDNGNTPLKSVPTT-LTIR 2385
            YF I  KTG      R +DRE       EV  SD   P+ +   ++ ++V               DIND+ P F+     +++    ++N       A D D G N    Y ++  +  + F ++ +   I   ++   LD D      + + ++A D G P +    +++I V      + N P+ ++  SE +V+++E    G  + +++A D D       N  ++ ++SN         F I +++G I+L++ LD +   S+ + +   D   +      V  I   DIND+ PQ +     D+    +++ EN ++ + I  +  TD D  +         +D   + L ++     D +  ++I     D E  +   + +  KD G P       I + + D N+H P     I +  + E  +IG +   V   D+D+  N      +I   +  + F ID  FG I +  NL+  KI  Y++ +   D  N  L +Q      +T+S  D     P    ++  I I E N  +   + QV A  +      ++   IN           + F IN   G +    ++D E   V+ +++  T+     ++  + I+++I+D NDN P       +   P        + K+    +   T+   D D   N  V Y +      L  N FK+  T G I++    ++ T   +   +  SD G   L S  T  +TIR
Sbjct: 1240 YFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVL--------------DINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHI---HIAKPLDSD----NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD-------NDQLWYNISNGNDD---NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVI---DINDNPPQFA----KDV--YHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRI-----DSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSV-FEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDP----PKFPTNNIAIEIFE-NLPIGTFVTQVTARSSSSIFFNIISGNIN-----------ESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMA--AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD---DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIR 1921          

HSP 14 Score: 87.0409 bits (214), Expect = 8.885e-17
Identity = 130/529 (24.57%), Postives = 216/529 (40.83%), Query Frame = 1
Query:  223 NYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLT--VFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLK-VSNNGDDRMIYS-----IIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIG----------QEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKP 1749
            N F I +  G   ++  +D ET  S+            N  +S+T   F     + N+ + + DIND+ P F  +   + I E +          A D D            Q      L        N+ +  +LD++      + LI+   D G P +  + K+ + V+D+ND+ P F        V E  A+GS++  V A DRDSG    I Y +   ++ +  SV    F+I    G I L   L+      + ++++A D G  PL  Q  + II+  ++++ P     PK          P NN     I + I  +  IG    V+ V  +    I    +S N ++    +     I+ N   D E+  +F  ++T K       S+ Q I I I D N++ P    N     + E  +IG          ++  T++V+D D   N  + + I + + K +F ID   G I++   LD E    Y   + V D  +     TT+  +T+ V++ ND  P
Sbjct: 1450 NTFYIGQDNGNILLSKYLDYETQQSY------------NLTISVTDGTFTA---FTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFE--KTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSI---ITGNVGSV----FEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVT-MSENDP-----PK---------FPTNN-----IAIEIFENLPIGT--FVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVF--NLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPP 1930          

HSP 15 Score: 64.6994 bits (156), Expect = 5.604e-10
Identity = 124/571 (21.72%), Postives = 231/571 (40.46%), Query Frame = 1
Query:  754 FMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINY-FMYESVSNHKKSV---------EVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEA----HDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYG-----QPPLSTSQTIEICISDVNEHPPVINN---------------NIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSF-SLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEI--ILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVT---EFLTLKM-FVLHLQASDNG 2343
            F  S Y V + E + +G    + +  +R +GL   +N    Y  +S  K+ +         +  F  I   +  ++LNR    + T  + +R++A    HD   S    +A + I + D ND +P     P        + +PE+  K   I  +   D D+G NG++   +  D E   +  +          I           S F +++   D G     Q   ++   + I +  VN + P I                  I  VN  +D  I      +E+ D +          ET ++ Y  ++ +F  +  +  +       Y + ++ ED   LGT    ++ S+ + +   + N P        ++I E    +   + ++   D D+G NA+V   I      +E      F IN  +G L+    LD EK   Y +++   D+ N    K+    + +++ D NDN PI++     N +I++ +    G  +  + A D D+ EN+ ++Y++      LN+  F++    G ++ T   +F T+K  + L ++ASD G
Sbjct:   62 FSHSVYNVTIPENS-LGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNR----EKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPL--FYPT----QYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTG-------EITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVN-DKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELN-QFAHLNQQHFI-------YNLTLLAED---LGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPE-TAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE------FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFE---NVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIAN----LNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWG 588          
BLAST of protocadherin-9 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 205.297 bits (521), Expect = 3.962e-53
Identity = 195/712 (27.39%), Postives = 328/712 (46.07%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVP-VFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKV-SNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASD 2337
            +K+  F+I  K+GE ++A  +DRE +  +        + A + K +           NVEI ++DIND+ P   +P +  I  +E +SI        A D D   + ++ Y   + +D F +  E      L + S LD +      Y L+    DG D  Q    ++ I VND NDN PIF  ++Y V+V E   + + I +V A D+D G+   I Y +     NH       +FKISK++G I L++ LD +    F + ++A D G   L   A + + I DIND+ P+ S++           + EN      +  +  T  DIG N  +   I    E+   K+ S  GD      ++ N T D E    + ++I   D G PPLS +  + I I D+N++ P    N+  +N++ED+ +G +   V+  D+D+  N  +++ I+   N   FSID K G I +   LDRE I  Y + I   D  Q   Q   S  + ++++D NDN P + +SS    +++ N  +   +F  F + +   +     YT + I+  NE     +F +  ++G L   +  +    D + I + + D G PP   +  ++V II+++   PI    +P    IN  +  + G  I  +HA D D  +  N +      +   +S +F +    G I     L + ++ L++  SD
Sbjct: 3009 DKQAQFQI-GKSGELFIAKPLDREQLMFYNL-----SIIATDGKFTAKA--------NVEIDVKDINDNTPYCLKPRYH-ISTNESISIGTTLVEVKAIDFDF-QSKLRFYLSGKGADDFSIGKESGI---LKVASALDRETT--PKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMG--ENHD------YFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYS------CKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGD------LVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACD--QGDPQRCNSVPININILDTNDNAP-IFSSSNYSVVLQENR-LLGYVFLTFKISDADETPNTTPYTFD-IRSGNE---GGLFRL-EQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIV---TPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLDIGLYKLNVSVSD 3667          

HSP 2 Score: 166.392 bits (420), Expect = 4.337e-41
Identity = 204/782 (26.09%), Postives = 342/782 (43.73%), Query Frame = 1
Query:  229 FRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDE-RVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY-----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQ-KLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYE------------------SVSNHKKSVEVPFFKISKNSGR-----IILNRKL-------DAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQI----SIKP--------KPDIPDC--MLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLT-VSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVF-------------ALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY---PGQIIATIHAYDNDTLE-NANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPL 2355
            FRI   +G  Y A ++D E   S+   V   D            V   K+    V+I+++D+ND+ P+FE   KVI I+E  ++ +F   L  AKD D G N+   Y +   + +       PF ++ +       S LD++    +NY LI+RA D G P +   + KLSI V D NDN P F +      V++   +G+E+F   A D D+G    I+Y + +                  S    K ++     K+S   G      +I+N  L       D+ +    F   E  ++G +  + + +      ++   +P +    S+ P        +P+  +    LS+ E+      +  I   D D+G NGK+   I+  +   + ++     DR    II     DRE ++ + ++IT  D G P  STS+ + I I DVN++ PVI   +    ++E   IG     +   D D+  N       ++    F+++   G +++   LDREK D Y + I  +D    G+   +S +L  V V D NDN P               +GV+E IF+V              A+D DIG NA +++++     + E   E++F I++  G +     LD E   V+ + +   D G+P  T +  I++ IID N+N    +F    +D +   K+      G  +  + A D DT++ N+ +TY++T  +      IF +++ QG+I     L   T   + L L A D    PL
Sbjct:  448 FRINPDSGMLYTAKQLDAEKKSSYTLTVSAID---------QANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLT-AKDRDSGENSYISYSIANLNAV-------PFEIDHFSGIVKTTSLLDFETMK-RNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHG-FGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRID---PDRGELQIIG--YLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDG---GSPVLSSEALVYVLVDDVNDNAPV--------------FGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSL-----KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNEN----RFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGD---GLGIFAVND-QGSITSLSQLDAETKNFYWLTLCAQDCAIVPL 1173          

HSP 3 Score: 162.925 bits (411), Expect = 5.166e-40
Identity = 186/719 (25.87%), Postives = 320/719 (44.51%), Query Frame = 1
Query:  187 LTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVF----VPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLS--LPENNDKNAYIGLIIVTDGD-IGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEV--EDKDATRNISFLIQETINKIYFSIDRKFGKIK-IKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINI-IEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQT---KEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL 2298
            L F I  D +  + FRI    GE  + G +DRE              +     L++TV+      K     + ITI D+ND+ PV +       + E   I        A D D G N    Y L      F +N        L L   LD +  D  NY+L + A DGG P+      + + V+D NDN P+F   EY+  V E    G+ +  + A D D G    I + + E   + +       F+I K++G I     LD +      + + A D G+  L     + I+I D+N++      +  P+  D +    + EN  K  ++  +   D D +  N K++  I   +   +  V++ G      SI +    D E ++ + +++  +D    PLS    + I + + N++ P+ +  +  VN++E      E  T++    D D T+ I++ I       YF ID K G IK  +  LDRE    +I+ + + DN   G+   +S S + VSV+D NDN P      +V  + +  +  V + IFQV A+D+D G N  + Y+I   K +N+      F I+ + G +     LD +  + ++I +   D G P ++   +  I++V +   + NAP+    + +N +++LT+   PG ++  I A D+D   N  + Y ++      + N F + +  G I ++++L
Sbjct:  807 LVFAI-SDGDYDSVFRIDPDRGELQIIGYLDRE--------------RQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGC---LRLNKPLDREKQD--NYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEE------LFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNEN------RFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQG------SITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDN---GSPVLSSTSRIVVSVLDINDNSPEF--DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNK------FRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSEN-VVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGN---DDNTFYIGQDNGNILLSKYL 1467          

HSP 4 Score: 155.221 bits (391), Expect = 1.378e-37
Identity = 164/673 (24.37%), Postives = 299/673 (44.43%), Query Frame = 1
Query:  412 NDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVI---NKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEH--PPVINNNIKEVNISEDVSIGQEFFTVEVEDKDAT---RNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTI---NYIKYRNEIIKEKVFTINRKNGELFAL-TSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAP-----IWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL-TLKMFVLHLQASDNGNTPLKS 2361
            N H P F    + + I+E V +        AKD D+G N    + +         +Y+  F ++     L +   LD +  +   Y L +   D G+P +   + L I + D NDN P+  K+     ++E   +G+ +  + ATD DSG+   + Y +         SVE   F ++  +G + LN+ LD +   ++ + + A D G   L  +A++ ++++D+ND+ P   ++      + +  + E+  +   + +I   D DIG N ++   +    +DEE  L ++     D+   +I      D E + +  + ++  D G P L++  +I I I DVNE+   P  ++ + E  + E+   G     V   D D       I++ I        F+++ + G I   S LD E  + Y + +  +D   +    +    + + V + NDN P        +N+ E +    E I  + A D DI     + Y I   N + Y         F I+ K G +      LDRE    + + + ++D G+P  +    I+V+++D NDN+P     ++K   P +  +N        Q I  +HA D+D+ EN  +TY+   ++     N F++   +G I + + L +   F +H++A DNG  P KS
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDG------DYDSVFRIDPDRGELQIIGYLDRERQN--EYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL---------SVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQ------EYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEE--LFRI-----DKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQ-GSITSLSQLDAETKNFYWLTLCAQDCAIV--PLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVE-IITLKAFDPDIDPTQTITYNIVSGNLVGY---------FEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVN--------QSIFQVHAIDSDSGENGRITYS---IKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNG-IPKKS 1383          

HSP 5 Score: 152.14 bits (383), Expect = 1.209e-36
Identity = 156/578 (26.99%), Postives = 251/578 (43.43%), Query Frame = 1
Query:  652 YSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIII--EDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQ-FTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKS 2361
            Y+L + A DG    +     + I V D NDN P  +K  Y ++ +E  ++G+ +  V A D D      + +++    ++         F I K SG + +   LD + TP +  +L AH         +   +III   DIND+ P  S+          +S+PE+   N  I  +   D D G N ++   +  +         + G  R+      + + DRE  SLF +++  +D G P L +  T+ + I D+N++PP  +       I E+ + G E   V     D   N  I + I     +  F +D   G + + + LD E    Y + I   D    GT   + +  + +S++D NDN P  L +   IN+ E  + V  KI  V A D D   N +V Y I     R + I +  F+I+ KNG +     LDRE    Y + +   D+G+P +     I +NI+D NDNAPI+   S  N  + L +    G +  T    D D  E  N T     +       +F+L E  G+++        +   FV+ ++  DNG  PL S
Sbjct: 3036 YNLSIIATDGKFTAKA---NVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD--FQSKLRFYLSGKGADD--------FSIGKESGILKVASALDRETTPKY--KLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMA------QYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRL------HKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDG---GTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIF-VGSKILDVKATDEDSDVNGLVTYNIE----RGDNIGQ--FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIF---SSSNYSVVLQENRLLGYVFLTFKISDAD--ETPNTTPYTFDIRSGNEGGLFRL-EQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYS 3570          

HSP 6 Score: 144.821 bits (364), Expect = 1.926e-34
Identity = 197/780 (25.26%), Postives = 343/780 (43.97%), Query Frame = 1
Query:  112 EESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAK----DLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY-----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYS-----IIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKD--ATRNISF-LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGT-QFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGN-TPLKSVPTTLTI 2382
            E +PP  ++      ++L    + +  F I  D++   +F ++  +GE  +   +DRE         +S  L       ++ VF     + +V I + D ND+ P F+  +    + E    N E  ++L K    D D GPN    Y LE  ++    N +  F +++Y     L + LD +V    N+ +I  A D G P       ++I++ DYNDN P+F      ++V E    G+ +  ++  D D      +++F+   VS  K++     F+I K SG + + + LD +    + + + A D        +A ++I ++DIND+TP   +KP+  I         + +++  IG  +V         +V  +    + K+   +S  G D          +      DRE    + +    +D           I I ++D+N++ P+ +     V++ ED  +      V   DKD    R I + L+ E  N  YF I +  G I++  +LDRE I  + + +  ED    G  +  +  ++ V+++D NDN P          I+E N     ++ +V+A   DIG NA + Y   +I   NE  K   F ++   G+L    +LD E    Y +++   D G PP +    + ++I+D NDN+P +     QN   IN+ +  + G  I  + A D D+  N  VTY + + +   N   F +    GTI V+  L   T+  + L +QA D G+     SVP  + I
Sbjct: 2774 ESTPPGTVL------TKLHMIGNYTFKFSIAADQD---HF-MISDSGELILQQTLDREQ-------QESHNLIVVAETSTVPVFFA---YADVLIDVRDENDNYPKFDNTFYSASVAE----NSEKVISLVKVSATDADTGPNGDIRYYLESDTE----NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVI--AADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIE-KQEMDFFI---VSGDKQAQ----FQIGK-SGELFIAKPLDREQLMFYNLSIIATD---GKFTAKANVEIDVKDINDNTP-YCLKPRYHI---------STNESISIGTTLV---------EVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGE--NHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAED---CGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILE-NATHGTEVCKVYATSIDIGVNADIHY---FIMSGNEQGK---FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFL----QNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGD---NIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININI 3473          

HSP 7 Score: 134.035 bits (336), Expect = 4.263e-31
Identity = 184/723 (25.45%), Postives = 315/723 (43.57%), Query Frame = 1
Query:  379 WINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGD--PIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAK-LTPSFFMRLEAHDSGESPLMGQAVMK--IIIEDINDHTPQIS--------IKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNG-----------KVSCVINKD--EEKILLKVSNNG----DDRMIYSIIANHTFDREAESLFTI-SITCKDYG-----QPPLSTSQTIEI------CISDVNEHPPVINNNIKE---VNISEDVSI------GQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQF-TTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNGNTPLKS 2361
            + +V I I+  + ++P+F      + I E   IN         D D+G N +         +I G N    F +N     LY   +LD +     +Y+L + A D  +    +    K+ I V D NDN PIF     +++++E    GS + ++ A DRDSG    I+Y    S++N      VP F+I   SG +     LD + +  ++ + + A D G  P   Q  +K  I+++DIND+ PQ           K  P   +  ++   + D    I   + +DG+  ++G            +SC + K     +IL   + +G    DD +I   +       ++  L    S  C++ G        LS ++   +        SD++  P     N+     VN  +++SI      G+    +E +D+D   N  + F I +      F ID   G+++I   LDRE+ + Y++ I V D   LG    +TS  L ++++D NDN+P +  +     + E +  +   +  + A D D G NA V Y ++        ++   FT+N   G L     LDREK D Y + +   D G+P  + E ++ V + D NDNAP++     Q  I  + +    G ++A I A D D   NA + ++L   E   +  +F++ +  G I+   +L  +   +H   + A D G+  L S
Sbjct:  383 YKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYL------EIVGGNEGDEFRINPDSGMLYTAKQLDAE--KKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISY----SIANLNA---VP-FEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWG-LPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRL-SDGN--EDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYD---LGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTE-SARIGTVVHCLHATDADSGINAQVTYALS--------VECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGV---QEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLK--EETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTS 1068          

HSP 8 Score: 132.109 bits (331), Expect = 1.601e-30
Identity = 141/500 (28.20%), Postives = 216/500 (43.20%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWI-NVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGK-VSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIY-----FSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNK 1677
            E  +YF+I + TG   +   +DRETI  F        +KA++C       VPK H I  V + I DIND+ P F       +I E  +   E     A  +DIG N    Y       I   N +  F ++     L L + LDY++   K Y L ++A DGG P    +  ++I + D NDN P F+++ Y +NV+E   VGS+I  V ATD DS + G + Y       N ++   +  F I   +G I ++R LD +    + + ++A D G+        + I I D ND+ P  S        +  + L EN           ++D D   N    +  I    E  L ++  +G  R       NH    E    F I +   D G PPL +   + + I + +++PP++      +N  ED   G     V   D+D    ++F +    + +Y     F+I    GKI   SNLD   I  Y + + V D K
Sbjct: 3211 ENHDYFKISKSTGIIRLHKSLDRETISLFNLT-----VKAEDCG------VPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYF------IMSGNEQGKFKMDSTTGDLVLNATLDYEM--SKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTY-------NIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSS------NYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRF--NHNLQDE----FVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD---IGLYKLNVSVSDGK 3669          

HSP 9 Score: 107.457 bits (267), Expect = 5.094e-23
Identity = 118/474 (24.89%), Postives = 208/474 (43.88%), Query Frame = 1
Query:  712 LSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSG-----ESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNG---KVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINK---IYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDV-YKISLLLTDKGNPPQTKEEIILVNII-DKNDNAPIWK 2094
            + I+V D ND  P+F  ++Y V + E T     I +V A D D G+ G I Y +          ++  +F I   +G I L ++L       F + + A+D G     ++    +  + I ++ +N + P+I  K    +       P +N      G++ V D D G NG   ++  V    +   LLK +   D+  I      H    +   ++ +++  +D G P     +++ I I   +++ P+    I EV+I E   I      ++V D D  +N + +  E +       F I+   G +     LD EK   Y + +   D   +G++  +S  + +SV D NDN P   N +KVI+I E N      + ++ A D D G N+ + Y+I         +    F I+  +G +   + LD E     Y++ +  +D G P + + EI L  ++ D NDN P ++
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLL---------MDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVT------PTSNP--LIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHL--NQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKN-ALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLA-GSFVVKLTAKDRDSGENSYISYSIAN-------LNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFE 614          

HSP 10 Score: 105.531 bits (262), Expect = 2.219e-22
Identity = 146/587 (24.87%), Postives = 249/587 (42.42%), Query Frame = 1
Query:  385 NVEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY----LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSII------ANHTFDREAESL----FTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFP 2100
            NV IT++D+ND+ P F EP++        V   F   L  A D DI   +  EYK+     ++G   +   I  L     L++ L++   D  +  L +   DG   +   + +L I +   N   P+F +S Y   V E    G  I  V A+D D G Y ++    YE VS   K +    F I + +G I      D +    + + L+  D G     G A +K+I+ D+ND+ P   +K      +  + +    + N  I  +   D DI  NG V             ++    +D+ +  +I       +  F  +AES     +   +   D G+P   +   + I I + + + P    +   + I E    G     + +       N +F      ++ +F I    G++ ++  LDRE+ + + + +V E +      F     + + V D NDN P   N+    ++ E +  V   + +V A D D G N  + Y   Y++   E I + +F I+  +G +  LTSLDRE    Y   ++  D G+P    +  + + I+D NDNAP++K P
Sbjct: 2434 NVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQF-VALPKAYDKDISDTDSLEYKI-----VYGNELQTYSIDKLTGVISLQNMLNF--TDKSSTVLNISVSDG---VHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANL---YYEIVSEEMKKI----FLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGK--FGFASLKVIVVDVNDNVPYFLLK------EYKMVVSTTVEANQTILTVKAKDDDIVDNGSVH-----------FQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHM-----IGNYTFKFSIAADQDHFMISDS-GELILQQTLDREQQESHNLIVVAETSTV--PVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVI-SLVKVSATDADTGPNGDIRY---YLESDTENI-QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLP 2970          

HSP 11 Score: 94.7449 bits (234), Expect = 3.766e-19
Identity = 133/625 (21.28%), Postives = 263/625 (42.08%), Query Frame = 1
Query:  652 YSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGE--SPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQP-PLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDN---------------KQLG----------------TQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYG--VKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEII---KEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGN-------------PPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKS 2361
            Y+L L A D G P +  ++ + I++   + N PIF +  Y V++ E   +   + R+  +D D G     N  +Y  +    +  E   F+I+ +SG +   ++LDA+   S+ + + A D     S     A +KI ++D+ND+ P      K      ++S+ ENN   +++  +   D D G+N  +S  I  +   +  ++ +        S++   T  R  E +    I   D+G P    T   + I + D+N++ P          +++   +G E F     D DA   IS+ + +      F++D   G + I  +L +  +   I+ +   D                + LG                T      + T+S+ + N+ K    +    +++    YG  V    F  F  +  I  +  +  T+ +I+ ++  +    + VF I+  +G+  ++  +D ++ ++  I  L  ++ N             P ++  +++ + I+D NDN P+ +          LT+    G ++  +HA D D+  NA VTY L+     +  + F ++ T G +++ + L  +    + LH+ A D G+  L S
Sbjct:  366 YNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGK----NALVYLEIVGGNEGDE---FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNK------VISINENNLAGSFVVKLTAKDRDSGENSYISYSI-ANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELI----IRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAIS--DGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLAT---FRLTESARIGTVVHCLHATDADSGINAQVTYALS-----VECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSS 962          

HSP 12 Score: 90.1225 bits (222), Expect = 1.058e-17
Identity = 175/747 (23.43%), Postives = 301/747 (40.29%), Query Frame = 1
Query:  208 DEEKKNYFRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEH---WINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLD--------IGPNNIQEYKLEQPSDIFGL-NYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRI-ILNRKLDAKLTPSFFMRLEAHD---SGESPLMGQAVMKIIIE--DINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEF-FTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINI-IEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP---GQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTL 2376
            D+  KN+F+I   TG   +  ++D ET   +  +V  SD  K            PK H     +V I + ++ND  PVF      + +      N       AKD D        +  N  + +++E+ + I    N+E   ILN            + ++Y+L +RA DG   I      + I+V    D+   F +  Y  +  E     + I          GL   I   + E+V  ++       F I  +SG +       D ++   + + +EA      G +  + +AV  I I   D+ND+ P     P         ++  ++ K   I  +   D D  +NG+V   + K   + L K+     +  I   +  H  + E      +++   D    P S+   +++ +  ++   PV       V++ EDV +      ++E E       I  +  E+ +   F ID   G I + + LD EKI  + + I   D+    +       L+VS+MD ND  P +   S + N+ I  N     +I ++ A DND G+NA + Y I  I  +N     ++F I+  +G L+  T LD E+   + I + + D G+P  +    + + + D NDNAP +  PS        TK++     GQ +A   AYD D  +  ++ Y +         +I KL        +  F      VL++  SD  +T    +  +L
Sbjct: 1866 DDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGK------------PKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFE---ILN----------NENDRDYALHVRASDG---IFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATI----------GLVNVIGNTLDENVE-YRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPY------YATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGE-LFKLDRKSGELSIKQHVEGHNRNYE------LTVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQS---FEIDYNTGSIFVVNELDYEKISSHDVSIRATDSL---SGVYAEVVLSVSIMDVNDCYPEI--ESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQN---NSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPS------YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISL 2541          

HSP 13 Score: 88.1965 bits (217), Expect = 4.561e-17
Identity = 169/749 (22.56%), Postives = 305/749 (40.72%), Query Frame = 1
Query:  226 YFRIVEKTGEFYVAGR-IDRETICS-FKEVGDSD---PLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE--QPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDY---NDNPPIFMK--SEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKI-LLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVED--NKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAP-------IWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQV---TEFLTLKMFVLHLQASDNGNTPLKSVPTT-LTIR 2385
            YF I  KTG      R +DRE       EV  SD   P+ +   ++ ++V               DIND+ P F+     +++    ++N       A D D G N    Y ++  +  + F ++ +   I   ++   LD D      + + ++A D G P +    +++I V      + N P+ ++  SE +V+++E    G  + +++A D D       N  ++ ++SN         F I +++G I+L++ LD +   S+ + +   D   +      V  I   DIND+ PQ +     D+    +++ EN ++ + I  +  TD D  +         +D   + L ++     D +  ++I     D E  +   + +  KD G P       I + + D N+H P     I +  + E  +IG +   V   D+D+  N      +I   +  + F ID  FG I +  NL+  KI  Y++ +   D  N  L +Q      +T+S  D     P    ++  I I E N  +   + QV A  +      ++   IN           + F IN   G +    ++D E   V+ +++  T+     ++  + I+++I+D NDN P       +   P        + K+    +   T+   D D   N  V Y +      L  N FK+  T G I++    ++ T   +   +  SD G   L S  T  +TIR
Sbjct: 1240 YFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVL--------------DINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHI---HIAKPLDSD----NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD-------NDQLWYNISNGNDD---NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVI---DINDNPPQFA----KDV--YHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRI-----DSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSV-FEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDP----PKFPTNNIAIEIFE-NLPIGTFVTQVTARSSSSIFFNIISGNIN-----------ESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMA--AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD---DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIR 1921          

HSP 14 Score: 87.0409 bits (214), Expect = 8.885e-17
Identity = 130/529 (24.57%), Postives = 216/529 (40.83%), Query Frame = 1
Query:  223 NYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLT--VFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLK-VSNNGDDRMIYS-----IIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIG----------QEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKP 1749
            N F I +  G   ++  +D ET  S+            N  +S+T   F     + N+ + + DIND+ P F  +   + I E +          A D D            Q      L        N+ +  +LD++      + LI+   D G P +  + K+ + V+D+ND+ P F        V E  A+GS++  V A DRDSG    I Y +   ++ +  SV    F+I    G I L   L+      + ++++A D G  PL  Q  + II+  ++++ P     PK          P NN     I + I  +  IG    V+ V  +    I    +S N ++    +     I+ N   D E+  +F  ++T K       S+ Q I I I D N++ P    N     + E  +IG          ++  T++V+D D   N  + + I + + K +F ID   G I++   LD E    Y   + V D  +     TT+  +T+ V++ ND  P
Sbjct: 1450 NTFYIGQDNGNILLSKYLDYETQQSY------------NLTISVTDGTFTA---FTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFE--KTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSI---ITGNVGSV----FEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVT-MSENDP-----PK---------FPTNN-----IAIEIFENLPIGT--FVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVF--NLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPP 1930          

HSP 15 Score: 64.6994 bits (156), Expect = 5.604e-10
Identity = 124/571 (21.72%), Postives = 231/571 (40.46%), Query Frame = 1
Query:  754 FMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINY-FMYESVSNHKKSV---------EVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEA----HDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYG-----QPPLSTSQTIEICISDVNEHPPVINN---------------NIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSF-SLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEI--ILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVT---EFLTLKM-FVLHLQASDNG 2343
            F  S Y V + E + +G    + +  +R +GL   +N    Y  +S  K+ +         +  F  I   +  ++LNR    + T  + +R++A    HD   S    +A + I + D ND +P     P        + +PE+  K   I  +   D D+G NG++   +  D E   +  +          I           S F +++   D G     Q   ++   + I +  VN + P I                  I  VN  +D  I      +E+ D +          ET ++ Y  ++ +F  +  +  +       Y + ++ ED   LGT    ++ S+ + +   + N P        ++I E    +   + ++   D D+G NA+V   I      +E      F IN  +G L+    LD EK   Y +++   D+ N    K+    + +++ D NDN PI++     N +I++ +    G  +  + A D D+ EN+ ++Y++      LN+  F++    G ++ T   +F T+K  + L ++ASD G
Sbjct:   62 FSHSVYNVTIPENS-LGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNR----EKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPL--FYPT----QYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTG-------EITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVN-DKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELN-QFAHLNQQHFI-------YNLTLLAED---LGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPE-TAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE------FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFE---NVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIAN----LNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWG 588          
BLAST of protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 289.656 bits (740), Expect = 5.144e-82
Identity = 220/781 (28.17%), Postives = 362/781 (46.35%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSES-----LTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH 2322
            +L  F++     +   L   I+Q+L Y ++EE   N LIGNI KD  +S  NS +     L +++          R++  TGE F  + RIDRE +C      DS+      C   + V + P +++  I ++I ++D ND+ P+F      I I E   IN    +  A D D GPN++ +Y+L      FGL+     E      L ++  LD +  D   Y + ++  DGG+P +     L + V D NDN P+F +S+  V++ E + VG+ + ++ ATD D G    I Y     VS   +      F ++  +G I + R LD + T    + + A D   SP   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I KD    L  V +N      Y +  +   D E    +   I   D G+P L+ +  + + + D N++PP+    + E+ + E+        T+   D+D+ RN   + Q   N  +F +DRK G +      DRE+ +R++  +   DN     Q  +  ++ V+++D NDN P   ++     + E N      +  +   D D G NAVV  +I        +   + F ++  +G + +  S DRE+   Y   +   D G+PP +    + +N+ID NDN PI  +P P N    L  ++  PG ++A + A D DT  NA + YT+         ++F++    G I + E  T+    LH
Sbjct:    2 DLRDFFLLATLVACFWLDPTIAQELIYPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSE------CSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRR----LFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQ-----YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQ--SQAAVIVTILDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENAVVRLSI--------LNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV---RSLFRIDPVTGNITLEEKPTIADIGLH 748          
BLAST of protocadherin-9 vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 290.041 bits (741), Expect = 8.259e-82
Identity = 220/781 (28.17%), Postives = 363/781 (46.48%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSES-----LTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH 2322
            +L  F++     +   L   I+Q+L Y ++EE   N LIGNI KD  +S  NS +     L +++          R++  TGE F  + RIDRE +C      DS+      C   + V + P +++  I ++I ++D ND+ P+F      I I E   IN    +  A D D GPN++ +Y+L      FGL+     E      L ++  LD +  D   Y + ++  DGG+P +     L + V D NDN P+F +S+  V++ E + VG+ + ++ ATD D G    I Y     VS   + +    F ++  +G I + R LD + T    + + A D   SP   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I KD    L  V +N      Y +  +   D E    +   I   D G+P L+ +  + + + D N++PP+    + E+ + E+        T+   D+D+ RN   + Q   N  +F +DRK G +      DRE+ +R++  +   DN     Q  +  ++ V+++D NDN P   ++     + E N      +  +   D D G NAVV  +I        +   + F ++  +G + +  S DRE+   Y   +   D G+PP +    + +N+ID NDN PI  +P P N    L  ++  PG ++A + A D DT  NA + YT+         ++F++    G I + E  T+    LH
Sbjct:    2 DLRDFFLLATLVACFWLDPTIAQELIYPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSE------CSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRL----FALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQ-----YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQ--SQAAVIVTILDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENAVVRLSI--------LNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV---RSLFRIDPVTGNITLEEKPTIADIGLH 748          
BLAST of protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 289.271 bits (739), Expect = 1.266e-81
Identity = 220/781 (28.17%), Postives = 363/781 (46.48%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSES-----LTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH 2322
            +L  F++     +   L   I+Q+L Y ++EE   N LIGNI KD  +S  NS +     L +++          R++  TGE F  + RIDRE +C      DS+      C   + V + P +++  I ++I ++D ND+ P+F      I I E   IN    +  A D D GPN++ +Y+L      FGL+     E      L ++  LD +  D   Y + ++  DGG+P +     L + V D NDN P+F +S+  V++ E + VG+ + ++ ATD D G    I Y     VS   + +    F ++  +G I + R LD + T    + + A D   SP   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I KD    L  V +N      Y +  +   D E    +   I   D G+P L+ +  + + + D N++PP+    + E+ + E+        T+   D+D+ RN   + Q   N  +F +DRK G +      DRE+ +R++  +   DN     Q  +  ++ V+++D NDN P   ++     + E N      +  +   D D G NAVV  +I        +   + F ++  +G + +  S DRE+   Y   +   D G+PP +    + +N+ID NDN PI  +P P N    L  ++  PG ++A + A D DT  NA + YT+         ++F++    G I + E  T+    LH
Sbjct:    2 DLRDFFLLATLVACFWLDPTIAQELIYPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSE------CSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRL----FALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQ-----YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQ--SQAAVIVTILDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENAVVRLSI--------LNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV---RSLFRIDPVTGNITLEEKPTIADIGLH 748          
BLAST of protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 289.271 bits (739), Expect = 1.266e-81
Identity = 220/781 (28.17%), Postives = 363/781 (46.48%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSES-----LTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH 2322
            +L  F++     +   L   I+Q+L Y ++EE   N LIGNI KD  +S  NS +     L +++          R++  TGE F  + RIDRE +C      DS+      C   + V + P +++  I ++I ++D ND+ P+F      I I E   IN    +  A D D GPN++ +Y+L      FGL+     E      L ++  LD +  D   Y + ++  DGG+P +     L + V D NDN P+F +S+  V++ E + VG+ + ++ ATD D G    I Y     VS   + +    F ++  +G I + R LD + T    + + A D   SP   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I KD    L  V +N      Y +  +   D E    +   I   D G+P L+ +  + + + D N++PP+    + E+ + E+        T+   D+D+ RN   + Q   N  +F +DRK G +      DRE+ +R++  +   DN     Q  +  ++ V+++D NDN P   ++     + E N      +  +   D D G NAVV  +I        +   + F ++  +G + +  S DRE+   Y   +   D G+PP +    + +N+ID NDN PI  +P P N    L  ++  PG ++A + A D DT  NA + YT+         ++F++    G I + E  T+    LH
Sbjct:    2 DLRDFFLLATLVACFWLDPTIAQELIYPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSE------CSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRL----FALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQ-----YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQ--SQAAVIVTILDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENAVVRLSI--------LNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV---RSLFRIDPVTGNITLEEKPTIADIGLH 748          
BLAST of protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 267.7 bits (683), Expect = 2.167e-74
Identity = 211/770 (27.40%), Postives = 359/770 (46.62%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAG-RIDRETICSFKEVGDSDPLKAQNCKLSLTVFVP------KEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSD---IFGLNY---EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDI--PDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNG-DDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNG 2343
            Y V EE PP+ LIG++  D  L +      T  +Y+ E    Y R+  KTG+ +     IDRET+   +        K + C L   V V           I   I ++DIND+ P F      + + E   +     + LA D D   N + +Y L    +   +FGL         +  L +   LD ++ D  +Y L ++A DGG+P +     L + + D NDN P F KS Y   V+E + +G  + +V A D D G  G I Y +++++    K       +I ++SG I +   LD +   +    + A D G SP   +  + I + D ND+ P + I+    +   D + ++ E+      + L+ V+D D G+N  V+CV+  D    L   S++  D++  Y +      D E    + + I   D G P LS++ ++++ ++D N++ P+ +  + EV  +E+   G++   V   D D+  N      +I ++  +  F ID   G+++ +S LDRE  DRY   +   D K + +   T+ ++ + V+D NDN P  + S    +++E N      +  V   D D G NA V+ ++       ++ K   F I    G + +  S DREK   Y   L   D G+PP++    + +N++D+NDNAP+   PS  +  I L+ +  P  ++  + A D D+  NA + Y++    P    ++F +  + G I +T+ LT K   LH   ++ SD G
Sbjct:   27 YRVHEEQPPSTLIGSLAADQGLPD------TGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRN-------KGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKD--SYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPK-----LLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAAD-KGVPSHRGTA-TVVIKVLDRNDNDPKFMLSGYSFSVLE-NMPPLSPVGMVTVQDMDEGENAQVQLSV-----EPDVGK---FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPS-NSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNP---HDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRG 761          

HSP 2 Score: 120.939 bits (302), Expect = 3.411e-27
Identity = 155/640 (24.22%), Postives = 261/640 (40.78%), Query Frame = 1
Query:  241 EKTGEFYVAGRIDRETICSF----KEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNL-------YLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPP--------IFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRK---------LDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGK-VSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSF-SLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVF-ALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNI 2061
            EK  +  V G +DRE   S+    K V   +P +  +  L               + I D ND+ P FE +    E+ E   I        A D D+GPN   EY L Q  D        P +L +       Y+K  LD +  +  N    + A D G   +     +SI V D NDN P        +   S+ + N+SE   VG+ +  V  +D+D G    +   +         + +VPF ++   S   + N++         LD +    + + + A DSG   L     +K+ + D ND++P  S    P +    +   E N     +  ++ +D D G N + V  +I     + L ++  N  +     + A    DRE +  +   +T  D G P    + T+ I + D N++ P    +    ++ E++        V V+D D   N  +   ++  + K  F I    G I    + DREK   Y   +   D    G    +S+  +T++V+D NDN P +   S    I        + + +V  A D D GSNA + Y+I      +      +F I+  NGE+     L R+   ++++ + ++D+G P  ++  I LV+I
Sbjct:  190 EKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALL--------------RVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPV------PKLLRIDRSSGIIYVKGPLDRE--EINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVV---------AGDVPF-QLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFS----PTL--FEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGE-----VRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGK--FVIQNGTGTILSSISFDREKESSYTFRLKAVDG---GDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHD------LFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKP--SRHAIALVHI 773          
BLAST of protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 287.345 bits (734), Expect = 1.195e-81
Identity = 254/861 (29.50%), Postives = 401/861 (46.57%), Query Frame = 1
Query:   46 LFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSL-TVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGL----NYEPPFILNLYLKSKLDYDVPDGKNYS-LILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN---ISFLIQETINKI----YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKE----KVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIIN----LTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL----TLKMFVLHLQASDNGNTPLKSVPTTLTI-------RYWPMETGSLLSGHDS--VSFNLIVTMAVVTCLICLSLLIAIVVVRRRQN 2526
             FSF    L   +   L+YS+ EE    Y+IGNI  D  +S +   S  F I     KK Y  +  + G+ YVA RIDRE +C  +          QNC L++  V     H+  + + I+D+ND+ P F  +   I I E   +     L  AKD D+G N+IQ YKL   +D FG+    N +      L L+  LD +    KN S LIL A DGG P + G   + I V D NDN P+F K  Y V VSE   +G  +  + ATD D G    I Y   +   N ++      F I+  +G + +  KLD ++  ++ M +EA D G   L+    + I + D+ND+ P I I    DI      +PE++     I L+ + D D G+NG+V   I++     L+  S N      Y ++ +   DRE  S + I+I  +D G P L+ S+TI + ++DVN++ PV +       I E+   G  F+ V   D D   N   +  ++ + I  I    Y SI+   G +  + + D EK+  + I    + + QL    T    LT    D NDN P       V  I E N       F+V A D+DI  N  V Y I       +II++       +IN  +G L+A  S D E    + I ++  D G+P ++    + + I D+NDNAP   +PS  ++  +    +   +  G ++  + A D D+  NA ++Y L +V  P   +   + +  G I++T  L     L+  ++ +   DNG  P+ S   TL +       +  P  T   +    S   +F L++++A+++ L   ++L+A++   R+Q+
Sbjct:   22 FFSF----LCESVICQLQYSIYEEQRLGYVIGNIANDLGVSAEELSSRKFHIVS-RSKKQYLNVHLENGDLYVADRIDREALCGMQ----------QNCFLNIEAVMESPLHFYTINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSYKL-SANDYFGMLEKVNTDGRKYPELVLEKTLDRE---KKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADEGSNAEITYLFNDIPENAQE-----VFAINPENGSVQITGKLDYEVATNYEMTVEAKDGG--GLVSYCKLLIQVSDVNDNAPDILITSFSDI------IPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHLISSSGN-----YYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEKLREFYIQAEDKGSPQLTNNKTIRLILT----DVNDNAPVFEKMDYVAYIQENNPS-GSSFFRVHATDSDINENGKVVYMI-----LTDIIEDMPLSSYISINTVSGVLYAQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYHLLQVPDP---SFLIIGQNTGEIRITRDLQETDALRQRIV-VMVKDNG-YPMLSSTVTLNLVVAENFQQVLPEITNQHIDTESSSNATFYLVISIALISILFIFTVLVAVISKCRKQS 830          
BLAST of protocadherin-9 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 286.574 bits (732), Expect = 1.013e-80
Identity = 220/780 (28.21%), Postives = 366/780 (46.92%), Query Frame = 1
Query:   25 LLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH 2322
            L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     D +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F +S+  V++ E   +G+ + ++ ATD D G    I Y     V++  K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   N KV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ +  + E+++SE+   G    TV   D+D+ +N   + Q   N  +F +DRK G +      DRE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  + A D+D G N  V  +I        +   + F ++  +G + +  S DRE+   Y   +   D G PP++    + +NI+D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E  +     LH
Sbjct:    3 LRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLCAGSSNSDEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRL----FALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITATDSDAGENKAVTLSI--------LNDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEEKPSAADVGLH 749          

HSP 2 Score: 117.472 bits (293), Expect = 5.702e-26
Identity = 129/542 (23.80%), Postives = 226/542 (41.70%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNR----------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCML--SLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNIS----FLIQET-INKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKS 2361
            GS    +Y  VS   K+ + P  K+S ++G I                          +L+  + P+ F RL               +KII++D ND+ P          P  ++  S+PEN   N+   +    D D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV   +  EV+I E+  IG     +   D D   N      F  Q T   K  F+++   G I ++  LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N+ V   I +I+       + V+     N  L   +SL D E    +   ++  D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + T+ A D D+ +N+++ Y L       N++ F L    G +  +        + F+  + A DNG  PL+S
Sbjct:   57 GSSTSLVYRLVS---KAGDSPLVKVSSSTGEIFTTSTRIDREKLCAGSSNSDENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF--------PSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIE---LSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGP-----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 281.567 bits (719), Expect = 5.726e-79
Identity = 230/771 (29.83%), Postives = 370/771 (47.99%), Query Frame = 1
Query:   85 SQDLKYSVKEESPPNYLIGNIKKDSRLS--EKNSESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICS--FKEVGDSDPLKAQNCKLSLTVFV-PKE--HWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK----MFVLHLQASDNG 2343
            +Q+  Y V+EE P N LIGN+ KD  L+     S  L F++          R+ E TGE F  + RIDRE +CS  F E           C   + V V P E    + +   IEDIND+ P+F      I I E  ++N    +  A D D+G N IQ Y+L +  ++FGL+     E      L ++  LD +  D   Y + ++  DGG+P +     L + V D NDN P+F + +  VN+ E  AVG+ + ++ ATD D G    I+++    ++N  K      F I  N+G I +   LD + +P   + + A D   +P   +A + I I DIND+ P I  +   +  +  + L E    N  I LI VTD D   NGKV+C  + D   +  ++    D++ +    A    D E+   + I I   D G+PPL+ S  + I I D N++ PV    +  ++  E+   G E   +   D D+ RN  +S+++      I F++DR+ G +     LDREK DRY   ++ +DN     Q  T+ ++T+SV+D NDN P   ++     + E N  +   +  +   D D G NAVV  T++ +  R+  I + +  + R N       + DRE+   Y   +   DKG+P ++    + + + D NDN P++  PS       +   T PG ++A ++A DNDT  NA++ Y++       +  +F + E  G I + E L       ++ L ++ +D+G
Sbjct:   43 AQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTE---------NKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKD--TYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKR----HFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHD---VPFRLKPVFDNQFLLETAA--PLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTI-FNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQ--TNTTVTLSVLDQNDNSPSFTHNEYNFYVPE-NLPMYGTVGLITVTDADSGENAVV--TLSLVNARDNFIIDPLTGVIRPN------ITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGN---SRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSG 776          

HSP 2 Score: 141.739 bits (356), Expect = 1.747e-33
Identity = 143/563 (25.40%), Postives = 251/563 (44.58%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPN-NIQEYKLEQPSDI----FGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVN-------VSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFF--KISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSK--VINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDV-YKISLLLTDKGNP 2025
            +++T+ D+ND+ PVF+     + I E  ++        A D D+G N  I  Y   Q +++    F ++     I    +K  LD +  +   + L + A DG          ++I + D NDN P  + + Y++N       +SEK  + ++I  +  TD+D+ L G +  F     ++H    +VPF    +  N   +     LD + T  + +++ A DSG+ PL   A++ I I+D ND+ P  ++      P   LS  ENN     +  I  TD D G+N ++S ++  +   I         DR    + A    DRE +  +T ++  KD G P L T+ T+ + + D N++ P   +N     + E++ +      + V D D+  N    +     +  F ID   G I+     DRE+   Y   +   D      Q +++  +T+ V D NDNKP  +  S     ++++ +      + +V+A+DND G NA + Y+I     R       +F I  ++G +     L    + V YK+ + + D G P
Sbjct:  253 LQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLIT---VKEPLDRE--ESPYHKLTVLASDGSS--TPSRATVTINITDINDNIP-SIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCF-----TDH----DVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTL------PMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIF------NLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGS--PQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRG------LFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          
BLAST of protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 281.567 bits (719), Expect = 7.273e-79
Identity = 230/771 (29.83%), Postives = 370/771 (47.99%), Query Frame = 1
Query:   85 SQDLKYSVKEESPPNYLIGNIKKDSRLS--EKNSESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICS--FKEVGDSDPLKAQNCKLSLTVFV-PKE--HWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK----MFVLHLQASDNG 2343
            +Q+  Y V+EE P N LIGN+ KD  L+     S  L F++          R+ E TGE F  + RIDRE +CS  F E           C   + V V P E    + +   IEDIND+ P+F      I I E  ++N    +  A D D+G N IQ Y+L +  ++FGL+     E      L ++  LD +  D   Y + ++  DGG+P +     L + V D NDN P+F + +  VN+ E  AVG+ + ++ ATD D G    I+++    ++N  K      F I  N+G I +   LD + +P   + + A D   +P   +A + I I DIND+ P I  +   +  +  + L E    N  I LI VTD D   NGKV+C  + D   +  ++    D++ +    A    D E+   + I I   D G+PPL+ S  + I I D N++ PV    +  ++  E+   G E   +   D D+ RN  +S+++      I F++DR+ G +     LDREK DRY   ++ +DN     Q  T+ ++T+SV+D NDN P   ++     + E N  +   +  +   D D G NAVV  T++ +  R+  I + +  + R N       + DRE+   Y   +   DKG+P ++    + + + D NDN P++  PS       +   T PG ++A ++A DNDT  NA++ Y++       +  +F + E  G I + E L       ++ L ++ +D+G
Sbjct:   43 AQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTE---------NKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKD--TYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKR----HFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHD---VPFRLKPVFDNQFLLETAA--PLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTI-FNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQ--TNTTVTLSVLDQNDNSPSFTHNEYNFYVPE-NLPMYGTVGLITVTDADSGENAVV--TLSLVNARDNFIIDPLTGVIRPN------ITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGN---SRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSG 776          

HSP 2 Score: 141.739 bits (356), Expect = 1.725e-33
Identity = 143/563 (25.40%), Postives = 251/563 (44.58%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPN-NIQEYKLEQPSDI----FGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVN-------VSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFF--KISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSK--VINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDV-YKISLLLTDKGNP 2025
            +++T+ D+ND+ PVF+     + I E  ++        A D D+G N  I  Y   Q +++    F ++     I    +K  LD +  +   + L + A DG          ++I + D NDN P  + + Y++N       +SEK  + ++I  +  TD+D+ L G +  F     ++H    +VPF    +  N   +     LD + T  + +++ A DSG+ PL   A++ I I+D ND+ P  ++      P   LS  ENN     +  I  TD D G+N ++S ++  +   I         DR    + A    DRE +  +T ++  KD G P L T+ T+ + + D N++ P   +N     + E++ +      + V D D+  N    +     +  F ID   G I+     DRE+   Y   +   D      Q +++  +T+ V D NDNKP  +  S     ++++ +      + +V+A+DND G NA + Y+I     R       +F I  ++G +     L    + V YK+ + + D G P
Sbjct:  253 LQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLIT---VKEPLDRE--ESPYHKLTVLASDGSS--TPSRATVTINITDINDNIP-SIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCF-----TDH----DVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTL------PMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIF------NLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGS--PQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRG------LFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          
BLAST of protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 281.182 bits (718), Expect = 7.675e-79
Identity = 230/771 (29.83%), Postives = 370/771 (47.99%), Query Frame = 1
Query:   85 SQDLKYSVKEESPPNYLIGNIKKDSRLS--EKNSESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICS--FKEVGDSDPLKAQNCKLSLTVFV-PKE--HWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK----MFVLHLQASDNG 2343
            +Q+  Y V+EE P N LIGN+ KD  L+     S  L F++          R+ E TGE F  + RIDRE +CS  F E           C   + V V P E    + +   IEDIND+ P+F      I I E  ++N    +  A D D+G N IQ Y+L +  ++FGL+     E      L ++  LD +  D   Y + ++  DGG+P +     L + V D NDN P+F + +  VN+ E  AVG+ + ++ ATD D G    I+++    ++N  K      F I  N+G I +   LD + +P   + + A D   +P   +A + I I DIND+ P I  +   +  +  + L E    N  I LI VTD D   NGKV+C  + D   +  ++    D++ +    A    D E+   + I I   D G+PPL+ S  + I I D N++ PV    +  ++  E+   G E   +   D D+ RN  +S+++      I F++DR+ G +     LDREK DRY   ++ +DN     Q  T+ ++T+SV+D NDN P   ++     + E N  +   +  +   D D G NAVV  T++ +  R+  I + +  + R N       + DRE+   Y   +   DKG+P ++    + + + D NDN P++  PS       +   T PG ++A ++A DNDT  NA++ Y++       +  +F + E  G I + E L       ++ L ++ +D+G
Sbjct:   23 AQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTE---------NKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKD--TYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKR----HFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHD---VPFRLKPVFDNQFLLETAA--PLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTI-FNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQ--TNTTVTLSVLDQNDNSPSFTHNEYNFYVPE-NLPMYGTVGLITVTDADSGENAVV--TLSLVNARDNFIIDPLTGVIRPN------ITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGN---SRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSG 756          

HSP 2 Score: 141.354 bits (355), Expect = 1.976e-33
Identity = 143/563 (25.40%), Postives = 251/563 (44.58%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPN-NIQEYKLEQPSDI----FGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVN-------VSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFF--KISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSK--VINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDV-YKISLLLTDKGNP 2025
            +++T+ D+ND+ PVF+     + I E  ++        A D D+G N  I  Y   Q +++    F ++     I    +K  LD +  +   + L + A DG          ++I + D NDN P  + + Y++N       +SEK  + ++I  +  TD+D+ L G +  F     ++H    +VPF    +  N   +     LD + T  + +++ A DSG+ PL   A++ I I+D ND+ P  ++      P   LS  ENN     +  I  TD D G+N ++S ++  +   I         DR    + A    DRE +  +T ++  KD G P L T+ T+ + + D N++ P   +N     + E++ +      + V D D+  N    +     +  F ID   G I+     DRE+   Y   +   D      Q +++  +T+ V D NDNKP  +  S     ++++ +      + +V+A+DND G NA + Y+I     R       +F I  ++G +     L    + V YK+ + + D G P
Sbjct:  233 LQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLIT---VKEPLDRE--ESPYHKLTVLASDGSS--TPSRATVTINITDINDNIP-SIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCF-----TDH----DVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTL------PMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIF------NLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGS--PQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRG------LFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 758          
BLAST of protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 285.034 bits (728), Expect = 3.176e-81
Identity = 216/771 (28.02%), Postives = 361/771 (46.82%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K      F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      +RE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +   + F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR----LFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDEDAGENKAVTLSI--------LNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 124.405 bits (311), Expect = 2.289e-28
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +     +    F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 284.648 bits (727), Expect = 2.177e-79
Identity = 216/771 (28.02%), Postives = 362/771 (46.95%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      +RE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +   + F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL----FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDEDAGENKAVTLSI--------LNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 126.331 bits (316), Expect = 8.350e-29
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +     +    F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 283.878 bits (725), Expect = 3.738e-79
Identity = 216/771 (28.02%), Postives = 362/771 (46.95%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      +RE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +   + F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL----FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDEDAGENKAVTLSI--------LNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 125.946 bits (315), Expect = 1.159e-28
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +     +    F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 284.263 bits (726), Expect = 4.038e-79
Identity = 216/771 (28.02%), Postives = 362/771 (46.95%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      +RE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +   + F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL----FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDEDAGENKAVTLSI--------LNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 126.331 bits (316), Expect = 8.047e-29
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +     +    F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 284.263 bits (726), Expect = 4.038e-79
Identity = 216/771 (28.02%), Postives = 362/771 (46.95%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      +RE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +   + F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL----FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDEDAGENKAVTLSI--------LNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 126.331 bits (316), Expect = 8.047e-29
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +     +    F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 5.998e-79
Identity = 217/771 (28.15%), Postives = 361/771 (46.82%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + + L + I+Q+L Y+++EE P N  IGNI KD  +S  N     S SL +++          ++   TGE F  + RIDRE +C+     + +      C   L V + P + +  I ++I ++D ND+ P+F      I I E   IN   P+  A D D G N +Q Y+L     +FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V+D NDN P+F + +  V++ E   VG+ + ++ ATD D G    I Y     V+   K +    F ++  +G I + R LD + T    + + A D   +P   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I ++    L  V +N      Y +  +   D E    F+  I   D G+P L+ +  + + + D N++PP+ N  + E+++SE+   G    T+   D+D+ +N   + Q   N  +F +DRK G +      DRE+ +R+I  +   DN     Q  +  ++ V+V+D NDN P   ++     + E N      +  +   D D G N  V  +I        +     F ++  +G + +  S DRE+   Y   +  TD G PP++    + +N++D NDN+P+   P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEEN-----ECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRL----FALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ-----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENKAVTLSI--------LNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 739          

HSP 2 Score: 126.331 bits (316), Expect = 5.257e-28
Identity = 132/540 (24.44%), Postives = 231/540 (42.78%), Query Frame = 1
Query:  853 GSINYFMYESVSNHKKSVEVPFFKISKNSGRIIL--NR--------------------KLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK------IFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL-DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKS 2361
            G+    +Y  VS   K+ + P  K+S ++G I    NR                    +L+  + P+ F RL               +KII++D ND+ P     P P I    +S+PEN   N+   +   TD D G NG     +   +    L +    +      +I     DRE +  + + I  +D G P  S++  +++ +SDVN++ PV      EV+I E+  +G     +   D D   N  I ++    +    K  F+++   G I ++ +LDRE+   + + ++  D    G+      ++T++V D NDN P + +   +I+ I G   + EK      I  +   D D   N  V   I +I+       + V+     N  L   +SL D E    +   ++ +D G P   +  ++ V + D+NDN PI+  P  +   +++++    G  + TI A D D+ +NA++ Y L       N++ F L    G +  +        + F+  + A DNG  PL+S
Sbjct:   57 GTSASLVYRLVS---KAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL-------------IKIKIIVKDTNDNAPMF---PSPVI---NISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD----GSSTPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV---ICFIEREVPFHLKAVY----DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIE---LSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQS 554          
BLAST of protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 277.33 bits (708), Expect = 1.328e-76
Identity = 215/775 (27.74%), Postives = 362/775 (46.71%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETI--CSFKEVGDSDPLKAQNCKLSLTVFV--PKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE---QPSDIFGLNY-------EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIP--DCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNG-DDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNGNTP 2352
            Y V EE PPN LIG++  D    +         +Y+ E    Y R+  KTG+ F     IDRE +  C  +  GD   L+    ++S+T  V       +  +I ++DIND+ P F      + I E  +I    P+ LA D D GPN +  Y+L+   +  ++FGL         +P     L +   LD +  D  +Y L ++  DGG P +     L + V D NDN P F +  Y   +SE + +G  + +V A D D G    I Y  +++    ++       ++ +N+G I +   +D +   +    + A D G +P   +A + + ++D+ND+ P I I+    +   D M ++ E+  +   + L+ V+D D G+N  V+CV+  D    L + S  G D +  Y +      D E    +TI I   D G PPLS++ ++++ + DVN++ PV   ++ EV   E+   G+    +   D D+  N      L  E   K  F+I  + G+I++K++LDRE+ + Y + +V  D      Q T   ++ V+V+D NDN P  + S    +++E N      +  V  +D D G NA V+ ++              F I    G + +  S DRE+   Y   L   D G PP++    + +N++D+NDNAP    PS  +  + LT  T  G+ ++ + A D D+  NA + Y++    P     +F++    G I + + +  +   LH   ++ SD G  P
Sbjct:   62 YKVPEEQPPNTLIGSLAADYGFPD------VGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILE---FEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQP----QLIVMGNLDRERWD--SYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRR-----LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTA--TVLVNVLDCNDNDPKFMLSGYNFSVME-NMPALSPVGMVTVIDGDKGENAQVQLSVEQ--------DNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNP---YGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 801          

HSP 2 Score: 117.472 bits (293), Expect = 3.151e-25
Identity = 144/642 (22.43%), Postives = 253/642 (39.41%), Query Frame = 1
Query:  181 ESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFE-PNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKL-----DYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPP--------IFMKSEYMVNVSEKTAVGSEIFRVIATDRDSG--------LYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKD-EEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSF-SLTVSVMDANDNKPYLLNSSKVIN-IIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQ 2031
            E    Q+ ED+E        EK  +  V G +DRE   S+        +K Q+         P+     + +T+ D ND+ P FE P+++  E+ E   I        A D D G N   EY   Q  ++         +L L   + L       D  D       + A D G   +    ++ + V D NDN P        +    + M N+SE  A  + +  V  +DRD G        + G + + + ++      S +  F + +           LD +    + + + A DSG  PL     +K+ + D+ND+ P  +           ++ PENN     I  I  +D D G N ++   +  +   K L  +S    +     I    + DRE    + + +   D G P L  + T+ + + D N++ P    +    ++ E++        V V D D   N    +    +   F I    G I    + DRE+   Y   +   D    G    +++  +T++V+D NDN PY+   S   + ++     + E + QV A D D G NA + Y+I             +F I   +G +     ++R  + ++++ + ++D+G PP+
Sbjct:  215 ELFGLQVAEDQE--------EKQPQLIVMGNLDRERWDSYDLT-----IKVQDGGSP-----PRASSALLRVTVLDTNDNAPKFERPSYEA-ELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRR------LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT---------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQS------VTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGE-----IQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDG---GVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYG------LFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPR 802          

HSP 3 Score: 106.301 bits (264), Expect = 6.821e-22
Identity = 99/370 (26.76%), Postives = 168/370 (45.41%), Query Frame = 1
Query: 1336 FTISIT-CKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETIN-------KIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWK-----FPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGT---------IQVT---EFLTLKMFVLHLQASDNGNTPLKSV 2364
            F +SIT     G P L   Q   I + D+N++ P   + +  + I E+ +IG  F      D+DA  N   S+ +Q           ++    + K  ++ +  NLDRE+ D Y + I V+D         +S  L V+V+D NDN P     S    + E N  +   + QV A D+D G+NA +EYT +      E+++ ++  ++R  G +     +DRE     + S+L  D+G  P++    ++V + D NDNAP  +       + Q+ + N+++       +A +   D D  ENA VT  +    P      F+L +   T         +Q T   ++  +K + + + A D+GN PL S 
Sbjct:  136 FEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGS--PPRASSALLRVTVLDTNDNAPKFERPSYEAELSE-NSPIGHSVIQVKANDSDQGANAEIEYTFHQAP---EVVR-RLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVP------FQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSST 489          
BLAST of protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 2.027e-75
Identity = 232/787 (29.48%), Postives = 383/787 (48.67%), Query Frame = 1
Query:   43 YLFSFSLIHLT-NQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLT----FQIYEDEEKKNYFRIVEKTGEFYVAG-RIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKE--HWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTF-DREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLT-KITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNG 2343
            Y+F+  L+ +  +  +Q+  Y+++EE P N LIGN+ KD  LS   ++SLT    F++          RI E TGE +  G RIDRE +C+          + ++C   + V + P E    + +   IEDIND+ P+F      I I E  +IN +  L  A D D+G N +Q Y+L +  +IFGL+     E   +  L ++ +LD +  D   Y + ++  DGG P +     L + V D NDN P+F ++E  V++ E   VG+ + ++ ATD D G    I++     VSN  +      F ++  +G I +   LD + TP+  + + A D G  P   +A++ + + D+ND+ P I I+   +  +  + L EN   N  I LI VTD D   NG+V+C  + +    L  V +N        ++ N  + D E+   + I +   D G+PPL+ S  + I + D N++ PV   +   V+I E+ S G +   V   D D+  N  I++L+        FS+DR+ G + +   LDREK D+Y+  I+ +DN       T++ ++ VS++D NDN P   ++     + E N      +  +   D D G N+ V  +I        + +   FTI+ + G +    S DREK + Y   +   D G   ++    + +N++D NDN P++  P P N    L    T PG ++  + A DNDT  NA V Y++         ++F + +  G I + E   +    LH   ++A+D G
Sbjct:   40 YIFAVLLVCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP-------RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKD--TYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARR----LFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN------QFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPP-EFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGV--PPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPE-NLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN---TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 789          

HSP 2 Score: 155.221 bits (391), Expect = 7.450e-37
Identity = 149/576 (25.87%), Postives = 260/576 (45.14%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQ-----PSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVN-------VSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRK--LDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLL----NSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNI 2061
            +++++ D ND+ PVF+     + I E   +        A D DIG N    +            +F LN     I    +K  LD +  +  N+ L++ A DGG  +      + + V D NDN P  +   Y+VN       +SE   + ++I  +  TD+D+   G +  F     ++H    E+PF      S + +L     LD + T  + ++L A D+G+ PL   A++ I ++D ND+ P  +           +S+PENN     +  +  TD D G N +++ ++  D             DR    +      DRE E  +  +I  KD G PPL+++ T+ + I D N++ PV  +N  +  + E++        + V D D   N +  +        F+ID + G I+   + DREK + Y   +  ED  ++    ++S  +T++V+D NDNKP  +    N S  + +   N G    +FQV A+DND G NA V Y+I     R+      +F I+++ G +  +   D     ++++ +   D G  P +   +++VN+
Sbjct:  267 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLIT---IKEPLDRE--ETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVP-SIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF-----TDH----EIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQS------FVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEF------SLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSR--SSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGT--VVFQVIAVDNDTGMNAEVRYSIVGGNTRD------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ-PDSLFSVVIVNL 802          

HSP 3 Score: 127.487 bits (319), Expect = 2.481e-28
Identity = 118/453 (26.05%), Postives = 198/453 (43.71%), Query Frame = 1
Query: 1048 MKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKI---YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKP-----YLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNA-VVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKS 2361
            ++ +IEDIND+ P   + P   I    +S+PEN+  N+   L    D D+G NG  +  + K +    L V    +   +  +I     DRE +  + + +  +D G P  S++  +++ ++D N++ PV      EV+I E+  +G     +   D D   N  I F     ++ I    F ++   G I IK  LDRE+   + + ++  D    G        + V+V D NDN P     Y++N      ++  N  +  KI  +   D D   N  V  +T + I +R   +    F +            LD E    Y I LL  D G PP  +  ++ + + D+NDNAP++     Q+ + +++ +   PG  +  + A D D+  NA + Y L    PP     F L    G + V + L  +    ++  + A DNG  PL S
Sbjct:  157 IRFLIEDINDNAP---LFPATVI---NISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD----GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENA-------AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT----QSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPE----FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTS 584          
BLAST of protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 6.763e-75
Identity = 231/794 (29.09%), Postives = 383/794 (48.24%), Query Frame = 1
Query:   16 MNELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLT----FQIYEDEEKKNYFRIVEKTGEFYVAG-RIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKE--HWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLT-KITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNG 2343
            M+ L   YI+    + + + +  +Q+  Y+++EE P N LIG++ KD  LS   ++SLT    F++          RI E TGE +  G RIDRE +C+          + ++C   + V + P E    + +   IEDIND+ P+F      I I E  +IN +  L  A D D+G N +Q Y+L +  +IFGL+     E   +  L ++ +LD +  D   Y + ++  DGG P +     L + V D NDN P+F ++E  V++ E   VG+ + ++ ATD D G    I++     VSN  +      F ++  +G I +   LD + TP+  + + A D G  P   +A++ + + D+ND+ P I I+   +  +  + L EN   N  I LI VTD D   NG+V+C  + +    L  V +N      + +      D E+   + I +   D G+PPL+ S  + I + D N++ PV   +   V+I E+ S G +   V   D D+  N  I++L+        FS+DR+ G + +   LDREK D+Y+  I+ +DN       T++ ++ VS++D NDN P   ++     + E N      +  +   D D G N+ V  +I        + +   FTI+ + G +    S DREK + Y   +   D G   ++    + +N++D NDN P++  P P N    L    T PG ++  + A DNDT  NA V Y++         ++F + +  G I + E   +    LH   ++A+D G
Sbjct:    1 MDLLSGTYIFAVLLACV-VFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP-------RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKD--TYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARR----LFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ-----FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPP-EFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGV--PPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE-NLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGN---TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          

HSP 2 Score: 155.606 bits (392), Expect = 6.095e-37
Identity = 149/576 (25.87%), Postives = 259/576 (44.97%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQ-----PSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVN-------VSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRK--LDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLL----NSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNI 2061
            +++++ D ND+ PVF+     + I E   +        A D DIG N    +            +F LN     I    +K  LD +  +  N+ L++ A DGG  +      + + V D NDN P  +   Y+VN       +SE   + ++I  +  TD+D+   G +  F     ++H    E+PF      S + +L     LD + T  + ++L A D+G+ PL   A++ I ++D ND+ P  +           +S+PENN     +  +  TD D G N +++ ++  D             DR    +      DRE E  +  +I  KD G PPL+++ T+ + I D N++ PV  +N     + E++        + V D D   N +  +        F+ID + G I+   + DREK + Y   +  ED  ++    ++S  +T++V+D NDNKP  +    N S  + +   N G    +FQV A+DND G NA V Y+I     R+      +F I+++ G +  +   D     ++++ +   D G  P +   +++VN+
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLIT---IKEPLDRE--ETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVP-SIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF-----TDH----EIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQS------FVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEF------SLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSR--SSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGT--VVFQVMAVDNDTGMNAEVRYSIVGGNTRD------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ-PDSLFSVVIVNL 770          

HSP 3 Score: 129.413 bits (324), Expect = 7.541e-29
Identity = 119/453 (26.27%), Postives = 198/453 (43.71%), Query Frame = 1
Query: 1048 MKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKI---YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKP-----YLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNA-VVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKS 2361
            ++ +IEDIND+ P   + P   I    +S+PEN+  N+   L    D D+G NG  +  + K +    L V    +   +  +I     DRE +  + + +  +D G P  S++  +++ ++D N++ PV      EV+I E+  +G     +   D D   N  I F     ++ I    F ++   G I IK  LDRE+   + + ++  D    G        + V+V D NDN P     Y++N      ++  N  +  KI  +   D D   N  V  +T + I +R   +    F        L     LD E    Y I LL  D G PP  +  ++ + + D+NDNAP++     Q+ + +++ +   PG  +  + A D D+  NA + Y L    PP     F L    G + V + L  +    ++  + A DNG  PL S
Sbjct:  125 IRFLIEDINDNAP---LFPATVI---NISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD----GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFL-------LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT----QSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPE----FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTS 552          
BLAST of protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 7.906e-75
Identity = 231/794 (29.09%), Postives = 383/794 (48.24%), Query Frame = 1
Query:   16 MNELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLT----FQIYEDEEKKNYFRIVEKTGEFYVAG-RIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKE--HWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLT-KITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNG 2343
            M+ L   YI+    + + + +  +Q+  Y+++EE P N LIG++ KD  LS   ++SLT    F++          RI E TGE +  G RIDRE +C+          + ++C   + V + P E    + +   IEDIND+ P+F      I I E  +IN +  L  A D D+G N +Q Y+L +  +IFGL+     E   +  L ++ +LD +  D   Y + ++  DGG P +     L + V D NDN P+F ++E  V++ E   VG+ + ++ ATD D G    I++     VSN  +      F ++  +G I +   LD + TP+  + + A D G  P   +A++ + + D+ND+ P I I+   +  +  + L EN   N  I LI VTD D   NG+V+C  + +    L  V +N      + +      D E+   + I +   D G+PPL+ S  + I + D N++ PV   +   V+I E+ S G +   V   D D+  N  I++L+        FS+DR+ G + +   LDREK D+Y+  I+ +DN       T++ ++ VS++D NDN P   ++     + E N      +  +   D D G N+ V  +I        + +   FTI+ + G +    S DREK + Y   +   D G   ++    + +N++D NDN P++  P P N    L    T PG ++  + A DNDT  NA V Y++         ++F + +  G I + E   +    LH   ++A+D G
Sbjct:    1 MDLLSGTYIFAVLLACV-VFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIP-------RDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKD--TYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARR----LFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ-----FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPP-EFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGV--PPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE-NLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGN---TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLG 757          

HSP 2 Score: 155.606 bits (392), Expect = 6.472e-37
Identity = 149/576 (25.87%), Postives = 259/576 (44.97%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQ-----PSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVN-------VSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRK--LDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLL----NSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNI 2061
            +++++ D ND+ PVF+     + I E   +        A D DIG N    +            +F LN     I    +K  LD +  +  N+ L++ A DGG  +      + + V D NDN P  +   Y+VN       +SE   + ++I  +  TD+D+   G +  F     ++H    E+PF      S + +L     LD + T  + ++L A D+G+ PL   A++ I ++D ND+ P  +           +S+PENN     +  +  TD D G N +++ ++  D             DR    +      DRE E  +  +I  KD G PPL+++ T+ + I D N++ PV  +N     + E++        + V D D   N +  +        F+ID + G I+   + DREK + Y   +  ED  ++    ++S  +T++V+D NDNKP  +    N S  + +   N G    +FQV A+DND G NA V Y+I     R+      +F I+++ G +  +   D     ++++ +   D G  P +   +++VN+
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLIT---IKEPLDRE--ETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVP-SIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF-----TDH----EIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQS------FVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEF------SLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSR--SSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGT--VVFQVMAVDNDTGMNAEVRYSIVGGNTRD------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQ-PDSLFSVVIVNL 770          

HSP 3 Score: 129.413 bits (324), Expect = 7.937e-29
Identity = 119/453 (26.27%), Postives = 198/453 (43.71%), Query Frame = 1
Query: 1048 MKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKI---YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKP-----YLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNA-VVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKS 2361
            ++ +IEDIND+ P   + P   I    +S+PEN+  N+   L    D D+G NG  +  + K +    L V    +   +  +I     DRE +  + + +  +D G P  S++  +++ ++D N++ PV      EV+I E+  +G     +   D D   N  I F     ++ I    F ++   G I IK  LDRE+   + + ++  D    G        + V+V D NDN P     Y++N      ++  N  +  KI  +   D D   N  V  +T + I +R   +    F        L     LD E    Y I LL  D G PP  +  ++ + + D+NDNAP++     Q+ + +++ +   PG  +  + A D D+  NA + Y L    PP     F L    G + V + L  +    ++  + A DNG  PL S
Sbjct:  125 IRFLIEDINDNAP---LFPATVI---NISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD----GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFL-------LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT----QSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPE----FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTS 552          
BLAST of protocadherin-9 vs. TrEMBL
Match: A0A3R7FMR5 (Protocadherin alpha-4 OS=Clonorchis sinensis OX=79923 GN=Pcdha4 PE=4 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 4.302e-121
Identity = 302/957 (31.56%), Postives = 467/957 (48.80%), Query Frame = 1
Query:   25 LLHFYIYLFSFSLIHLTN--QISQDLKYSVKEESPPNYLIGNIKKDS--RLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETIC----------------------SFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF--------EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL---EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPI-QCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIP-----------DCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREA--ESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIK--EVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNP-PQTKEEIILVNIIDKNDNAPIWK-----FPSPQ-----------NDIINLTKI--------TYP---GQIIATIHAYDNDTLENANVTYTL--TKVEPPLNS-----------------NIFKLHETQGTIQVTEFLTLK------MFVLHLQASDNGNTPLKSVPTTLTIRYWPMETG------------SLLSGHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRR-QNYTC 2535
            ++ +   +F  ++ H TN     ++L Y++ EE+     IGN+K D+  +     S+   F++Y+D  K+NYFRI   +G+ +VA RIDRETIC                        +E G SD   ++ C+L L++FV +E+WINV I I DIND+ P F        +PN  V+ + E V    E PL  A+D D G N +Q Y L   E    +F ++Y PPF LNL +  +LD +     NY+  + ACDGG P  +CG Q L I V D NDN P+F K  Y V V+E    GS +  V A+D DSG +GS+ Y + + VS     V +  F +  +SGR+   + +DAK T  F + + A D G  PL+GQ+V++I + D+NDH P I ++P   +P           +  + + EN      +GLIIV D DIG N  V C + + E +  L+ +N+   R +YS+ AN +FDRE+  +   ++ ITC D G P   T ++I I I DVNE  P    + +  ++ I E  + G   F  E  D DAT  I + +      + F ID   G++  +  LDRE   +    +   D   L +   ++ + +TV++ D NDN+P L+ + +V+ I+E   G  + + Q+ A+D D   N  V Y +  +   N I     F IN+++G+LF L SLDRE+   Y++ +L  D G P  +   + I+V ++D+NDN P W+      P  Q           + ++ L K+        T P   GQ +  + A D D+  NAN+T+ L  T   P +                   N F +  T G + +   L         +  ++L+ SDNGN PL+   + L IR     +             S L    ++   L + +  V CL  + L++A   +R+R Q  TC
Sbjct:   10 VISYGFIVFVHAIQHGTNIPSTPKELSYTINEEAEVGSFIGNLKLDAERKFLIPYSQLTHFELYDDS-KQNYFRIEPDSGKLFVAARIDRETICPQPELLSGRLAAQDHRMWAPTLGSEEYGQSD---SKKCELHLSLFVAQEYWINVIIAIHDINDNQPYFPIGLAQSTKPNIYVVNVSESVQSGHEIPLIGARDSDAGINAVQSYTLRGDELNPALFAVSYSPPFTLNLIVLDELDAE--RKANYTGEIVACDGGQPSPKCGVQPLLIHVTDINDNKPVFEKHVYEVVVNETVLTGSTVLTVHASDADSGSHGSVRYQIGQPVSQ----VVLDHFGLDASSGRLYTKKPIDAKDTALFVIPVLAKDGGSVPLIGQSVVRISVTDVNDHAPWIEVRPV-QLPGKQVTSGVKFSEGTMWIYENQPVGTNLGLIIVGDEDIGDNSLVECKLQESEYRFYLEHANSAKGREMYSLSANQSFDRESLPDGSTSVQITCSDKGDPTQKTEKSIAIQIIDVNEFSPEFPADRRNYDIQIEEGQNPGTFVFQAEANDLDATPMIHYYLSREAQSL-FHIDPHSGRVTTRKVLDRESTPKIRFTVHATDKNLLESDLNSTVANVTVTLTDINDNEPTLVEN-EVLKIVENRPGFSDLVGQLIAIDKDADLNGTVRYKLLSVLTENNIAVNDTFMINQESGKLFTLRSLDREQCSQYRLHVLAYDLGTPESKNTTQTIIVEVLDENDNKPEWRPMLPLLPDGQYSAQSAYSKYASRLLGLDKVFELGQLNTTAPLHRGQRVCKLAATDADSSRNANLTFHLVTTYFTPEMEGDDTQHLMHHSGKATTMPNYFMVSSTSGELMIGPGLRGAGLSEPGLAEIYLRVSDNGNPPLEKT-SRLFIRISDTSSSLSGMGMSGKGLLSYLISSGNIGIALTIVLIFVMCLTSICLIVAFSALRQRSQAPTC 952          
BLAST of protocadherin-9 vs. TrEMBL
Match: A0A183A885 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3170 PE=4 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 8.913e-121
Identity = 297/969 (30.65%), Postives = 464/969 (47.88%), Query Frame = 1
Query:   76 NQISQDLKYSVKEESPPNYLIGNIKKDS--RLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETIC--------------------SFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFE--------PNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL---EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDP-IQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIP-----------DCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREA--ESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVIN--NNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQ-TKEEIILVNIIDKNDNAPIW-----------KFPSPQN----------------DIINLTKITYPGQIIATIHAYDNDTLENANVTYTL-----------------------TKVEPPLNSNIFKLHETQGTIQVTEFLT------LKMFVLHLQASDNGNTPLKSVP------TTLTIRYWPME--TGSLLS-----GHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRRQ-NYTCSHSQSPSNIMFAI------NTDQNRSQF 2601
            N   ++L Y++ EES     +GN+K D+  +     ++   F++Y+D  ++ YFR+ + TG+ +VA RIDRETIC                    S     DSD  +   C++ L + + +++W+NV +TI DINDH P F         P + V  + E V+  +E PL  AKD D G N++Q Y L   E    +F + Y+PPF LNL +  +LD +      Y+  L ACDGG P  QCG Q   I VND NDN P+F KS Y V V E   V S + R+ ATD DSG  G I Y   + +S   ++V   FF +    G +   R L+A+  P F + + A D G  PL+GQ V++I + D+NDH P I I+    +            +  L +PEN      IGL+I  D D+G+N  V C +  ++++  L+ +N+   R +Y +  N +FDRE+    +  + + C D G+P  ST + I + I D NE  P  +    I+ V + E   +G     V+  D DAT  I + +      + F ID   G I  +  LDRE++ +    +   D+ Q   Q   + + +TV ++D NDN P L   ++  +I+E   G  + + Q+ ++D D+G+N  V Y +  +      +  + F +N  +G+LF L SLDRE+Y  Y++++LL D+G P +    E I V ++D+NDNAP+W             P+P+                  ++N T   Y GQ IA + A D D   NAN++Y L                       +K  P + ++ FKL    G + +   L         +  L+ +  DNGN PL S        T  +     ++  +G  LS     GH  ++  LIV + V+ CL  + L++A   +RR+     C  +  PS+   A+       + Q+ SQF
Sbjct:   30 NGFQKELTYAINEESEVGSFVGNLKLDAERKFLIPYNQLTRFELYDDT-RQGYFRVEQDTGKLFVAARIDRETICPQPDALIPETMPTYPDDLWASVPTQQDSDQSEGSVCQVHLALHIAQQYWVNVIVTIHDINDHKPYFPLGPSGLGLPVYTV-NVSESVTAGYEIPLVGAKDADAGINSVQSYSLRGAELDPALFAIAYKPPFTLNLVVLQELDAETK--STYTGELIACDGGQPQPQCGVQPFQIIVNDLNDNKPVFAKSLYEVEVEETLPVNSTVIRLNATDADSGPRGEIRYVFGQPIS---QAVLHHFF-LDSVIGELTTRRPLNARENPRFLIPVLAKDGGIVPLIGQTVVQITVRDVNDHDPWIEIRAVQSVGQQGAGDRQVEQNITLFVPENQPIGTNIGLLIAGDEDVGENSAVVCQLKSNQDRFYLEHANSAKGREMYRLGTNLSFDRESLPNGIVYVDVLCVDGGKPKRSTERKIPVQILDENEFAPAFDPSKKIQNVYLEEGKDVGTFVTQVQATDADATPKIQYHLSREAQNL-FHIDADTGIIVTRVVLDREQMPKIRFSVFATDHDQSDRQAAPAVANVTVHLVDINDNAPEL-TGNRAFHIVENRPGFSDLVGQLTSVDKDVGNNGTVRYRLVSVSGNGNPLVNETFMLNPDSGKLFTLHSLDREEYSQYELTVLLEDQGTPYKLNSTESITVEVLDENDNAPVWGDPLRIMTTVEHLPTPEALRKSSRMLGLSKLKDLGLLNATTPFYHGQKIAKLTATDPDAPHNANLSYHLLATYFIPFNEEFNVIGEHTQLVSSKPAPNVPTH-FKLASATGDLFIGPGLGGVGSAKGGLAELYFRVCDNGNPPLDSSARLFIQLTAYSSNSAALDSTSGGFLSYLISTGHLGIA--LIVVLFVIMCLTSICLVVAFTTIRRKSPGNACECACCPSSRRKALRPCMDNGSVQHNSQF 985          
BLAST of protocadherin-9 vs. TrEMBL
Match: G7YNN2 (Protocadherin alpha-4 OS=Clonorchis sinensis OX=79923 GN=CLF_103848 PE=4 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 1.915e-119
Identity = 302/957 (31.56%), Postives = 466/957 (48.69%), Query Frame = 1
Query:   25 LLHFYIYLFSFSLIHLTN--QISQDLKYSVKEESPPNYLIGNIKKDS--RLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETIC----------------------SFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF--------EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL---EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPI-QCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIP-----------DCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREA--ESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIK--EVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNP-PQTKEEIILVNIIDKNDNAPIWK-----FPSPQ-----------NDIINLTKI--------TYP---GQIIATIHAYDNDTLENANVTYTL--TKVEPPLNS-----------------NIFKLHETQGTIQVTEFLTLK------MFVLHLQASDNGNTPLKSVPTTLTIRYWPMETG------------SLLSGHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRR-QNYTC 2535
            ++ +   +F  ++ H TN     ++L Y++ EE+     IGN+K D+  +     S+   F++Y+D  K+NYFRI   +G+ +VA RIDRETIC                        +E G SD   ++ C+L L++FV +E+WINV I I DIND+ P F        +PN  V+ + E V    E PL  A+D D G N +Q Y L   E    +F ++Y PPF LNL +  +LD +     NY+  + ACDGG P  +CG Q L I V D NDN P+F K  Y V V+E    GS +  V A+D DSG +GS+ Y + + VS     V +  F +  +SGR+   + +DAK T  F + + A D G  PL+GQ+V++I + D+NDH P I ++P   +P           +  + + EN      +GLIIV D DIG N  V C + + E +  L+ +N+   R +YS+ AN +FDRE+  +   ++ ITC D G P   T ++I I I DVNE  P    + +   + I E  + G   F  E  D DAT  I + +      + F ID   G++  +  LDRE   +    +   D   L +   ++ + +TV++ D NDN+P L+ + +V+ I+E   G  + + Q+ A+D D   N  V Y +  +   N I     F IN+++G+LF L SLDRE+   Y++ +L  D G P  +   + I+V ++D+NDN P W+      P  Q           + ++ L K+        T P   GQ +  + A D D+  NAN+T+ L  T   P +                   N F +  T G + +   L         +  ++L+ SDNGN PL+   + L IR     +             S L    ++   L + +  V CL  + L++A   +R+R Q  TC
Sbjct:   10 VISYGFIVFVHAIQHGTNIPSTPKELSYTINEEAEVGSFIGNLKLDAERKFLIPYSQLTHFELYDDS-KQNYFRIEPDSGKLFVAARIDRETICPQPELLSGRLAAQDHRMWAPTLGSEEYGQSD---SKKCELHLSLFVAQEYWINVIIAIHDINDNQPYFPIGLAQSTKPNIYVVNVSESVQSGHEIPLIGARDSDAGINAVQSYTLRGDELNPALFAVSYSPPFTLNLIVLDELDAE--RKANYTGEIVACDGGQPSPKCGVQPLLIHVTDINDNKPVFEKHVYEVVVNETVLTGSTVLTVHASDADSGSHGSVRYQIGQPVSQ----VVLDHFGLDASSGRLYTKKPIDAKDTALFVIPVLAKDGGSVPLIGQSVVRISVTDVNDHAPWIEVRPV-QLPGKQVTSGVKFSEGTMWIYENQPVGTNLGLIIVGDEDIGDNSLVECKLQESEYRFYLEHANSAKGREMYSLSANQSFDRESLPDGSTSVQITCSDKGDPTQKTEKSIAIQIIDVNEFSPEFPADRRNYHIQIEEGQNPGTFVFQAEANDLDATPMIHYYLSREAQSL-FHIDPHSGRVTTRKVLDRESTPKIRFTVHATDKNLLESDLNSTVANVTVTLTDINDNEPTLVEN-EVLKIVENRPGFSDLVGQLIAIDKDADLNGTVRYKLLSVLTENNIAVNDTFMINQESGKLFTLRSLDREQCSQYRLHVLAYDLGTPESKNTTQTIIVEVLDENDNKPEWRPMLPLLPDGQYSAQSAYSKYASRLLGLDKVFELGQLNTTAPLHRGQRVCKLAATDADSSRNANLTFHLVTTYFTPEMEGDDTQHLMHHSGKATTMPNYFMVSSTSGELMIGPGLRGAGLSEPGLAEIYLRVSDNGNPPLEKT-SRLFIRISDTSSSLSGMGMSGKGLLSYLISSGNIGIALTIVLIFVMCLTSICLIVAFSALRQRSQAPTC 952          
BLAST of protocadherin-9 vs. TrEMBL
Match: A0A2H1C537 (Cadherin domain protein OS=Fasciola hepatica OX=6192 GN=D915_10443 PE=4 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 1.960e-119
Identity = 296/968 (30.58%), Postives = 455/968 (47.00%), Query Frame = 1
Query:   88 QDLKYSVKEESPPNYLIGNIKKDS--RLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETIC--------------------SFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF-------EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL---EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQ-CGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKP-----------KPDIPDCMLSL--PENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREA--ESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNI--SEDVSIGQEFFTVEVEDKDATRNIS-FLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQ-TKEEIILVNIIDKNDNAPIWKFP---------------SPQND------------IINLTKITYPGQIIATIHAYDNDTLENANVTYTL-----------------------TKVEPPLNSNIFKLHETQGTIQVTEFLTLK------MFVLHLQASDNGNTPLKSVPTTLT--IRYWPMET------GSLLS-----GHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRRQN------YTCSHSQSPSNIMFAINTD--QNRSQF 2601
            ++L Y++ EES     +GN+K D+  +     ++   F +Y+D  ++ YFR+ ++TG+ +VA RIDRE IC                    +     + D   A  C++ L + + ++ W+NV ITI DINDH P F       EP+   + I E V+  +E PL  AKD D G N++Q Y L   E    +F + Y+PPF LNL +  +LD +      Y   L ACDGG P   CG Q   + VND NDN P+F KS Y V V E   + S + R+ ATD DSG  G + Y   + +S          F++   +G +I  R ++A+  P F + + A D G  PL+GQ V++I + D+NDH P I I+            + ++ D   SL   EN      IGL+I  D D+G N  V C +  ++    L+ +N+   R +Y +  N +FDREA  + +  + + C D G P  ST + I I + D NE  P  + + K  N+   E   +G     V   D+DAT  I  +L +E  N   F ID + G I  +  LDRE++ +    +   D  Q   + + + + +TV + D NDN P L   ++  +I+E   G  + + Q+ ++D D+G+N  V Y++  +      I    F +N  +G+LF L SLDRE+Y  Y++ +LL D+G P        I V+++D+NDNAP+W  P                 QN             ++N T   Y GQ +  + A D D   NAN+TY L                       ++V P + +  FKL  T G + +   L         +  L+L+  DNGN PL S          Y P         G  LS     GH  ++  LIV + V+ CL  + L++A   +RR+ +      + C  +Q  + +  +I+ D  Q  SQF
Sbjct:   34 KELTYAINEESEVGSFVGNLKLDAERKFLIPYNQLTRFDLYDDT-RQGYFRVEQETGKLFVAARIDREAICPQPDALIPDKLTTYTEDLWSTLPGQRNGDQSGANVCQVHLALHIAQQFWVNVIITIHDINDHKPYFPIGSADAEPSLYTVNISESVTAGYEVPLIGAKDADAGMNSVQTYSLRGAELDPSLFAIAYKPPFTLNLVILRELDAETK--STYHGELVACDGGQPQPLCGAQPFQVFVNDLNDNKPVFTKSLYEVEVEETLPINSTVIRLNATDADSGPRGHVQYLFGQPISQAVHH----HFRLDPVTGELITQRGMNARENPRFIIPVVAKDGGLVPLIGQTVVQITVRDVNDHDPWIEIRAVQSVRQQGPQSRSNLTDKNTSLFVSENQPIGTNIGLLIAGDEDVGDNSAVVCHLKSNQAHFYLEHANSAKGREMYRLGTNLSFDREALLDGVVYVDVLCLDGGNPKRSTERKIAIQVLDENEFTPSFDTSQKTQNVYLEEGKPVGTFVIQVRATDEDATPKIEHYLSREAQN--LFHIDAESGAITTRVILDREQMPKIRFNVYATDQDQSDRRASPAVANITVHLADINDNAPEL-TGNRAFHIVENRPGFSDLVGQLTSIDKDVGNNGTVRYSLVSVSGNGNPIANDTFMLNPDSGKLFTLRSLDREQYSQYELVVLLEDRGTPQALNSTATITVDVLDENDNAPVWSDPLRIMSALKYVSIPEALRQNSRMLGLVNFKDLGLLNATTPFYHGQKVTRLTATDPDAPHNANLTYHLLATYFIPFNEEFDLGKESAHSFASRVAPNVPT-YFKLSATTGDLFIGPGLGGAGSAKSGLAELYLRVCDNGNPPLDSSARLFVQLTSYNPTSVILDPNNGGFLSYLISTGHLGIA--LIVVLFVIMCLTSICLVVAFTTIRRKSSGGTCDCFCCPSAQRKA-LRLSIDNDSVQQNSQF 987          
BLAST of protocadherin-9 vs. TrEMBL
Match: A0A504YKU6 (Protocadherin-1 OS=Fasciola gigantica OX=46835 GN=FGIG_00296 PE=4 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 2.304e-119
Identity = 295/971 (30.38%), Postives = 456/971 (46.96%), Query Frame = 1
Query:   88 QDLKYSVKEESPPNYLIGNIKKDS--RLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETIC--------------------SFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF-------EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL---EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQ-CGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKP-----------KPDIPDCMLSL--PENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREA--ESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNI--SEDVSIGQEFFTVEVEDKDATRNIS-FLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQ-TKEEIILVNIIDKNDNAPIWKFP-----------SPQN----------------DIINLTKITYPGQIIATIHAYDNDTLENANVTYTL-----------------------TKVEPPLNSNIFKLHETQGTIQVTEFLTLK------MFVLHLQASDNGNTPLKSV-----------PTTLTIRYWPMETGSLLS-----GHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRR-QNYTCSHSQSPSNIMFAINTDQNRSQFITLRNDP 2622
            ++L Y++ EES     +GN+K D+  +     ++   F +Y+D  ++ YFR+ ++TG+ +VA RIDRE IC                    +     + D   A  C++ L + + ++ W+NV ITI DINDH P F       EP+   + I E V+  +E PL  AKD D G N++Q Y L   E    +F + Y+PPF LNL +  +LD +      Y   L ACDGG P   CG Q   + VND NDN P+F KS Y V V E   + S + R+ ATD DSG  G + Y   + +S          F++   +G +   R ++A+  P F + + A D G  PLMGQ V++I + D+NDH P I I+            + +I D   SL   EN      IG++I  D D+G N  V C +  ++    L+ +N+   R +Y +  N +FDREA  + +  + + C D G P  ST + I I + D NE  P  + + K  N+   E   +G     V   D+DAT  I  +L +E  N   F ID + G I  +  LDRE++ +    +   D      + + + + +TV + D NDN P L   ++  +I+E   G  + + Q+ ++D D+G+N  V Y +  +      I    F +N  +G+LF L SLDRE+Y  Y++ +LL D+G P        I V+++D+NDNAP+W  P            P+                  ++N T   Y GQ +A + A D D   NAN+TY L                       ++V P + +  FKL ET G + +   L         +  L+L+  DNGN PL+S            PT++ +       G  LS     GH  ++  LIV + V+ CL  + L++A   +RR+    TC          F   + Q ++  +++ NDP
Sbjct:   34 KELTYAINEESEVGSFVGNLKLDAERKFLIPYNQLTRFDLYDDT-RQGYFRVEQETGKLFVAARIDREAICPQPDDLIPDKLTTYTEDIWSTLPGQRNGDQSGANVCQVHLALHIAQQFWVNVIITIHDINDHKPYFPIGSADAEPSLYTVNISESVTAGYEIPLIGAKDADAGMNSVQTYSLRGAELDPSLFAIAYKPPFTLNLVILQELDAETK--STYHGELVACDGGQPQPLCGAQPFQVFVNDLNDNKPVFTKSLYEVEVEETLPINSTVIRLNATDADSGPRGEVQYLFGQPISQAVHH----HFRLDPVTGELATRRGMNARENPRFIIPVVAKDGGLVPLMGQTVVQITVRDVNDHDPWIEIRAVQSVRQQGPQSRSNITDKNTSLFVSENQPIGTNIGVLIAGDEDVGDNSAVVCHLKSNQAHFYLEHANSAKGREMYRLGTNFSFDREALPDGVVYVDVLCLDGGNPKRSTERKIAIQVLDENEFTPSFDTSKKTQNVYLEEGKPVGTFVIQVRATDEDATPKIEHYLSREAQN--LFQIDAESGAITTRVILDREQMPKIRFNVYATDQDHSDRRASPAVANITVHLADINDNAPEL-TGNRAFHIVENRPGFSDLVGQLTSIDKDVGNNGTVRYGLVSVSGNGNPIANDTFMLNPDSGKLFTLRSLDREQYSQYELVVLLEDRGTPHALNSTATITVDVLDENDNAPVWSDPLRIMSALKYVSVPEALRRNSRMLGLVNFKDLGLLNATTPFYHGQKVARLTATDPDAPHNANLTYHLLATYFIPFNEEYDLGKESAHSFVSRVAPNVPT-YFKLSETTGDLFIGPGLGGAGSAKSGLAELYLRVCDNGNPPLESSARLFVQLTSHNPTSVILD---SNNGGFLSYLISTGHLGIA--LIVVLFVIMCLTSICLVVAFTTIRRKSSGGTCD--------CFCCPSAQRKALRLSIDNDP 980          
BLAST of protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 290.812 bits (743), Expect = 3.261e-82
Identity = 222/781 (28.43%), Postives = 361/781 (46.22%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH 2322
            +L  FY+     + + L   I+Q+L Y ++EE   N LIGNI KD  +S  N     S +L +++          R++  TGE F  + RIDRE +C      DS+      C   + V + P +++  I ++I ++D ND+ P+F      I I E   IN    +  A D D+GPN++ +Y+L      FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V D NDN P+F +S+  V++ E + VG+ + ++ ATD D G    I Y     VS   +      F ++  +G I + R LD + T +  + + A D   S    +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I KD    L  V +N      Y +  +   D E    +   I   D G+P L+ +  + + + D N++PP+    + E+ +SE+        T+   D+D+ RN   + Q   N  +F +DRK G +      DRE  +R++  +   DN     Q  +  ++ V+++D NDN P   ++     + E N      +  +   D D G NAVV  +I        +   + F ++   G + +  S DRE+   Y   +   D G+PP +    + +N+ID NDN PI  +P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E  T     LH
Sbjct:    2 DLKDFYLLATLVACLWLDPAIAQELIYPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSE------CSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRR----LFALNSTTGLITVQRPLDREETANHKLSVLASDGSSS--SARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQ-----YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQ--SQAAVIVTILDQNDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENAVVSLSI--------LNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYP-PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGN---NKGLFRIDPVTGNITLEEKPTEADSGLH 748          
BLAST of protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 289.656 bits (740), Expect = 4.940e-82
Identity = 222/781 (28.43%), Postives = 361/781 (46.22%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITY-PGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH 2322
            +L  FY+     + + L   I+Q+L Y ++EE   N LIGNI KD  +S  N     S +L +++          R++  TGE F  + RIDRE +C      DS+      C   + V + P +++  I ++I ++D ND+ P+F      I I E   IN    +  A D D+GPN++ +Y+L      FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V D NDN P+F +S+  V++ E + VG+ + ++ ATD D G    I Y     VS   +      F ++  +G I + R LD + T +  + + A D   S    +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I KD    L  V +N      Y +  +   D E    +   I   D G+P L+ +  + + + D N++PP+    + E+ +SE+        T+   D+D+ RN   + Q   N  +F +DRK G +      DRE  +R++  +   DN     Q  +  ++ V+++D NDN P   ++     + E N      +  +   D D G NAVV  +I        +   + F ++   G + +  S DRE+   Y   +   D G+PP +    + +N+ID NDN PI  +P P N    L  ++  PG ++A + A D DT  NA + YT+       N  +F++    G I + E  T     LH
Sbjct:    2 DLKDFYLLATLVACLWLDPAIAQELIYPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSE------CSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRR----LFALNSTTGLITVQRPLDREETANHKLSVLASDGSSS--SARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQ-----YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQ--SQAAVIVTILDQNDNSPKFTHNHFQFFVSE-NLPKYSTVGVITVTDADAGENAVVSLSI--------LNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYP-PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGN---NKGLFRIDPVTGNITLEEKPTEADSGLH 748          
BLAST of protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 266.159 bits (679), Expect = 5.122e-74
Identity = 219/792 (27.65%), Postives = 359/792 (45.33%), Query Frame = 1
Query:   37 YIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAG-RIDRETICSFKEVGDSDPLKAQNCKLSLTVFVP------KEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE---QPSDIFGL---NYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVP-FFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKP--DIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNG-DDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNG 2343
            +  LF+  L+   N     + Y V+EE PPN LIG++  D  L +         +Y+ E    Y R+  KTGE +     IDRET+   +       +K + C L   V V           I   I ++DIND+ P F      + + E   +     +  A D D   N + +Y L    + S +F L   N     +  L +   LD ++ D  +Y L + A DGG P +     L + + D NDN P F KS Y   VSE + VG  + +V A D D G  G I Y +      H+ S  VP   +I +++G I +   LD +   SF   + A D G SP      + I + D ND+ P + I+        D + ++ E+      + L+ V+D D G+N  V+CV+  D    L    ++  D++  Y +      D E    + + I   D G P LS++ ++ + ++D N++ P+ +  + EV  +E+   G++   V   D D+  N      +I ++  +  F ID   G+++ +S LDRE  +RY   +   D K + +   T+ ++ + V+D NDN P  + SS   +++E N      +  V  LD D G NA V+ ++              F +    G + +  S DREK   Y   L   D G PP++    + +N++D+NDNAP+   PS  +    L+ +  P  ++  + A D D   NA + Y++    P     +F +  + G I++T+ LT K   LH   ++ SD G
Sbjct:    7 WFLLFAL-LVDSINSALGGILYHVREEQPPNTLIGSLAADQGLPDSG------HLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCR-------IKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKD--SYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTI------HQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAAD-KGVPSHRGTA-TVVIKVLDRNDNDPKFMLSSYSFSVLE-NMPPLSPVGMVTVLDMDKGENAQVQLSVE--------PDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPS-NSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNP---HELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRG 761          

HSP 2 Score: 108.227 bits (269), Expect = 1.970e-23
Identity = 135/584 (23.12%), Postives = 235/584 (40.24%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNL-------YLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPP--------IFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRK---------LDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGK-VSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVF-ALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNI 2061
            + + I D ND+ P FE +    E+ E   + +      A D D+GPN   EY + Q SD        P +L +        +K  LD +      + +I R  D G   +     +SI V D NDN P        +   S+ + N+SE   VG+ +  V  +D+D G    +   +         + +VPF ++       + N+K         LD +    + + + A DSG   L     +++ + D ND++P  S       P   +   E N     +  +I  D D G N + V  +I     + L ++     D     + A    DRE +  +   +T  D G P    + T+ I + D N++ P    +    ++ E++        V V D D   N    +    +   F +    G I    + DREK   Y   +   D  +     ++   +T++V+D NDN P +   S             + + +V  A D D GSNA + Y+I            ++F I+  +GE+     L R+   ++++ + ++D+G P  ++  I LV+I
Sbjct:  229 LRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPV------PKMLQIERSTGIISVKGPLDREEISSFKFHVIAR--DKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVV---------AGDVPF-QLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSP------PLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEI-----DPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGE--PPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGN------PHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKP--SRHAIALVHI 773          
BLAST of protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000035285.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:8923404:8955697:1 gene:ENSAMXG00000041384.1 transcript:ENSAMXT00000035285.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 263.848 bits (673), Expect = 6.815e-74
Identity = 196/681 (28.78%), Postives = 334/681 (49.05%), Query Frame = 1
Query:   94 LKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV--PKE-HWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIF------GLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLI-----QETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGT-QFTTSFSLTVSVMDANDNKPYLL------NSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIID 2067
            ++YSV EE     ++GNI KD  + ++  +   F+I      +  FR+    G  +V G+IDRE +C           ++ +C ++L + +  P E H++ VEI   DINDH P+F    K +EI E         L  A+D D G N++Q YKL Q           G + + PF++   L+  LD +      + L+L A DGG P + G  ++ + V D NDN P+F K  Y   +SE   +G+++ +V ATD D+G  G + Y   + V+ + + V    F +   +G I++   +D +    + + ++A D   +PL    ++ I I D+ND+ P+I      ++    +++PEN+     + LI V+D D G NGKVSC + +D    LL+ S       IYS++   + DRE  S + I+   KD G PPLS+ +T+ + +SDVN++ P  + N     + E+   G   F+V   D D   N  IS+ I     QE  +  + +I+ + G I    + D E    Y   IV  D+   GT   +++ ++ V ++D NDN P +L       S++ +  I  N      + +V A D DIG N  + +++       E+    +F ++R  G++  L S       ++K+ +L+ D GN   +    +++ I++
Sbjct:   30 IRYSVLEEQRNGTVVGNIAKDLGIDQRTLKERGFRIVS-TTGETLFRVNRNDGVLHVNGKIDREEVCE----------RSSSCLINLKIALENPLEIHYVTVEIV--DINDHPPIFSEKEKRLEISENAIAGVRFQLQGARDADSGVNSVQMYKLSQNEHFRIEVRDRGEDGKMPFLI---LQKSLDRET--CARHKLLLTALDGGRPQKSGTMEIIVDVIDINDNAPVFTKDTYSAKLSENAPIGTKVIQVNATDLDNGPNGEVFYIFGQDVNRNLRRV----FDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKALAPLTTDKIILIQIVDVNDNAPEI------EVTSLSIAVPENSHSGTTVALISVSDVDSGMNGKVSCSVPEDIPFSLLQSSQEN----IYSLVTKSSLDREKTSQYDITFIAKDAGHPPLSSIKTLTVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSVSAHDLDLDENAIISYHIWRDPAQENKHSSFLNINPETGAIYALKSFDFESTKSYQFYIVASDS---GTPSLSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSL------QEVSDHSLFGLDRYTGQIRTLRSFTETDEALHKLVILVKDNGNVSLSATATVIIKIVE 669          

HSP 2 Score: 162.54 bits (410), Expect = 1.869e-40
Identity = 189/710 (26.62%), Postives = 307/710 (43.24%), Query Frame = 1
Query:  499 LAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYD-VPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIE--DINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIV----TDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN----------ISF-LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEK---VFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQN----DIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNGNTPLKSVPTTLTIRYWPMET-------GSLLSGHDSVSFNLIVTMAVVTCLICLSLLIAIVV 2508
            +AKDL I    ++E        I     E  F +N     L++  K+D + V +  +  LI       +P++  +  +++ + D ND+PPIF + E  + +SE    G       A D DSG+  S+   MY+   N    +EV           +IL + LD +      + L A D G     G   M+II++  DIND+ P  +     D     LS      +NA IG  ++    TD D G NG+V  +  +D  + L +V +   D +   I+     D E +  + I I   D    PL+T + I I I DVN++ P I      + + E+   G     + V D D+  N          I F L+Q +   IY         +  KS+LDREK  +Y I  + +D        ++  +LTV V D NDN P    +     + E N      +F V A D D+  NA++ Y I    +R+   + K      IN + G ++AL S D E    Y+  ++ +D G P  +    + V I+D+NDN P+  +P   N     +  + +    G ++  + AYD D   N  + ++L +V    + ++F L    G I+     T     LH   +   DNGN  L +  T +     P E         S+    + V+F LI+T+  V+ L  +S+++ I++
Sbjct:   47 IAKDLGIDQRTLKERGFR----IVSTTGETLFRVNRNDGVLHVNGKIDREEVCERSSSCLINLKIALENPLEIHY--VTVEIVDINDHPPIFSEKEKRLEISENAIAGVRFQLQGARDADSGV-NSVQ--MYKLSQNEHFRIEVRDRGEDGKMPFLILQKSLDRETCARHKLLLTALDGGRPQKSG--TMEIIVDVIDINDNAPVFT----KDTYSAKLS------ENAPIGTKVIQVNATDLDNGPNGEVFYIFGQDVNRNLRRVFDL--DPVTGEIVVKGPIDFEQKYQYEIDIQASDKALAPLTTDKIILIQIVDVNDNAPEIEVTSLSIAVPENSHSGTTVALISVSDVDSGMNGKVSCSVPEDIPFSLLQSSQENIY--------SLVTKSSLDREKTSQYDITFIAKDAGH--PPLSSIKTLTVFVSDVNDNSPEFSLNPYTFYVPENNVP-GMSMFSVSAHDLDLDENAIISYHI----WRDPAQENKHSSFLNINPETGAIYALKSFDFESTKSYQFYIVASDSGTPSLSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVS---DHSLFGLDRYTGQIRTLRSFTETDEALHKLVILVKDNGNVSLSATATVIIKIVEPKEAFAASDVKSSVQDEDNDVTFYLIITLGSVSVLFVISMIVLIMM 715          
BLAST of protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1gc5 (protocadherin 1 gamma c 5 [Source:ZFIN;Acc:ZDB-GENE-041118-16])

HSP 1 Score: 261.536 bits (667), Expect = 1.716e-73
Identity = 210/712 (29.49%), Postives = 331/712 (46.49%), Query Frame = 1
Query:   46 LFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWIN-VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYE--------PPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKI----YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEK-----IFQVFALDNDIGSNAVVEYTINYIKYR-NEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQND 2115
            L  F L  L N +   + Y++ EE     ++GNI KD             +I   E  + YF +  + GE  V GRIDRET+C           +A NC + L + + +   ++ VEI I+DIND+ P F     V++I E  ++    P+  A+D D G N+++ Y L   ++ F LN +        P  IL+  L      D      + LIL A DGGDP++ G   L I V D NDN P F    Y  +V E   +GS +  + ATD D G+ G I Y+      ++ + V    F ++ +SG I +  KLD +   S+   + A D G   L G + + I + D ND+ P+I +   P+       +PEN      + LI V D D G+NGKVS  I K       K+ ++ ++   YS+I + + DRE  S + I I   D G PPL T +TI + I DVN++ P  +     V I E+   G   F++   D D   N      ++   +N I    YF I+ + G I   S+ D EK+ R  + +  +D+       +++ +L V ++D NDN P ++  S V+  +      +       + +V A+D D G NA       +I YR  E     +F++N   GE+    SL  ++    ++ + + D G P Q+    + V +I+   + PI  +P    D
Sbjct:   16 LLGFVL--LWNTVGAQIHYTIAEEVKEGSIVGNIAKDLGFDVSRVAKSKLRI-ASESSRQYFDVDTEKGELIVNGRIDRETLCG----------QAVNCLVPLQIIIEEPLQLHRVEIEIQDINDNAPNFHTKESVLKIAESAALGSRFPIESAEDPDSGKNSLKSYSLNS-NEHFRLNVKALDGGRKVPELILDKPL------DREKQLIHKLILTALDGGDPVRSGSTLLKIVVEDNNDNEPHFELQIYKASVQESAGIGSNVVTIKATDMDEGINGEIQYYFAAHTPDYVRKV----FNVNPDSGEITVIGKLDHEGINSYTFDICAQDKGYPKLEGHSSVHIRVIDENDNPPEIILTSLPN------PVPENATVGTVVALINVMDLDSGENGKVSLKIPK---GFPFKLKSSFENH--YSLITDSSLDRELNSEYNIEIVATDSGSPPLKTVKTINVTILDVNDNAPAFSQTSYNVYIKENNVAGSSLFSITALDSDVNNNAILTYSVVDSKVNDIPASSYFYINSENGTIYSMSSFDYEKVKRLTLIVQAKDHGS--PSLSSNATLHVFILDQNDNAPSVIYPSAVMGSVSHQRMPRSAKPGHLVTKVTAVDADSGHNA-------WISYRLAEATDASLFSVNLHTGEVRTKRSLSEQEDSSQRLLIEIQDNGEPVQSTTVTVDV-LIEDGFHEPISDYPKKSTD 682          

HSP 2 Score: 116.316 bits (290), Expect = 5.167e-26
Identity = 144/567 (25.40%), Postives = 242/567 (42.68%), Query Frame = 1
Query:  799 VGSEIFRVIATD-RDSGLYGSINYFMYESVSNHKKS-------VEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAV-----MKIIIE-------------DINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEE-KILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN------ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNG-----ELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTL--TKVEPPLNSNIFKLHETQGTIQVT---EFLTLKMFVLHLQASDNGNTPLKSVPT 2370
            VG++I   IA + ++  + G+I   +   VS   KS           +F +    G +I+N ++D +                  L GQAV     ++IIIE             DIND+ P    K      + +L + E+    +   +    D D G+N   S  +N +E  ++ +K  + G  R +  +I +   DRE + +  + +T  D G P  S S  ++I + D N++ P     I + ++ E   IG    T++  D D   N       +    + + K+ F+++   G+I +   LD E I+ Y   I  +D      +     S+ + V+D NDN P ++ +S + N +  N  V   +  +  +D D G N  V   I            K F    K+       L   +SLDRE    Y I ++ TD G+PP    + I V I+D NDNAP +   S     + + +    G  + +I A D+D   NA +TY++  +KV     S+ F ++   GTI      ++  +K   L +QA D+G+  L S  T
Sbjct:   26 VGAQIHYTIAEEVKEGSIVGNIAKDLGFDVSRVAKSKLRIASESSRQYFDVDTEKGELIVNGRIDRET-----------------LCGQAVNCLVPLQIIIEEPLQLHRVEIEIQDINDNAPNFHTK------ESVLKIAESAALGSRFPIESAEDPDSGKNSLKSYSLNSNEHFRLNVKALDGG--RKVPELILDKPLDREKQLIHKLILTALDGGDPVRSGSTLLKIVVEDNNDNEPHFELQIYKASVQESAGIGSNVVTIKATDMDEGINGEIQYYFAAHTPDYVRKV-FNVNPDSGEITVIGKLDHEGINSYTFDICAQDKGY--PKLEGHSSVHIRVIDENDNPPEIILTS-LPNPVPENATVGTVVALINVMDLDSGENGKVSLKI-----------PKGFPFKLKSSFENHYSLITDSSLDRELNSEYNIEIVATDSGSPPLKTVKTINVTILDVNDNAPAFSQTSYN---VYIKENNVAGSSLFSITALDSDVNNNAILTYSVVDSKVNDIPASSYFYINSENGTIYSMSSFDYEKVKRLTLIVQAKDHGSPSLSSNAT 549          
BLAST of protocadherin-9 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 248.44 bits (633), Expect = 8.208e-69
Identity = 220/783 (28.10%), Postives = 363/783 (46.36%), Query Frame = 1
Query:   94 LKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIY---EDEEKKNYFRIVEKTGEFYVAGR-IDRETICSFKEVGDSDPLKAQNCKLSLTVFV------PKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNL----------YLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVP-FFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN---ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQ------VFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLH---LQASDNG 2343
            + Y V EE      IGN   D RL++ N E LT+++     ++      R+  +TGE + AGR +DRE +C  ++ GD        C + + V V      P    I V I +EDIND+ P F      + + E        P+  A D D   N ++ Y+L  PSD   ++    F L++          YL  +   D  + + Y + LRA DGG P   G   L I V D NDN P+F ++E  V + E + VG+ + ++ A+DRD+G    + Y +  S             F++ +NSG + +N  L+ + +P + + + A D G  P+   A + + + D+ND++P I I+      + ++ + E +  N  + LI V+D DIG NG V+C I   E    LK     +    Y +    T D E ++ + + I   D G   LS + ++ I + D N++ PV      +V++ E+  IG+   TV   D+D  +N   + FL  +      F +D + G I +   LDREK   Y   I+ +D  Q       + ++ V+V+D NDN+P         ++ E ++ V E + +      V   D+D G N  V  +I     R      ++F+I+ ++G + +    DRE+   Y + +  TD G P ++    ++++++D NDN+PI   P        +   T PG I+  + A DND   NA + Y +    P    N+F +    G I + E LT     LH   ++ SD G
Sbjct:   39 VSYRVAEELREGAFIGNPSVDLRLADYNLE-LTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGDE-------CHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYEL-LPSDPATVSA---FELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQ---YLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDA--PTMFHMDPETGIISLTEQLDREKKANYSFTILAKD--QGIPVLEGNATVIVNVLDVNDNRPRF-------SLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNR------QLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNP---HNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          
BLAST of protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 208.764 bits (530), Expect = 6.070e-56
Identity = 180/687 (26.20%), Postives = 312/687 (45.41%), Query Frame = 1
Query:   94 LKYSVKEESPPNYLIGNIKKD--SRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVF--VPKE--HWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGL----NYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQET-----INKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPY-----LLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELF--ALTSLDREKYDV-YKISLLLTDKGNPPQTKEEIILVNIIDKNDN 2079
            +KY++ EE P   L+G +  D   R++E  S        +D    +   + E  G       IDRE  C           +A +C +   V   +P+     ++ E+ + DINDH P F  +   +EI E V++    PL  A+DLD+G N ++ Y L++ ++ FGL      +      L +KS+LD +  +G+ Y+L L A DGGDP + G   + I V D NDN P+F ++   V V E    G+ +  + ATD D G  G + Y     V    +      F++   +G++ L  +LD +L   + + ++A D G S +     + + +EDIND+ P+I +          + + E     +++GL+ V+D D  +NG V+C +       LL   ++      Y ++ N + DRE  + + + +   D G PP   ++   + + D N++ P  + +  E ++ E+ S G    TV   D DA  N  I++ + E+         Y SI+   G I     LD E +      +   D+        T+ +++V ++D NDN P      L N + V+ +   + G+   +  V A D+D  +N  + Y I     RN      +F INR  GE+F  A +  D       + + +++ D+G+P  +    I + +    D 
Sbjct:   31 VKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDD---FSLVHVEEADGTVSAREVIDREQQCG----------QAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDE-NERFGLALRARTDGAKYAELVVKSRLDRE-QEGE-YTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRR----LFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDD------YVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGV--PPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPR-DAGLGYLVTVVRARDSDSEANGELSYRIVQGNERN------LFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDG 682          

HSP 2 Score: 132.88 bits (333), Expect = 7.952e-32
Identity = 144/632 (22.78%), Postives = 263/632 (41.61%), Query Frame = 1
Query:  730 DYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV----SCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPP------VINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSID--RKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQ-FTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFT---INRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQN--DIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTI-----QVTE-FLTLKMFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGHDS---VSFNLIVTMAVVTCLICLSLLIAIVVVRRRQNYTCSHS 2544
            D ND+ P F +SE  V +SE  A+G+ +    A D D G      Y + E   N +  + +           +++  +LD +    + ++L A D G+ P  G  +++I + D ND++P  +         C +++ E+      +  +  TD D G NG+V    S  ++ +  ++       G       +      D E  S + ISI  +D G   +     + + + D+N++ P      ++ +    V +SE  +       V V D D+  N   +        +F +   R    +   S+LDRE++  Y + +   D    GT     +   TV ++D NDN+P    S+   +++E N      +  V A D D   N ++ Y +      +E+    V T   IN  +G ++AL  LD E        +   D G PP      + V I+D+NDNAP+   P  +N   ++ L +    G ++  + A D+D+  N  ++Y + +       N+F+++   G +      VT+   +     L +   D G +P  S    + IR      G    G D    +  +++  MA+     C   L A+V+V   ++ +C  +
Sbjct:  128 DINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDE---NERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQT------SCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTG------KLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAEN-GLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDG---GTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENN-SPGAYVTTVTAWDADAEHNGMIAYNV----VESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGN---ERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRG-SPALSATAAIEIRVGAHGDGD--DGADETQPLDASMLAVMALGAA--CALTLAAVVLVASTKSGSCGAA 727          

HSP 3 Score: 73.559 bits (179), Expect = 1.698e-13
Identity = 63/264 (23.86%), Postives = 123/264 (46.59%), Query Frame = 1
Query: 1582 IDRKFGKIKIKSNLDREK-IDRYIICIVVEDNKQLGTQFTTSFSLT---VSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNI---FKLHETQGTIQVTEFLTLKM---FVLHLQASDNG 2343
            ++   G +  +  +DRE+   +   C++  D   L T     F L    V ++D ND+ P    S   + I E +  +  ++    A D D+G NA+  Y ++  +     ++ +  T   K  EL   + LDRE+   Y + L   D G+PP++   ++ + ++D NDN+P++   S     + + +   PG ++ T++A D D   N  V Y+ +    P+++ +   F+L    G + +   L  ++   + + +QA D G
Sbjct:   77 VEEADGTVSAREVIDREQQCGQAPSCVIRFD--VLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISE-SVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRAR--TDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCN---VTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSS---PVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMG 329          
BLAST of protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.504 bits (480), Expect = 6.403e-49
Identity = 186/767 (24.25%), Postives = 325/767 (42.37%), Query Frame = 1
Query:  103 SVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQP-SDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIY---SIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDR------YIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVT---EFLTLKMFVLHLQASDNGNTPLKSV 2364
            +V+   P  +++     DS L E  +    F      + +  FR+   TG+      +DRE +  +  V     ++AQ+         P      V + + D+ND+ PVF P      I E            A D D G N    Y+L    +  F +N      +   + +++  D  +   Y L + A DGG         ++I V D  D PP F + +Y   V E  A G+ +  V A+  D  L  ++ Y +   VS  ++      F I  + GRI     +D +    + +R+ A+  G   + G+A + +++ D+N+H P        D     +S+ E+   N+    +  TD D G+NG+V   I +          N G+   I+    +   +  DRE    ++++++  D G  PLS+S T+ + + DVN++ P+ N++    +  E+  +G     V+  D DA  N          ++ F +D + G+I      DRE + R      +   +V  D  +         ++ V V D NDN P    S    ++ E    + + + +V A D D G N  + Y IN     NE  K   FT++   G++  L SLDRE+   Y + +  TD G  P      + V ++D+NDN P +       D +  T++   G+++ T+ A D DT  + +V Y +           F +  + G++ +    +F T +++ L++ A D G  P  S 
Sbjct:  455 AVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLV-----VQAQDRGSP-----PLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVN-----AVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD--LNANVTYLI---VSGDQRGS----FSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVF------DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGE---------GNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRP-KPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQ-LLRVTASDVDEGVNGALRYAIN---EGNEGGK---FTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRV---GELLITLTASDEDTGPSGDVRYAIVAGN---THATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSA 1165          

HSP 2 Score: 187.193 bits (474), Expect = 3.248e-48
Identity = 195/782 (24.94%), Postives = 324/782 (41.43%), Query Frame = 1
Query:  388 VEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYE----PPFILN----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDI-GQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQP-PLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSF-SLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTIN---YIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATI-------------HAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGHDSVSFNLIVTMA-------VVTCLICLSLLIAIVVVRRRQNYTCSHSQSPSNIMFAINTDQNRSQFITLR 2613
            V + + D+ND+ P F EP    +   E  ++  +  L  A D D+GPN +  +  +    I   N E    PP  +     L+L +    D     +Y+L ++A DGG P + G  ++++ V D NDNPP F K  Y  +V+E + VG+ +  ++   R                      + VPF      +G +   + LD +    + + L A D G  PL G+A   I + D+ND+ P I     P       S+ E+        L+ VTD D    NG++S  I    E+    +   G   +    +A+   DRE   ++ ++I   D G+P   S + ++ + ++DVN+H P    +     +SE    G     V   D D+  N  + + I    +  +FS+D   G +     +DRE     ++ I  +D    G Q  T++ SLTV+++D ND  P    +  V   +E N      +  V A D+D+G N  V Y  +     +YR      ++F ++   G++  L SLDRE+ + Y + +   D+G+PP      + V + D NDN P++                YP Q  A+I              A D D   N  V Y LT  +    +  F+++   G +     L  +   ++ L + A D G+   +S P  +TI     +        D  SF +   +A       V    + L+  +  ++V   Q  + S   S   I  A   D+    F  LR
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYK----IVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLLHRGR--------------------GPLAVPF---DPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSA-SVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQ-LDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQ---GAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVE-NSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYR------EMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF----------------YPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGD----AARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARS-PAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLR 730          

HSP 3 Score: 182.185 bits (461), Expect = 1.115e-46
Identity = 177/709 (24.96%), Postives = 309/709 (43.58%), Query Frame = 1
Query:   97 KYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGK-NYSLILRACDGGDPIQCGHQK-LSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVT----DGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQL--GTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVF-ALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDRE----KYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAY 2175
            + S+ E+ P N    +++   + S KN E + ++I E    + +   +   G+ YV   +DRET   +     S  + A +  +      P    + V +T+ D+ND+ P+F  +  V    E   +        A D D G N    Y  E+P   F L+ E   I +L +  +       G  ++S  + A DGG P     +  + + V D NDNPP F KS Y  +VSE  +  +++ RV A+D D G+ G++ Y + E     K       F +  ++G+I L   LD + T S+ + + A DSG SPL     + + + D ND+ P+ +        + +LS+  +  ++  +G +++T    D D G +G V   I          +     DR   S+      D E + L+ ++++ +D G+PP S++  + + + D N++PP         +I E++ IG    TV   D DA  N      + ++     +F+ID + G+I   + +DRE         V   +K +   T+ +   ++TV V D NDN P  +  + +  +++G       +     A D D   NA V Y +             +F ++R+ G +   T LDRE     + +  +++         Q  E  I+ N +  N   P+ +FP      INL +    GQ I    +Y
Sbjct:  764 EVSIAEDEPVNSRFFSVRATDKDSGKNGE-VKYEIGEGNGGEKFG--IFPDGQLYVRYELDRETREEY-----SLTVSAMDTGVE-----PLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGK-------FTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFT--------ESLLSV--DALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAI-----DRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAI--LVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGD------AAILFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNH--PLPRFPQDYESPINLLQ----GQTIPMPSSY 1423          

HSP 4 Score: 165.622 bits (418), Expect = 1.515e-41
Identity = 137/568 (24.12%), Postives = 239/568 (42.08%), Query Frame = 1
Query:  688 PIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKP-DIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDN-KQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTI---NYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKS 2361
            P      ++ I V D NDNPP+F   E  + V E T  G  IF + ATD D G    + Y +               F +   SG +  +R+LD +   S+ + + A D   +     A + + + D ND++P+ S      D+ +   + P+     A IG ++  D D G  G+V+  +   E+         G   +  ++      DRE+ + + +     D G   L+ +  + + + D N++ P + N+     + ED   G     +   D D   N  + F I     +  F++    G++ +   LDRE+   Y + + V D  +    + +++  +++ + D NDN P   +    +   +   G      Q  A+D D G N+ VEY +                 F +N   GE+  +  LDRE    Y +++L  DKG PP T    + V + D NDNAP  +FP  + +   + +   PG  +  + A+D D   N  + Y +   +P   +  F+L    GT+ V   L  +    + L ++A D G  P +S
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGA--------FVVDAASGVLRASRRLDREERASYLLTVRASDGTHAT---DARLSVAVRDANDNSPRFSRHAYSFDVAED--AAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWAD-GAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGND-GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQ--AVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAP--RFPRREYEAA-IAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDP---TGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGG-PARS 2035          

HSP 5 Score: 164.466 bits (415), Expect = 3.302e-41
Identity = 155/637 (24.33%), Postives = 266/637 (41.76%), Query Frame = 1
Query:  367 PKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY---LKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFR-----VIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPP---LSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQ---------ETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTY 2211
            P   +  VEI++ED+ND+ PVF      +E++E            A D D G N +  Y +   S       E  F+++     L++    D  +  +Y L +RA DG         +LS+ V D NDN P F +  Y  +V+E  A   +  R     V+A D DSG +G + Y +  S  +         F +   +G + + R LD +    + +R  A D G   L   A + + + D ND+ P +              +PE+      +  I  TD D G N ++   I+  + +    V N+G       +      DRE +S + + +   D  + P   LS++  + + ++DVN++ P   +  +     ED  +G    TV+  D D+ RN  + + +                 F+++   G++++   LDRE    Y + ++  D  +     T++ +L V+V DANDN P          I E      E + ++ A D D G+N  + Y I       +   + V       G L     LDRE+   Y++++   D G P ++    + V + D ND +P ++  SP   +        P  +I  + A D+D   +  VTY
Sbjct: 1495 PMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGS-------EGAFVVDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGA---FGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQND------SLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDG------QLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP-RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGR--PPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTE-VLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVL------GTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQL-SPYT-VHARENTQGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 6 Score: 156.762 bits (395), Expect = 8.079e-39
Identity = 174/737 (23.61%), Postives = 311/737 (42.20%), Query Frame = 1
Query:  223 NYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE-----QPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQ-FTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKV-FTINRKNGELFALTSLDREKY------DVYKISLLLTDKGNP-PQTKEEIILVNIIDKNDNAPIWKFPSPQNDI----INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKS 2361
             +F + E TG     G++DRE   S      +    AQ          PK  + ++ +T+ D+ND  P+F +  +    ++  +   F   ++ A D D+G N    Y  +     Q  ++F L+      L   + +    D  + + Y L+++A D G P      K+++ V D NDN P+F   +Y  ++ E    G+ +  V ATD D G  G++ Y +           +   F+++  +G +     LD +    + +++ A D G       A++ I + D  D  P  +        D    + EN      +G +  +  D+  N  V+ +I   +++    +  +G       I   +  DRE ++ + + +     G   ++   ++ + + DVN H PV +    EV+I+ED  +   FF+V   DKD+ +N  + + I E      F I    G++ ++  LDRE  + Y + +   D    G +  ++S ++ V+V+D NDNKP   +SS V +  E    V   +  V A D D GSN  V Y+           K +V F ++ + G + +L   DRE          +  S++ TD G P P      + V + D NDN P +     Q  +     NLT++         + A D D   N  + Y + +         F +  + G I +   L       + L + A+D+G +PL +
Sbjct:  387 GWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQ----------PKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVS-AADSDLGENGTVRYNFDPDMPAQYREMFRLDS-----LTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAG--------DAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARD------DYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGG-----RIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPD-GQLYVRYELDRETREEYSLTVSAMDT---GVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCE-EQEVGSLVGAVQATDADAGSNGGVTYSFE---------KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLR-------VTASDVDEGVNGALRYAINEGN---EGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAA 1059          

HSP 7 Score: 148.673 bits (374), Expect = 2.613e-36
Identity = 150/630 (23.81%), Postives = 248/630 (39.37%), Query Frame = 1
Query:  187 LTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFK-EVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLA-----LAKDLDIGPNNIQEYKLEQPSD------IFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESP---LMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIAN----HTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTD 2013
            +T+ +    E    F +   +G    + R+DRE   S+   V  SD   A + +LS              + + D ND+ P F  +    ++ E  + + +T  A     LA D D GP     Y L    D       FGL+   P    L +   LD +      Y L  RA DGG        +L + V D NDN P          V E    G+ + R+ ATD D G+   + + +       + +V         N G++ + R LD +    + + +   D    P   L     + +I+ D+ND+ P  +       P   L+ PE++   A +  +   D D G+N  V   +  D E+             + ++          DREA   + +++   D G+PPL+++ T+ + + D N++ P       E  I+ED   G E   +   D D   N  + + I        F +D   G + +   LDRE+   Y + +   D    G   + + S+ V++ D ND  P    S   ++  E   G    I QV A D+D+GS+  V Y                F+++  +G +  L SLDRE    + + +  TD
Sbjct: 1551 VTYSVLSGSEGA--FVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLS--------------VAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLH---PVTGALNVTRPLDRE--SRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAV--------GNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTS------PRSALA-PEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGG--GPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGN------DGGAFSVS-PDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 8 Score: 133.65 bits (335), Expect = 1.107e-31
Identity = 149/631 (23.61%), Postives = 257/631 (40.73%), Query Frame = 1
Query:  382 INVEITIEDINDHVPVFE-PNWKVIEIDERVSINFETPLALA-KDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFM-----KSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKK-------SVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKII--IEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIY---FSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTY 2211
            + V +T++D ND+ P FE P +       R S+  ++P+  A +DL           L +      + ++P   + +  +  LD++    + Y+L LRA DGG+P   G     I++ D NDN P         +    +V E  A G+    V  TD DS    + N  +  S+    +       +  VP  ++ K      +  +LD +  P + + + A D+G+ P+   A   ++  + D+NDH P+ ++           +L E     +Y+  +   D D G N K+   I    +     V     D     +  +   DRE  S   ++I+ +D G  P +   ++ + + DVN+ PP+           E+   G    +V   D D   N  + +     +   Y   F +D   GK+    +LDRE+++ Y + +  +D         ++  +TV V D NDN P         +I+E N      +  V A D D G+N  V Y +              F +N   G +    SLDRE+  VY++ +   D G+       I+ + + D  D  P   F       +    +  PG ++ ++ A   D   NANVTY
Sbjct:  120 LQVNVTVQDANDNPPAFEKPAY-------RASVAEDSPVGAALRDL-----------LHRGRGPLAVPFDPKTGM-VSTRQPLDFEA--RRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADS---PTANGELSVSIVGGNERGHFVLHAPGVPGLRVLK------VASQLDRERIPMYNLTILASDNGK-PVARSATASLVVYVNDVNDHAPRFALS------AYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSV-----DESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGS--PPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILE-NEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR-------FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPT--FARDDYSFVVFENVA-PGTLVGSVSASTLDL--NANVTY 693          

HSP 9 Score: 103.99 bits (258), Expect = 1.180e-22
Identity = 89/326 (27.30%), Postives = 147/326 (45.09%), Query Frame = 1
Query: 1309 TFDREAESLF----TISITCKDYG-----QPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETI---NKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIE----GNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDII--NLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEP 2232
            +FD  A  +F    ++  + +D G     +PP+S+   +EI + DVN++PPV      E+ + E+   G+  FT+   D D  +N   L+  ++   ++  F +D   G ++    LDRE+   Y++ +   D    GT  T +  L+V+V DANDN P     +   ++ E         +  I  V A D D G    V Y +      +    +  F ++   G L     LDRE    Y +    TD G    T    + VN++D NDNA     PS QND +   + +   PG  +  I A D+D   NA + ++++  +P
Sbjct: 1464 SFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNA--LVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD----GTHATDA-RLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYAL--APSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATAR--LYVNVLDANDNA-----PSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDP 1773          

HSP 10 Score: 101.679 bits (252), Expect = 7.050e-22
Identity = 108/437 (24.71%), Postives = 175/437 (40.05%), Query Frame = 1
Query:   94 LKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGD-SDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE-----------QPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGL-IIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKD 1362
            L   V E++PP   +  I         N+E L F I   + +  +   V   G+  VA  +DRE    +  V   SD  +    +LS          + V + + D+ND+ P F  P   +   D  V     T  A+  D D G N+  EY L                 F LN        + L  +LD +    ++Y+L + A D G P       L++ V D NDN P F + EY   ++E    G+E+ R+ A D D G  G + Y +               F++    G + + R LD + T S+ + + A D G       A +++ + D+ND +P   + P        +   EN      + L ++  D D+G +G+V+       +     VS +G   ++ S+      DREA+    + IT  D
Sbjct: 1734 LAAEVPEDAPPGTSLLRISATDDDEGVNAE-LEFSISSGDPEGRF--AVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLS--------SAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAV--DPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNT---VTGEVRLVRELDREA--RQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD-------FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSP------YTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSL------DREAQPQHVLIITATD 2133          
BLAST of protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 9.487e-47
Identity = 193/805 (23.98%), Postives = 330/805 (40.99%), Query Frame = 1
Query:   64 IHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKE---------HWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----------------------LYLKSKLDYD-VPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYM-VNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILN--RKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPD--IPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINN--------NIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETIN----KIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVIN-----IIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRN-EIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIA-TIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLT 2301
            +  T  +   L Y V EE    Y+IG++++ + L                   +   + E +GE  VA R+DRE +C        +P   ++     TV V              ++V++ + DINDH P F      + I E  ++    PL  A D D G N+IQ Y++   S   GL   P  ++                        L L+ +LD + VP   +Y L+L   DGG+P   G   L+I V D NDN P+F+      V ++E + VG+ + ++ A D D+G  G+I Y  +  +++           +   +G + +    KLD +  P   + + A D G+        + + + D ND+ P   +       +PD  + + EN      + LI V+D D+G +G V   +       L        +++ + +      D E    + +S+   D G P LS    + I + D+N++ PV  N         + EV++ E+   G     +   D D+  N  I+F + E          FS++ + G++ + + LDREK  RY + +   D      Q      + V+V+D NDN P  +  S   N      +E    V   +  V   D D G NA V   +N ++    + I     T     G +  L  LDRE    Y++S+   D G P  +    + + + D NDNAP+   P+  +   ++   +  G ++  ++ A D D  +N    Y +    P     IF L+   G + +   ++
Sbjct:   19 VSTTPLVQGALLYEVDEEVLVGYVIGDLRQSNLLCVCFFPPAPHVSPLPLHTPSLCIVNELSGELSVALRLDREALCM------EEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASG-DGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVP---SYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAA---LHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELAS-----PNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGS--PQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARV--ALNLVREAGPDWIGGAGDT---PGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNP---KGIFLLNADSGALSLARTVS 795          
BLAST of protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 7.894e-43
Identity = 163/632 (25.79%), Postives = 272/632 (43.04%), Query Frame = 1
Query:  373 EHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKI--SKNSGRIILNRKLDAKLTPSFFMRLE--AHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIG-QNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQP--PLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKS-NLDREKID------RYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLT 2220
            EHW    V IT+ + ND+ P+F      + + E  ++       LA DLD G      Y     SD F L+     I    + + LD++      +++ + A DGG     G  ++ I + D NDN P+F +  Y+    E     + + RV ATD DS     I Y +  +      S    +F I  S   G + L R LD +  P   + L   A D G  PL       + + D ND++P        D     +++PEN    A +  +  TDGD   + G++S + + +        + +GD      I +    DREA S + + +   D G      +   T+ I + DVN++ P   +    V I E+   G + FTV   D D   N + +        ++ I+   GKI+     LDRE ++         I +   D      + T S ++TV + D NDN+P  +     + ++EG       +FQV A D D G+N  V Y++     R +      F ++   G +  L  LDRE    Y++ L+ TD+G P  +    + + ++D NDNAP +    P    ++L +      ++ +++  D D+  NA +++ +T
Sbjct:    9 EHWGSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSLDPASGLI---SVAAALDFEAT--PRFTVTVMARDGGGQETAG--RVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPT------SAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIF------DRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGD------ITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEG-LPANSTLFQVTATDPDEGANGNVTYSMTAALPRPD------FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFH---PARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFIT 605          

HSP 2 Score: 148.288 bits (373), Expect = 3.215e-36
Identity = 172/658 (26.14%), Postives = 273/658 (41.49%), Query Frame = 1
Query:  103 SVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYV--AGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV------PKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLY---LKSKLDYDVPDGKNYSLILRACDGGDP--IQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRI-ILNRKLDAK-LTPSFF--MR---LEAHDSGESP--LMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELF-ALTSLDREKYDVYKISL 2001
            +  E+SPPN                   +T+ I       +YF I    G   V  A  +D E              K     +SLT+        P    +   + + D ND+ P+F+ N   I I E +          A D D  P    EY   Q S I+ L     F +N     + S    D      Y LI+RA DGGD    + G   ++I + D NDN P +    Y V + E T  G++IF V A D D    G++ Y +             PF++I+  SG+I     +LD + L P  F  MR   +   D G  P      A + ++++D+ND+ P     P        L + E    N+ +  +  TD D G NG V+  +     +   ++  +    +I +++     DREA + + + +   D G P LS++ T+ + + DVN++ P  +     V++ E V+      ++   D D+  N  +SF I        FS+  + G ++   +LDRE    Y + I   DN   G++ T + +L V V+D NDN+P  L  S  +++ E N      I QV A D D G N  V Y I          ++  F +N  +G +    T LDRE   ++ + +
Sbjct:  155 ATDEDSPPN-----------------NQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYE--------------KIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSP----EYG--QLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAI---------DPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPY------ALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQL--DAATGLITTLV---QLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPE-NVTRGAIILQVQATDIDEGINGRVWYRIISGN------QDGNFLVNVSSGLISRGATPLDRETVALHALQV 748          

HSP 3 Score: 146.747 bits (369), Expect = 1.087e-35
Identity = 154/584 (26.37%), Postives = 254/584 (43.49%), Query Frame = 1
Query:  694 QCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIV--TDGDIGQNGKVS-CVINKDEEKILLKVSNNGDDRMIYSIIA-NHTFDREAESLFTISIT--CKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNIS--FLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALT-SLDREKYD------VYKISLLLTDKGNPPQ--TKEEIILVNIIDKNDNAPIW-KFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKSVPTTLTI 2382
              G  ++ I + + NDN PIF    Y V+V E   +G+ + +V+ATD D+G++G ++Y   +             F +   SG I +   LD + TP F + + A D G     G+  ++I + D+ND+TP           D  +     ND N+   ++ V  TD D   N +++  ++          ++ +G     Y ++      D E     TIS+T    D G PPL+++ T  + + D N++ P+ + N   + I E++  G     V   D D +       LI        F I+ + G I   + LDRE + +YI+ +   D      Q T   ++ ++++D NDN P   +    + I+E   G  + IF V A D D+  N  + Y I+             + IN  +G++      LDRE  +      +  I +   D+G+PP+  T    + V + D NDN P +   P     +  L   +   Q+ AT    D D   N NVTY++T   P  +   F+L    G I     L    +  + L L A+D G TP  S  TTL++
Sbjct:   10 HWGSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDK---------FSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGR--VRINLLDVNDNTPVFQ-------RDSYVGTAREND-NSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGG----YGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTD-IFTVSAADPDLNENGTLVYAIDP--------PNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTAT----DPDEGANGNVTYSMTAALPRPD---FQLDAATGLITTLVQLDREAVAAYQLRLVATDRG-TPALSSTTTLSL 553          

HSP 4 Score: 138.272 bits (347), Expect = 4.339e-33
Identity = 146/569 (25.66%), Postives = 244/569 (42.88%), Query Frame = 1
Query:  613 KSKLDYDVPDGKNYSLILRACDGG--DPIQCGHQK----LSIRVNDYNDNPPIF-MKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVP---FFKISKNSGRIILN-RKLD--AKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRM-------IYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQ-ETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLL--NSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNP---PQTKEEIILVNIIDKND---------NAPIWKFPSPQNDIINLTKITYPGQIIATIH-AYDNDTLENANVTY 2211
            ++ LD +  D  +Y L + + DGG  + I     K    + + V D NDN P F   S  +V V E  A G+ +  + ATDRD+G  G+++     + ++      +P      I   SG  I++  K D   K +     R+ A D G  P      + +I+ D+ND+ P I + P        +S+ E       +  +  TD D G NG+V+            ++ + G D++       I  +      DRE  + +T+ +   D G PPLS S  + + + DVN+  P     ++ V++ E +S+G    TV+  +     N  +  +   I K  F++    G +     L  +  +R+ +  V  D+ +          L V V+D ND++P  +   +  V+NI E    V  +I +V A+D D G N  V Y+  +         E  F IN  +G +    +LDRE   VY + LL +D+G P     T+   ++++ ID N+          AP   F  P++        + PG  +  +  A D D   NA V Y
Sbjct: 1788 QAALDREATD--SYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVS-----ARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVP-IFLSPG----GYAVSVVELGAPGTLVASVWATDADAGPNGQVT-----------FRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL--KSYERFNLTAVATDHGR--PPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITE-VMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWES-FRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEH--------SPPGTAVGNVSGAVDADVGANAIVYY 2319          

HSP 5 Score: 131.339 bits (329), Expect = 5.646e-31
Identity = 158/700 (22.57%), Postives = 293/700 (41.86%), Query Frame = 1
Query:  343 KLSLTVFVP----KEHWINVEITIEDINDHVPVF---EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPS-DIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDS----GLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMG------QAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVIN-----KDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPV-INNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIK--SNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNI--FKLHETQGTIQVTEFL---TLKMFVLHLQASDNG 2343
            +L LT+ V     +   + + +T+ D+ND+ P F        V+E    V  +     A+ +DL +       Y +     D FG++     I+ +   + +DY+      Y L++ A D   P      +L + + +  D    F  + Y   +SE    G+ + RV A    +     L  +I    +     HK+        I+   G I     LD + T S+ + + + D G    +        A + + + D ND++P+            ++ + E+      + ++  TD D G NG VS   +     +   + +L + N     ++   +A   F  +        I   D G PP ST+  + + + DVN++ P+ ++     V++ E  + G    +V   D DA  N  ++F I E+      SI    G I++   +N+DRE    Y + +V  D        + S  + V V D ND +P  L   + ++++E +  V   +  V A +N  G N   +YT     Y+   I +  FT++  +G + +   L  + Y+ + ++ + TD G PP   +  + V ++D ND+ P++  P P   ++N+T++      I  + A D D  +N  V Y+        + +   F+++ T G I     L   +  ++ L L ASD G
Sbjct: 1577 RLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTV---APIDYETR--PEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSA-----TLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVD--VAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRI-ESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGN--PPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLE-SLSVGSFVATVKATENYKGHN--TKYT-----YKIAGIGKNAFTVHATSGLVTSTRLL--KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLP-PNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQG 2250          

HSP 6 Score: 126.716 bits (317), Expect = 1.521e-29
Identity = 147/617 (23.82%), Postives = 250/617 (40.52%), Query Frame = 1
Query:  367 PKEHWINVEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQ---------PSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV-------SCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQP-PLSTSQTIEICISDVNEHPPVI------NNNIKEVNISEDVSIGQEFFTVE-VEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTS-----------FSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDR--EKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKF 2097
            P+    N+ + + D+ND+VP+F  P    + + E  +         A D D GPN    +++E          PSD          I+ +   + +D +      Y+L++ A D G+P   G   + + V+D ND  P F+     V+V E  +VGS +  V AT+      G    + Y+     K +     F +   SG +   R L  K    F +   A D G  PL GQA + + + D+NDH P   + P   + +    +P        I  ++  DGD GQNG V         V ++D E   +  ++         I      DRE+++++++ +   D GQP    ++Q +++ + D++++ PV           +  +I E    G     V    D D   N  + + I        F++ R +G + + S+LDRE    Y I +    N       TT              + V + D ND  P   N      +   +  V  ++ Q+ A+D D+G+N++V Y I  I Y    IK    +  R    +F L    R  E+  + +   L T  G P     E++  ++   ND A +  +
Sbjct: 1932 PRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSD---------GIIRVAPGANIDRETR--AAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATEN---YKGHNTKYTYKIAGIGKNA-----FTVHATSGLVTSTRLL--KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMP----VVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSG-------IISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSR-WGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAV-DAKVGSELLQLEAVDRDVGNNSIVLYRILSILY----IKHSSNSSTRMY-NIFTLGRCARAGERDGILRTYDLFTAYG-PGYFMLEVVAADLAGHNDTATVGVY 2508          

HSP 7 Score: 122.479 bits (306), Expect = 2.722e-28
Identity = 140/582 (24.05%), Postives = 247/582 (42.44%), Query Frame = 1
Query:  673 CDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEK-TAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRL-EAHDSGESP---LMGQAVMKIIIEDINDHTPQI--SIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVS-CVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKI-----YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS--LTVSVMDANDNKPYLLNSSKVINIIEGN-YGVKEKIFQ--VFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGEL-FALT-SLDREKYDVYKISL--LLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDND--TLENANVTYTLTKVEPPLNSNIFKLHETQG---TIQVTEFLTLKMFVLHLQASD 2337
            C    P Q     L IR+ D NDN P F  + Y V ++E  +  G  +  V A+D D G    +   +Y  VS +  +     F I   +G +   + LD +++   ++ +  A D    P   L   A + + + D+ND TP    S +   D+ +              I   + +D D G NG++   +I+ D     +    +GD R+   +      DRE ++ + ++I  KD G PPL+++ T+ + + DV+++ PV  N     ++SE  ++      V   D +  RN + L+Q +          F  D + G + +   LDRE++  Y + + V DN      +    S  + V+++D NDN P     +    I E +  G    +    ++A D D G NA + Y++              F I+R  G +  AL   LDRE     ++ L  L+ D G    T    + V ++D NDN P +   S    ++  +     G  +  + A D D    +   V Y++        ++ F + E+ G   T+   ++ T   ++L + A+D
Sbjct: 1146 CLTATPAQATTSVL-IRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARV---VYAIVSGNTAAT----FGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSE--------GQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYV----ELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPD-NPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLG-------GSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVR--LGVTVLDVNDNTPTFNVTSQTAHVLENSPAV--GTSVIVVKAMDRDLGVCDAGTVRYSIASG----GNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATD 1691          

HSP 8 Score: 108.612 bits (270), Expect = 4.978e-24
Identity = 150/650 (23.08%), Postives = 273/650 (42.00%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKV-IEIDERVSINFETPLALAKDLDIGPNNIQEYKL--EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGL-YGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQA---VMKIIIEDINDHTPQIS-IKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVS-CVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREA--ESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDV-SIGQEFFTVEVEDKDA----TRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNK-PYLLNSSKVI---NIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEI----------ILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANV-----TYTLTKVEP 2232
            V + + D+ND  P F  +++  I++ E           +A D D G N   EY +    P + F ++   P   +L ++  ++ D      Y+L + A D G P       + +RV D +DN P+F+      ++SE  AV + + RV A+D + G    ++      S  N +++     F     +G + +NR LD +    + + L   D+ ++P   +    +M + I D ND++P  S +  + +IP+   + P         G I  +D D G N  ++  ++       L+       DR   S+      DRE        ++I  +D G+   + +  + + + DVN++ P  N   +  ++ E+  ++G     V+  D+D        + + I    N   F ID   G I   + +D E    Y++ +V  D  Q     T S  L VS+ +  D K  + L + +       + G   V+    Q+ A        A++    +  K   +   +    I    GE+    +LDRE  D Y +++L  D G     +E I          + VN+ D+NDN+P  +F +    ++ + +   PG ++  +HA D D   N  V     T+T T++ P
Sbjct: 1268 VSVHVADVNDVTPWFLRSYEGPIDVSEG-QPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVIS---PADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERA-----FYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPE---NSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLID-----RDRGNVSMALGQGLDREGIPGGRLELTILVQDGGR--RNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDT-FGIDESTGLIVTVAPIDYETRPEYLLMVVATD--QAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGG----PREAIAVLTNKPGAYVYVNVTDENDNSP--EFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPP 1889          

HSP 9 Score: 82.8037 bits (203), Expect = 3.556e-16
Identity = 127/593 (21.42%), Postives = 234/593 (39.46%), Query Frame = 1
Query:  718 IRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIF----RVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRI--ILNRKLDAKLTPSFFMRLE--AHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDK-NAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYS-----IIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIK--EVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKF-------------GKIKIKSNLDREKIDRYIICIVVEDN--KQLGTQFTT--SFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYD-VYKIS------LLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL-----TLKMFVLHLQASDNGNTPLKS 2361
            + + D NDN P+F +  Y   + E +  G+ +      + A+D D G+  ++ Y +    S         +F I ++ G +   L + LD +  P   + L     D G         + + + D+ND+TP  ++  +         + EN+      + ++   D D+G      C    D   +   +++ G+D          I+     D E    + + +   D   PP  T+ + E+ +S  NE    ++ ++   +  +SE    G     V      A   +   +   + K +     K              G+I  ++ LDRE  D Y++ ++  D   ++     T      + V+V D NDN P     S  +  +  +      +  + A D D GSN  V     +      I  + +  I  ++G    +T +D  K D V K S      ++  D G+PP++    + V ++D NDN PI  F SP    +++ ++  PG ++A++ A D D   N  VT+   ++E     +   +  + G I+V         T   + L + A D GN PL  
Sbjct: 1488 VTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSS--------AYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRR--NATVRLGVTVLDVNDNTPTFNVTSQ------TAHVLENSPAVGTSVIVVKAMDRDLGV-----C----DAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQA-PPFHTA-SCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARA-HTHTGTRIPPQYILIIQNESG----VTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPI--FLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTF---RIESG-GGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSG 2042          

HSP 10 Score: 60.077 bits (144), Expect = 3.589e-9
Identity = 68/240 (28.33%), Postives = 104/240 (43.33%), Query Frame = 1
Query: 1690 QFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDRE-KYDVYKISLLLTDKGNPPQ---TKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTL-----KMFVLHLQASDNGNTPLKSVPTTLTI 2382
            Q TTS  + + + D NDN P    ++  + + EG       +  V A D D G NA V Y I              F I+   G L A+ +LD E    +Y + +  TD+   P    T    + V++ D ND  P W   S +   I++++   PG  IAT  A D D+  N  + Y++   +P    N F +    G ++V  ++ L       + L + A D G  PL S   TLT+
Sbjct: 1153 QATTS--VLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGN------TAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTP-WFLRSYEGP-IDVSE-GQPGPRIATFMASDQDSGLNGELEYSIIDGDP---RNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNS---TLTV 1375          
BLAST of protocadherin-9 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 233.802 bits (595), Expect = 1.028e-62
Identity = 209/769 (27.18%), Postives = 331/769 (43.04%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDI----FGLNYEPPF-ILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFM-YESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDK---------NAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGN 2346
            + V+EE PP   +G +   S              +E   K+  F     TG      RIDRET                   L L    P    I+V++ ++DIND+ P F   +  + I E + +N   P+  A D D G N   +Y +    +      G    P    L +  K  LD +  D   Y L + A D G P   G+  ++I + D ND+ P+F ++ Y+ +++E T  G  I RV A DRDSG  G I Y + ++++ ++        F +  ++G I   + LD ++  S+   + A D G       A + I + D ND++PQ+ I   P         P N DK         N  I  I+VTD D   N +    I   +++   KV   G     Y I      DRE    + +++   D G P  ST   + I ++DVN++ P   +N    NISE    G     +   D D   N  +S+ I    +  +F +D + G +     LDRE++    I I  +D+       T S ++TV+++D NDNKP  + SS    I EG   +   + QV A D D G N  + Y I+     ++     +F +N + G L+  + LDRE   +Y  ++L  D G+P       + + I D NDNAP++    P     ++ +   PG+++  + A D D   NA ++Y +       N+  F +  + G I     L     + F L + A D GN
Sbjct:   14 FHVQEEQPPGTYVGKVDGASA-------------FEGSPKQ--FGFNSNTGVISTTARIDRETTT--------------QISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTD--FYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNS------IFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLP---------PHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLG----FYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGS--APKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEG-ASIGATVLQVSATDVDSGDNGRITYEIS----SSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFY---PVEYFASIMENEPPGKLLQ-VTATDADEGTNAVISYDIIGGN---NNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGN 718          

HSP 2 Score: 167.933 bits (424), Expect = 3.849e-42
Identity = 185/727 (25.45%), Postives = 324/727 (44.57%), Query Frame = 1
Query:  367 PKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSD--IFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDA----KLTPS--FFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV--SCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKY----DVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL--TLKMFVLHLQASDNGNTPLKSVPTTLTI-RYWPMETGSLLSGHD---SVSFNLIVTMAVVTCLIC 2481
            P+   + + IT+  IN H P F  +  V  +     ++++    +A D D G N    Y + Q ++  +FG+         LY++  L   +    +Y LI+RA DGG P       ++I + D ND+  +F+ + +   V+E ++ G+ +  ++A   D      I Y +  S S+         F +   SG+I    +LD     K T S  + M+ EA  +  +    +A++ + + D+ND+ P  S +    I    LSLP      + +  I   D D G N K   S V     +K  +  S+ G+  +      + T DRE  S + + +   D     L ++  IEI + D N+  PV   +   VNI+ED  IG     +   DKD  +N  I + I        F ++   G++ +  +LD E    Y + I  +D+  +    +++ ++TV+V+D NDN P L  +  V   +  N      + +  A D D G+NA + +++    Y       K F++N    E+  + ++D E      D +++ ++ TD+G+P  +  + I V + D+NDN+P +  P       +L         + TI A D D   N  VTY++       N+  F LH + G +Q+   +     ++ L +QASD G  P +   T +++ +  P+  G   S  D   SV+ N +   +VVT L  
Sbjct:  927 PQHSTMTIHITLS-IN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGG----KLYIRKSLLQALK--GSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESH---------FAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFS-RAVYAITVSELSLP-----GSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFIN-SSTGELHL------SKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLI--PLSSTVNVTVNVLDVNDNAP-LFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSM----YSQ--TPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN--------VMTITAEDPDRNSNGKVTYSIISG----NNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQ-PSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAA 1601          

HSP 3 Score: 156.762 bits (395), Expect = 1.407e-38
Identity = 147/565 (26.02%), Postives = 249/565 (44.07%), Query Frame = 1
Query:  364 VPKEHWIN-VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLAL-AKDLDIGPNNIQEYKLEQPSDI--FGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGD---DRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIV--VEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQ 2031
            VP    +  V I + D+ND+ P F  N     I E ++ N    L L A D D G N    Y +   +D+  F ++++   +      +    D     + ++ + A D G   + G   +++ + D NDN P FMKS Y   +SE  ++G+ + +V ATD DSG  G I Y     +S+    V    F+++  +G +    +LD +    +   + A D G+  LM    +++ I DIND+ P          P    +    N+    +  +  TD D G N     VI+ D    ++  +NNG+   D     I    + D E E  F++ I+ KD G    + +  + + + +  ++ PV    +    + E+V  G     V    KD   +IS+ I        F +D   G IKI  ++DRE+  +Y++ ++  V   K L  Q T    + + V+D NDN P    SS +++ I+G + V + ++   A+D D G N +V Y +           E +  IN  +G +     L       Y + +L +D G+PPQ
Sbjct:  402 VPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISE-LAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLV-----TTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITY----EISSSDAQVN-GLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-------YPVEYFASIMENEPPGKLLQVTATDADEGTN----AVISYD----IIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQAT----VNIEVLDRNDNAPQFSTSSVIVD-IDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS-------NAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQ 928          

HSP 4 Score: 153.68 bits (387), Expect = 1.097e-37
Identity = 179/789 (22.69%), Postives = 325/789 (41.19%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRET-----ICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSD-IFGLNYEPPFILNLYLKSKLDYDVPDG--KNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNG-------DDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---------FVLHLQASDNGNTPLKSVPTTLTIR 2385
            ++V E  P   L+G +   ++  +KN  S+++ I   +   N F +    G   + G +DRE      +     VG   PL AQ               +N+E+   D ND+ P F  +  +++ID    +      A A DLD G N +  Y+L   ++ +  +N     I       KL   + DG    Y++ + A D G P Q  H  ++I +    ++PP F  S Y+ +V     +  + F V+A D+DSG  G + Y +        +  E   F I    G++ + + L   L  S+ + + A D G         + I I+D NDH                 ++ EN+     +G ++    D  +   +   +   E    + V +         D   +     ++ +  +AE+++  +   +D           + + ++D+N++ PV +  +  + +SE    G   F ++  D D   N  F   L+  T    +F I+   G++ +   LDRE    Y + +   D        T    +TV   D+ND +P    S   +NI E    +   +  + A D DIG N +++Y+I+            +F +    G L    SLD E   +Y++++   D G  P +    + VN++D NDNAP+  FP+ Q   + + +    G  +    A D DT  NA++ +++    P   S  F ++    T ++T    + +         F L + A+D G +P  S   ++T++
Sbjct:  748 FTVYENVPKGTLVGRVYATTK--DKNG-SISYAIVSGD-PTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQAT-------------VNIEVL--DRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVI-------KLARKLTDGDETQYTVQVLASDSGSPPQ--HSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSI-------PQGNEEGLFGIFP-GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNT------FRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRD--------KAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFF-INSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVG--DSNDQRPVFPESDYTVNITEDAL-IGSLVINLNASDKDIGQNGLIKYSISNGNL------AAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPL--FPT-QPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTP---SKTFSVNS--ATCEITTIAAIDLETMPAGRDSFQLVVMATDQG-SPKLSTRKSITVQ 1467          

HSP 5 Score: 124.405 bits (311), Expect = 1.116e-28
Identity = 130/549 (23.68%), Postives = 239/549 (43.53%), Query Frame = 1
Query:   82 ISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFI----LNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNL-DREKIDRYIICIVVEDNKQLGTQFTTSFSL 1713
            ++   +++V E S P  L+G +   + L    ++ + + +   E   ++F +  ++G+     R+DRE +   K  G S+    Q   +     + ++  I V +T+ D+ND+ PVF      I + E            A D D G N    Y L     + G   +  FI      L+L   LD +     +Y+L+++A D  +       K+ I V D ND  P+F +S+Y VN++E   +GS +  + A+D+D G  G I Y    S+SN   +     F +   +GR+I+ + LD + T  + + + A D G  PL     + + + D+ND+ P    +P        L++ EN +    +G    +D D G N  ++  +          V++   +    + I   T     +S F + +   D G P LST ++I + ++D N++ P     +     +   S+     T E  D+++   +++ I    N  YF++    G++++   + D   I  Y + I   D  Q   Q  T  S+
Sbjct: 1051 VNNTFRFAVAENSSPGTLVGTLVAHA-LDHSRTKDIVYSLISSE---SHFAVDVRSGQITTRVRLDREEL--IKNTG-SNVYIMQAEAMYNDTTIKRDKAI-VIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSL-----VSGTGMDKFFINSSTGELHLSKTLDRETT--SSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKY----SISNGNLAA---MFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQP------VTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDS-FQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF---VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISG-NNGYFNLHPSTGQLQMIHQIPDNPTI--YQLTIQASDGGQPSRQTQTVVSV 1564          

HSP 6 Score: 105.145 bits (261), Expect = 9.994e-23
Identity = 124/513 (24.17%), Postives = 205/513 (39.96%), Query Frame = 1
Query:  229 FRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTP----SFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHP----PVINNNIKEVNISEDVSIGQEFFTVEVEDKDAT--RNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDAN 1737
            F I   TGE +++  +DRET  S+  V       A N  L  T          +EIT+ D ND  PVF  +   + I E   I        A D DIG N + +Y +   +     + E      L +   LD++    + Y L + A D G         +++ V D NDN P+F      + V E    G  + R  A+DRD+G    I + MY    +         F ++  +  I     +D +  P    SF + + A D G   L  +  + + + D ND++P   + P        L+          +  I   D D   NGKV+  I            + G  +MI+ I  N T       ++ ++I   D GQP    S+  +  +S   E P    P  ++   + +++E+   G    TV      ++   NI + +    +K  F + +  G +K    +DRE +      +V   +KQ  +  T+S ++T++V D N
Sbjct: 1207 FFINSSTGELHLSKTLDRETTSSYNLV--VKATDASNANLYSTA--------KIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESA-TGRLIVAKSLDFETT--QLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKT-------FSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF-VSPPAAAAGSSLN----------VMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPT-------IYQLTIQASDGGQP----SRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          
BLAST of protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 228.794 bits (582), Expect = 4.478e-61
Identity = 196/745 (26.31%), Postives = 341/745 (45.77%), Query Frame = 1
Query:  166 SEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKSVPTTLTIR 2385
            ++ +   LTF I E     + F+I + +G   VA R+DRET  ++  V  +    +Q   +          + N  I + D+ND+ PVF P      + E + I        A D D G N    Y+L    D       P   L   + +K   D  D  +YSL + A D G P Q     +++ +ND NDN P F +S+Y + V+E TA GS I RV+A+D D+G  G + Y +     NH  +     F+I   +GRI +   +D +   S+ + + A DSG  P +  A + I + D ND++P  +        +    + E     + + ++  TD D G N +V   I + +       + NG       +      +RE    +T++I   D G P +++ + + + ++DVN++PPV N+     ++ E+ +      TV  +D D   N  + + I    ++  F I+   G I   + LD E+  +Y + +   D+K     +T   ++T+ V++ ND  P     +   ++ E N      + +V A D D  S   + Y+I   K  ++      F+I++++G +     LDRE   +Y I + +TD GNPP +    + + I+D+NDN+P +   S  + I+   + + P      + A D D   NA +TY L++      ++ F +  + G I + + L  +    + L +QA D+G  P  S   ++TIR
Sbjct: 1022 TDSDGTPLTFDIVEGNAGSS-FKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESV----------YNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSV-GDTSKFEVNPATGL---VTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIIS--GNHGNA-----FRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASN------ETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNG------VLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSK-----YTAKTNVTIRVINLNDITPAFTQQNYTASVRE-NSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDK------FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSIL---ENSAPSSFSFKLAATDADEGTNARITYNLSR------NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQAS---SITIR 1706          

HSP 2 Score: 199.904 bits (507), Expect = 4.634e-52
Identity = 192/727 (26.41%), Postives = 317/727 (43.60%), Query Frame = 1
Query:  220 KNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRM-IYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQ-ETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLK---MFVLHLQASDNGNTPLKSVPT-TLTI 2382
            K  F I   +G   V+  +DRET  S+     S  ++A++   +      +     V I ++DIND+ P+F+  + V  + E  S   +     A D D   N    Y L   +D+F +N     I    LK++LDY+      Y + + A DGG P +     + + V+D NDNPP F KS Y   V E  A G  +  V ATD DSG  G I+Y +     N         F + + +G I     LD +   S+ + + A D      M    + I I D ND+ P  +   +        ++ E++     +G +  TD DIG NG V+  I    +    ++    D R  I S+    T DRE    +T+ +   D G P  S + +I + + DVN++ P    ++    I ED S+      V+VEDKD   N +  +         F+ID   G +  K+ LD E    Y + +   D        T    +T  +++ NDN P  ++ ++V +I E +  +   + ++ A D+D         T + +    E      F I++ +G +     LDRE    Y + +  T+ G+  ++      + ++D NDNAP++    P +   +L +    GQ +A + A D D  ENA VTY L+  +    ++ F+++   G +     L  +    + L + A D+G     +V   TLTI
Sbjct:  523 KGAFNIDANSGSIRVSSELDRETTPSY-----SLQVEARDGGSTS-----RSSSTRVTIALQDINDNSPIFQGPY-VFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLIT---LKTQLDYE--KKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMA-------FAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSR-------FNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQL----DPRSGILSV--RSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDST-GFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKIT--IINVNDNVPSFVSPAQVTSIPE-DVAINTHVVKLNATDSD-----GTPLTFDIV----EGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFN---PGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGD----TSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTI 1193          

HSP 3 Score: 199.134 bits (505), Expect = 1.040e-51
Identity = 176/629 (27.98%), Postives = 289/629 (45.95%), Query Frame = 1
Query:  223 NYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWIN---VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL-EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQ-FTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWK 2094
            N FRI   TG   V G +DRE + S+        + A++        VP   W++   V IT+ D ND+ P+F  N     IDE VSI     +  A D D G N    Y +    +  F +N      +N  L  K + +      Y+L +RA D G P+    ++L++ VND NDNPP+F    Y+ +V E +A  + +  V A D D G    + Y +  S ++ K+      FKI+  SG I+    LD +    + + + A DS       +  + I + ++ND TP  + +      +   S+ EN+  +  +  +  +D D   +   S V  KD +K  +       D+    I      DRE  SL+ I +   D G PPLS    + I I D N++ P  +++    +I E+ +     F +   D D   N       + N   F I    G I +   LDRE    Y + I   D+   GT    +S ++ V+V+D ND++P L+NSS +   +  N   +  + ++ A D D G NA + +++      NE   + VFT++   G++     LDRE+  VY + + + DKGNP  +    +++++ID++DN P ++
Sbjct: 1249 NAFRIDSTTGRITVVGVVDREALASYNLT-----ISAKDSG------VPP--WVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAIN-----AMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSII-SGNDEKR------FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQ------NYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSI-------DQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA-FMIGASSGVITLAQPLDRENKSTYDLAIQARDH---GTPPQASSITIRVTVIDINDHRP-LINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSL----LSNE--HKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQ 1825          

HSP 4 Score: 189.119 bits (479), Expect = 1.280e-48
Identity = 186/708 (26.27%), Postives = 306/708 (43.22%), Query Frame = 1
Query:  112 EESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKL-EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLS-LPENNDKNAYIGLIIVTDGDIGQNGK-VSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTL 2217
             E+ P   +  +    R S  N+ ++T+ ++  E K   F +  KTGE      +D ET  S+        ++        T FVP        IT++D+ND+ P F  +     + E V++        A DLD+G N    Y L    +  F ++ +        +++K  +D     +Y + LRA DGG P + G   + I + D NDN P+F  ++Y  +V E  A+G+ +  V A+D+D+G    + Y      +NH        F +   +G + ++R LD +   S+ + L   D G  PL   + + I + DIND+ P  S       P    S + EN      +     TD D   NG  V  +I  +++ +     + G    I SI    + D E ++ + +++  +D G P    +  + I I DVN+H PV + +     I E   IG    TV   D D+         LI   + K  F+ID   G I++ S LDRE    Y   + VE      T  ++S  +T+++ D NDN P +     V  + E +     +I QV A D D  SN  V Y ++            VF+IN   G +   T LD EK   Y +++   D G P ++   ++ V + D NDN P +   +       + +    G  +  + A D D+  N  ++Y++
Sbjct:   80 RENTPAAQVAIVTATDRDSGTNA-AITYSLFSGENK---FMMNSKTGEIRTVTPLDHETKDSYT-------MRISAFDGKHTTFVPL-------ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQG------VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHA-------FTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS-------PSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVFTIDGSTG----IISIA--KSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNV-KGAFNIDANSGSIRVSSELDRETTPSY--SLQVEARDGGSTSRSSSTRVTIALQDINDNSP-IFQGPYVFRVSESS-SPGHQIGQVAATDADDSSNGDVRYALSD--------NTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQF---AKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSI 724          

HSP 5 Score: 52.7582 bits (125), Expect = 1.021e-6
Identity = 42/159 (26.42%), Postives = 73/159 (45.91%), Query Frame = 1
Query: 1909 EKVFTINRKNGELFALT-SLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNT---PLKSV 2364
            + +FTI+   G +       DRE    Y++++L  D  N       ++++++ D+NDNAP +    P N  +   +   P   +A + A D D+  NA +TY+L   E     N F ++   G I+    L   T   + + + A D  +T   PL +V
Sbjct:    9 QGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEF----PLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGE-----NKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPLITV 158          
BLAST of protocadherin-9 vs. Ensembl Nematostella
Match: EDO46418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ21])

HSP 1 Score: 214.542 bits (545), Expect = 1.501e-56
Identity = 205/799 (25.66%), Postives = 349/799 (43.68%), Query Frame = 1
Query:  106 VKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRET--ICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESV--SNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV--SCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTIN---------------------YIKYRNEIIK--EKVFTINR---------------KNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTL---TKVEPPLNSNIFKLHETQGTIQVT---EFLTLKMFVLHLQASDNG 2343
            V E+ PPN  +  +  D + +  N E + + I +     +YF I +KTG        DRE   +   + +G    L +      L           V+I I D NDH PVF+       I E   +        A D D G N    Y ++  +D F ++     + + + L S+   +    +  S  + A D G+  +     + I V D  ++PP+F +  Y+V V E  A+GS + ++ A+ +        N  +Y S+   N   S   P F+I  + G +  + +LD K T +F + + A ++ + P+   A +KI +ED+ND+ P+  +      P     + EN    + +  +   D D G+NG+V  S V +KD +K        G D     +     FDREA+  +T+++  +D G P  +T   +EI I+D N++PP+    +  +++ E  + G E   V   D+D   N  +S+ I E      F ++R+FG I++   LDRE +D Y + +  +D K     ++   ++ V V+D NDN P    S   +N+ E N      + ++ A D D+G +    Y I+                     YI +  E +K    V T++                  G +     LDREK   Y I +  TD G+PPQ  +  + V + D ND  P +   + +     +++    G  +AT+ A D D   NA + Y+L    K E P     F++ ET G I +    ++ T + + L ++  D+G
Sbjct: 1048 VMEDDPPNTFVMQVHADDQDTGANGE-VIYSIEKPPGALSYFAIDDKTGIVTTLQSFDREEKPVYQIRIIGRDGGLGSSRGAERLM------GVCQVDIRIGDKNDHDPVFQNKQYEATIKEDFEVGRSVLHVSATDADAGSNAKLTYSIQPQNDYFAIDRATGTVTSKMSLLSEAKSEGQSSRVISFNVVANDNGNVSRKTVTLVRITVLDLGNDPPVFSQGVYVVTVREDIAIGSSLIQLSASTK-------TNKLIYYSIVPGNVPSSNNPPRFQIRISKGIVWNSHRLDHKETSNFSLTIRA-ETTDPPMSAFANLKIFLEDVNDNPPEFVM------PRYQGHVSENAPIGSSVLQVSARDRDSGENGRVTYSFVQDKDSDKF-------GLDENTGLVTTREEFDREAQGRYTLALKARDNGSPQKTTDTIVEIIITDENDNPPIFEEKVYNISVLESAASGMELLKVSAVDRDFGVNARVSYYISEGNINGAFEVNREFGTIRLAGTLDRENVDHYKLTLTAKDGK-----YSGEATVNVYVLDINDNNPKFEKSHYRVNVSE-NRPAGTLVVKLRASDPDLGESGKFLYDISGQGLMIVGDVNDNKPRFPDEPYIGHVMENLKAGASVMTMSAVDIDDPDVGNNAVMTDTGVIRTRRMLDREKRSSYDIVVAATDGGDPPQEGKVKVKVIVDDANDQHPQF---TKRVFAAKISESAALGSTVATVSATDRDEGVNAKLKYSLEYEAKEERP-----FRIDETTGEIILALTLDYETKRNYRLKVKVRDSG 1804          

HSP 2 Score: 145.976 bits (367), Expect = 2.977e-35
Identity = 132/506 (26.09%), Postives = 212/506 (41.90%), Query Frame = 1
Query:  367 PKEHWINVEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQP--SDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNN-------------------GDDRMIYSII--------------------ANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISF---LIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKP 1749
            P   + N++I +ED+ND+ P F  P ++   + E   I        A+D D G N    Y   Q   SD FGL+     +      ++ ++D      Y+L L+A D G P +     + I + D NDNPPIF +  Y ++V E  A G E+ +V A DRD G+   ++Y++ E   N         F++++  G I L   LD +    + + L A D   S   G+A + + + DIND+ P+       +     +++ EN      +  +  +D D+G++GK    I+     I+  V++N                   G   M  S +                         DRE  S + I +   D G PP      +++ + D N+  P     +    ISE  ++G    TV   D+D   N      L  E   +  F ID   G+I +   LD E    Y + + V D+  +   F+ + SLTV V+DAND  P
Sbjct: 1345 PMSAFANLKIFLEDVNDNPPEFVMPRYQG-HVSENAPIGSSVLQVSARDRDSGENGRVTYSFVQDKDSDKFGLDENTGLV-----TTREEFDREAQGRYTLALKARDNGSPQKTTDTIVEIIITDENDNPPIFEEKVYNISVLESAASGMELLKVSAVDRDFGVNARVSYYISEGNINGA-------FEVNREFGTIRLAGTLDRENVDHYKLTLTAKDGKYS---GEATVNVYVLDINDNNPKF------EKSHYRVNVSENRPAGTLVVKLRASDPDLGESGKFLYDISGQGLMIVGDVNDNKPRFPDEPYIGHVMENLKAGASVMTMSAVDIDDPDVGNNAVMTDTGVIRTRRMLDREKRSSYDIVVAATDGGDPPQEGKVKVKVIVDDANDQHPQFTKRVFAAKISESAALGSTVATVSATDRDEGVNAKLKYSLEYEAKEERPFRIDETTGEIILALTLDYETKRNYRLKVKVRDSG-VPLSFSDTASLTVEVLDANDRAP 1827          

HSP 3 Score: 138.658 bits (348), Expect = 4.871e-33
Identity = 168/732 (22.95%), Postives = 302/732 (41.26%), Query Frame = 1
Query:  106 VKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFE--PNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDI---FGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKL------SIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRI------ILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQ-------ISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIAN-HTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLT 2220
            V E++  + L+  ++     ++K+++ +T+ I   +   N F I  KTG   +      E I          P    N   S  + V +   I   + I+D+N+H PVF    ++  + +++     F   +  A D D G N    Y +E+P      F ++ +   +  L       +D  +   Y + +   DGG     G ++L       IR+ D ND+ P+F   +Y   + E   VG  +  V ATD D+G    + Y +           +  +F I + +G +      +   K + + +      + A+D+G        +++I + D+ +  P        ++++    I   ++ L  +   N  I   IV        G V    N    +I          R+   I+ N H  D +  S F+++I  +    PP+S    ++I + DVN++PP       + ++SE+  IG     V   D+D+  N  +++   +  +   F +D   G +  +   DRE   RY + +   DN     Q TT   + + + D NDN P        I+++E      E + +V A+D D G NA V Y      Y +E      F +NR+ G +    +LDRE  D YK++L   D      + E  + V ++D NDN P  KF       +N+++    G ++  + A D D  E+    Y ++
Sbjct:  947 VAEDAGSDQLVATVQA----TDKDNDPVTYSIASGDNTTN-FVINNKTGVIKLVSNRKPELIG---------PYYTMNISASDGLHVSQAMVI---VAIQDVNNHKPVFTDCASYHPVVMEDDPPNTFVMQVH-ADDQDTGANGEVIYSIEKPPGALSYFAIDDKTGIVTTLQ-----SFDREEKPVYQIRIIGRDGGLGSSRGAERLMGVCQVDIRIGDKNDHDPVFQNKQYEATIKEDFEVGRSVLHVSATDADAGSNAKLTYSIQP---------QNDYFAIDRATGTVTSKMSLLSEAKSEGQSSRVISFNVVANDNGNVSRKTVTLVRITVLDLGNDPPVFSQGVYVVTVREDIAIGSSLIQLSASTKTNKLIYYSIVP-------GNVPSSNNPPRFQI----------RISKGIVWNSHRLDHKETSNFSLTIRAETT-DPPMSAFANLKIFLEDVNDNPPEFVMPRYQGHVSENAPIGSSVLQVSARDRDSGENGRVTYSFVQDKDSDKFGLDENTGLVTTREEFDREAQGRYTLALKARDNGS--PQKTTDTIVEIIITDENDNPPIFEEKVYNISVLESAASGME-LLKVSAVDRDFGVNARVSY------YISEGNINGAFEVNREFGTIRLAGTLDRENVDHYKLTLTAKDG---KYSGEATVNVYVLDINDNNP--KFEKSHYR-VNVSENRPAGTLVVKLRASDPDLGESGKFLYDIS 1613          

HSP 4 Score: 122.865 bits (307), Expect = 3.178e-28
Identity = 144/575 (25.04%), Postives = 247/575 (42.96%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLM----GQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVS----IGQEFFTVEVEDKDATRNISFLI---QETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELF---ALTSLD------------REKYDVYKISLLLTDKGNPPQ 2031
            V + + D N++ P+F+ +   + + E   I  E     A+DLD G N   + K +  +DIF ++     I        L Y     K YS  + A D G P +     + + ++ ++D+PP+F KS Y   + E  A+   I RV A     G  G + Y++   V    +S     F + + +G + L + LD +   S+ +R+ A      P M     +A + I + DIND+ P+ +I  +P     + S+ +       +  +   D D G +  V   +   +          G   +I +      F+R+    +   +T  D   PP     T  I + DVN++PP+    + +V + E++     IGQ  F     DK A   +++ I   +++ +   FSI    G +   S LDRE + R+I+ I  +D    G    +  + + + V D ND+ P   + S  +  I  N     ++FQ  ALD D G N +V Y+I  I+      K+  F+IN  +G LF    LT+L+             E+     I + +  +  PPQ
Sbjct:    1 VIVRVLDGNNNDPIFQQSSYWVALPEGSPIGTELLRVTAEDLDSGSN--ADVKYQSSNDIFAVDETTGTI-------TLQYQASRNKKYSFTVTAFDQGKPSRSSVATVYVSIHSFSDSPPVFRKSTYEKRIPENFALKRGIVRVEALANGGGAGGELRYYL---VGGDPQSQ----FNVDRLTGELSLKKPLDYEKVASYRLRIRAVQKTWRPNMPELPAEATVLITVTDINDNAPRFAIPREP----LVTSIHQFRPAGTTVTKVTAYDQDSGSHALVKYGLENADSFPFTITPQTG---VIKTTAELRHFERD---FYAFVVTATD-STPPFH-KVTANIQLGDVNDNPPLFAQPVYKVFVRENLQGGHVIGQ--FAARDPDKGANARVTYSIINFEDSRSDNLFSIHPFTGVLTALSTLDREDLSRHILTIQAKDT---GVPRMSGLAQIVIIVDDVNDHAPRFSSGSFHVE-IPLNTPPDSRVFQARALDPDGGHNGLVRYSI--IQGN----KQGYFSINHIDGSLFLDEKLTTLEPIDIKVTRDMGQPERSSTADIRIFIHVQAGPPQ 535          

HSP 5 Score: 115.161 bits (287), Expect = 7.741e-26
Identity = 140/601 (23.29%), Postives = 246/601 (40.93%), Query Frame = 1
Query:  643 GKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMK-SEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSG------ESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAES------LFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVS-----------------VMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKI--TYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDN 2340
            G  Y++ + A DG   +      + + + D N++ P+F   + Y   V E     + + +V A D+D+G  G + Y      S  K    + +F I   +G +   +  D +  P + +R+   D G         LMG   + I I D NDH P    K          ++ E+ +    +  +  TD D G N K++  I    +   +       DR   ++ +  +   EA+S      + + ++   D G     T   + I + D+   PPV +  +  V + ED++IG     +    K            T   IY+SI    G +   +N  R +I   I   +V ++ +L  + T++FSLT+                  + D NDN P  +      ++ E N  +   + QV A D D G N  V Y+    K  ++      F ++   G +      DRE    Y ++L   D G+P +T + I+ + I D+NDN PI+     +  + N++ +     G  +  + A D D   NA V+Y ++  E  +N   F+++   GTI++   L    +  + L L A D 
Sbjct: 1004 GPYYTMNISASDG---LHVSQAMVIVAIQDVNNHKPVFTDCASYHPVVMEDDPPNTFVMQVHADDQDTGANGEVIY------SIEKPPGALSYFAIDDKTGIVTTLQSFDREEKPVYQIRIIGRDGGLGSSRGAERLMGVCQVDIRIGDKNDHDPVFQNK------QYEATIKEDFEVGRSVLHVSATDADAGSNAKLTYSIQPQNDYFAI-------DRATGTVTSKMSLLSEAKSEGQSSRVISFNVVANDNGNVSRKTVTLVRITVLDLGNDPPVFSQGVYVVTVREDIAIGSSLIQLSASTK------------TNKLIYYSI--VPGNVPSSNNPPRFQI--RISKGIVWNSHRLDHKETSNFSLTIRAETTDPPMSAFANLKIFLEDVNDNPPEFVMPRYQGHVSE-NAPIGSSVLQVSARDRDSGENGRVTYSFVQDKDSDK------FGLDENTGLVTTREEFDREAQGRYTLALKARDNGSPQKTTDTIVEIIITDENDNPPIF-----EEKVYNISVLESAASGMELLKVSAVDRDFGVNARVSYYIS--EGNING-AFEVNREFGTIRLAGTLDRENVDHYKLTLTAKDG 1551          

HSP 6 Score: 110.153 bits (274), Expect = 2.734e-24
Identity = 150/627 (23.92%), Postives = 257/627 (40.99%), Query Frame = 1
Query:  214 EKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPK-EHWINVEITIEDINDHVPVF----EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISI-TCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGN----YGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNII 2064
            + ++ F +   TGE  +   +D E + S++       L+ +  + +    +P+      V IT+ DIND+ P F    EP   V  I +            A D D G + + +Y LE  +D F     P   +   +K+  +    +   Y+ ++ A D   P        +I++ D NDNPP+F +  Y V V E    G  I +  A D D G    + Y    S+ N + S     F I   +G +     LD +      + ++A D+G   + G A + II++D+NDH P+ S           + +P N   ++ +      D D G NG V   I +  ++    +++         I  +   D +  +L  I I   +D GQP  S++  I I I  V   PP   ++    N++E+   G     +     D    + + I        F +    G +     LD EK  RY I ++  D K       +   + V+V++ NDNKP  +N      IIEGN      V  ++  + A+D D   + ++ Y I   K R      + F++N  N  +   T + R+    Y   + ++D G PP   + +  V ++
Sbjct:  157 DPQSQFNVDRLTGELSLKKPLDYEKVASYR-------LRIRAVQKTWRPNMPELPAEATVLITVTDINDNAPRFAIPREP--LVTSIHQFRPAGTTVTKVTAYDQDSGSHALVKYGLEN-ADSFPFTITPQTGV---IKTTAELRHFERDFYAFVVTATDSTPPFH--KVTANIQLGDVNDNPPLFAQPVYKVFVRENLQGGHVIGQFAARDPDKGANARVTY----SIINFEDSRSDNLFSIHPFTGVLTALSTLDREDLSRHILTIQAKDTGVPRMSGLAQIVIIVDDVNDHAPRFSSG------SFHVEIPLNTPPDSRVFQARALDPDGGHNGLVRYSIIQGNKQGYFSINH---------IDGSLFLDEKLTTLEPIDIKVTRDMGQPERSSTADIRIFIH-VQAGPPQFLSSPFVGNVTENEPKGAFVVHISAASLDP---VMYSIVSGNEAGNFRLHPGVGWLTTVRPLDNEKQSRYKIIVMAMDLKNR----VSKVEVIVNVLNVNDNKPKFVNIRN--GIIEGNVLKDVAVGSRVMVIDAVDAD--RSDILSYRIEDEKAR------RYFSVN--NEGVVTSTRVLRDLDSPYLFKVSVSDNGKPPMVAQAMARVVLL 729          

HSP 7 Score: 109.383 bits (272), Expect = 4.215e-24
Identity = 126/522 (24.14%), Postives = 220/522 (42.15%), Query Frame = 1
Query:  589 PFILNLYLKSKLDYDVPDGKNYSLILRAC-DGGDPIQCGHQK-LSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESL---FTISITCKDYGQPPLSTSQTIEI-CISDVNEHPPVINNNIK-EVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKI-YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGT-----QFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL------DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIW 2091
            P+  ++ ++S LDY+      ++   R   D  D      +  + I + D NDNPP F +  Y   + E   VG+ +  V A D DSG+ G  +YF           VE  FF +   +G I   R LD +  P+    + A DSG     G A + + + ++ND+ P+ S           + + E+   +  +  +  TD D   N  V+  I   +      ++N      +  +++N    R+ E +   +T++I+  D     L  SQ + I  I DVN H PV  +       + ED         V  +D+D   N  + + I++    + YF+ID K G +    + DRE+   Y I I+  D   LG+     +      + + + D ND+ P   N      I E ++ V   +  V A D D GSNA + Y+I          +   F I+R  G + +  SL      + +   V   +++  D GN  +    ++ + ++D  ++ P++
Sbjct:  780 PYSGDVRVRSGLDYETVKTHRFTAEARNTRDNTDYANIDSEADVKIVLRDLNDNPPEFFELSYRDTLPESAPVGTTVLSVTARDLDSGVNGQFHYF-----------VESQFFSVDPYTGWITTKRPLDFETNPTHSFLVVAQDSGNPARNGTARVIVELTNVNDNAPRFSQSL------YNVFVAEDAGSDQLVATVQATDKD---NDPVTYSIASGDNTTNFVINNKTG---VIKLVSN----RKPELIGPYYTMNISASD----GLHVSQAMVIVAIQDVNNHKPVFTDCASYHPVVMEDDPPNTFVMQVHADDQDTGANGEVIYSIEKPPGALSYFAIDDKTGIVTTLQSFDREEKPVYQIRIIGRDGG-LGSSRGAERLMGVCQVDIRIGDKNDHDPVFQNKQYEATIKE-DFEVGRSVLHVSATDADAGSNAKLTYSIQ--------PQNDYFAIDRATGTVTSKMSLLSEAKSEGQSSRVISFNVVANDNGNVSRKTVTLVRITVLDLGNDPPVF 1260          

HSP 8 Score: 100.908 bits (250), Expect = 1.812e-21
Identity = 125/521 (23.99%), Postives = 200/521 (38.39%), Query Frame = 1
Query:  106 VKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRET----ICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPS--DIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINY------------------------FMYESVSNHKKSVEVPFFK-------------ISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVIN---KDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQP-PLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDA 1527
            V E +P    +  +    R S +N   +T+   +D++  + F + E TG        DRE       + K   +  P K  +                VEI I D ND+ P+FE     I + E  +   E     A D D G N    Y + + +    F +N E      + L   LD +  D  +Y L L A DG      G   +++ V D NDN P F KS Y VNVSE    G+ + ++ A+D D G  G   Y                        ++   + N K    V                 +  ++G I   R LD +   S+ + + A D G+ P  G+  +K+I++D ND  PQ + +           + E+    + +  +  TD D G N K+   +    K+E    +       D     II   T D E +  + + +  +D G P   S + ++ + + D N+  P          + EDV IG+    +EV D D+
Sbjct: 1375 VSENAPIGSSVLQVSARDRDSGENGR-VTYSFVQDKDS-DKFGLDENTGLVTTREEFDREAQGRYTLALKARDNGSPQKTTDTI--------------VEIIITDENDNPPIFEEKVYNISVLESAASGMELLKVSAVDRDFGVNARVSYYISEGNINGAFEVNRE---FGTIRLAGTLDRENVD--HYKLTLTAKDGK---YSGEATVNVYVLDINDNNPKFEKSHYRVNVSENRPAGTLVVKLRASDPDLGESGKFLYDISGQGLMIVGDVNDNKPRFPDEPYIGHVMENLKAGASVMTMSAVDIDDPDVGNNAVMTDTGVIRTRRMLDREKRSSYDIVVAATDGGDPPQEGKVKVKVIVDDANDQHPQFTKRV------FAAKISESAALGSTVATVSATDRDEGVNAKLKYSLEYEAKEERPFRI-------DETTGEIILALTLDYETKRNYRLKVKVRDSGVPLSFSDTASLTVEVLDANDRAPRFEPLSYSAVVREDVDIGERLLRLEVTDPDS 1858          

HSP 9 Score: 89.3521 bits (220), Expect = 7.007e-18
Identity = 160/766 (20.89%), Postives = 301/766 (39.30%), Query Frame = 1
Query:   97 KYSVKEESPPNYLIGNIKKDSRLSEKNSES-LTFQI--YEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWI-NVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQ--PSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYS-----IIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFT---TSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE----FLTLKMFVLHLQASDN 2340
            K  V+E     ++IG     +R  +K + + +T+ I  +ED    N F I   TG       +DRE +           ++A++        VP+   +  + I ++D+NDH P F      +EI      +     A A D D G N +  Y + Q      F +N+      +L+L  KL    P       I    D G P +     + I ++     PP F+ S ++ NV+E    G+ +  + A         S++  MY  VS +    E   F++    G +   R LD +    + + + A D        + ++ ++  ++ND+ P+                   N +N  I   ++ D  +G    V   ++ D   IL     +   R  +S     ++ +    R+ +S +   ++  D G+PP+       + +  +   P     + +  +I E  ++G   FT+        RN  + I   + +  F +D   G ++++S LD E +  +        N +  T +    +   + + + D NDN P     S    + E +  V   +  V A D D G N    Y           ++ + F+++   G +     LD E    +   ++  D GNP +     ++V + + NDNAP  +F     ++  + +     Q++AT+ A D D   N  VTY++   +   N+  F ++   G I++       L    + +++ ASD 
Sbjct:  333 KVFVRENLQGGHVIGQFA--ARDPDKGANARVTYSIINFEDSRSDNLFSIHPFTGVLTALSTLDREDLSRHILT-----IQAKDTG------VPRMSGLAQIVIIVDDVNDHAPRFSSGSFHVEIPLNTPPDSRVFQARALDPDGGHNGLVRYSIIQGNKQGYFSINH---IDGSLFLDEKLTTLEPID-----IKVTRDMGQPERSSTADIRIFIH-VQAGPPQFLSSPFVGNVTENEPKGAFVVHISA--------ASLDPVMYSIVSGN----EAGNFRLHPGVGWLTTVRPLDNEKQSRYKIIVMAMDLKNRVSKVEVIVNVL--NVNDNKPKFV-----------------NIRNGIIEGNVLKDVAVGSRVMVIDAVDADRSDILSYRIEDEKARRYFSVNNEGVVTSTRVLRDLDSPYLFKVSVSDNGKPPMVAQAMARVVL--LKYQP---QQDQQRTSIQESAALGTRVFTLLT--AKPIRNARYSIVSPL-ETKFRVDPYSGDVRVRSGLDYETVKTHRFTAEAR-NTRDNTDYANIDSEADVKIVLRDLNDNPPEFFELSYRDTLPE-SAPVGTTVLSVTARDLDSGVNGQFHY----------FVESQFFSVDPYTGWITTKRPLDFETNPTHSFLVVAQDSGNPARNGTARVIVELTNVNDNAP--RFSQSLYNVF-VAEDAGSDQLVATVQATDKD---NDPVTYSIASGD---NTTNFVINNKTGVIKLVSNRKPELIGPYYTMNISASDG 1016          

HSP 10 Score: 87.8113 bits (216), Expect = 2.142e-17
Identity = 96/365 (26.30%), Postives = 153/365 (41.92%), Query Frame = 1
Query:  229 FRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLE-QPSDIFGL--NYEPPFILNLYLK---------------SKLDYDVPDGKN-----------------------YSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIE--DINDHTPQIS-------IKPKPDIPDCMLSL----PENNDKNA 1161
            F +  + G   +AG +DRE +  +K       L A++ K S       E  +NV +   DIND+ P FE +   + + E            A D D+G +    Y +  Q   I G   + +P F    Y+                S +D D PD  N                       Y +++ A DGGDP Q G  K+ + V+D ND  P F K  +   +SE  A+GS +  V ATDRD G+   + Y +      ++   E P F+I + +G IIL   LD +   ++ ++++  DSG  PL       + +E  D ND  P+         ++   DI + +L L    P+++ +N 
Sbjct: 1519 FEVNREFGTIRLAGTLDRENVDHYKLT-----LTAKDGKYS------GEATVNVYVL--DINDNNPKFEKSHYRVNVSENRPAGTLVVKLRASDPDLGESGKFLYDISGQGLMIVGDVNDNKPRFPDEPYIGHVMENLKAGASVMTMSAVDIDDPDVGNNAVMTDTGVIRTRRMLDREKRSSYDIVVAATDGGDPPQEGKVKVKVIVDDANDQHPQFTKRVFAAKISESAALGSTVATVSATDRDEGVNAKLKYSL-----EYEAKEERP-FRIDETTGEIILALTLDYETKRNYRLKVKVRDSG-VPLSFSDTASLTVEVLDANDRAPRFEPLSYSAVVREDVDIGERLLRLEVTDPDSDSQNG 1863          

HSP 11 Score: 85.5001 bits (210), Expect = 1.035e-16
Identity = 86/346 (24.86%), Postives = 148/346 (42.77%), Query Frame = 1
Query: 1336 FTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNIS--FLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICI--VVEDNKQLGTQFTTSFSLTVSVMDANDNKP-YLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNII--DKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNG 2343
            ++ ++T  D G+P  S+  T+ + I   ++ PPV   +  E  I E+ ++ +    VE             + +     +  F++DR  G++ +K  LD EK+  Y + I  V +  +    +     ++ ++V D NDN P + +    ++  I         + +V A D D GS+A+V+Y +       E      FTI  + G +     L   + D Y   +  TD   PP  K   +  NI   D NDN P++  P  +   + + +    G +I    A D D   NA VTY++   E   + N+F +H   G +     L    L   +L +QA D G
Sbjct:   80 YSFTVTAFDQGKPSRSSVATVYVSIHSFSDSPPVFRKSTYEKRIPENFALKRGIVRVEALANGGGAGGELRYYLVGGDPQSQFNVDRLTGELSLKKPLDYEKVASYRLRIRAVQKTWRPNMPELPAEATVLITVTDINDNAPRFAIPREPLVTSIHQFRPAGTTVTKVTAYDQDSGSHALVKYGL-------ENADSFPFTITPQTGVIKTTAELRHFERDFYAFVVTATDS-TPPFHK---VTANIQLGDVNDNPPLFAQPVYK---VFVRENLQGGHVIGQFAARDPDKGANARVTYSIINFEDSRSDNLFSIHPFTGVLTALSTLDREDLSRHILTIQAKDTG 411          

HSP 12 Score: 83.5741 bits (205), Expect = 4.253e-16
Identity = 130/542 (23.99%), Postives = 220/542 (40.59%), Query Frame = 1
Query:  718 IRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTP--QISIKPKPDIPDCMLSLPENND-KNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITC--KDY--GQPPLSTSQTIEICISDVNEHPP--VINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQ---ETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTI-NYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLT 2301
            +RV D N+N PIF +S Y V + E + +G+E+ RV A D DSG    + Y     +           F + + +G I L  +  A     +   + A D G+      A + + I   +D  P  + S   K         +PEN   K   + +  + +G          ++  D +      S    DR+   +      D E  + + + I    K +    P L    T+ I ++D+N++ P   I       +I +    G     V   D+D+  +   L++   E  +   F+I  + G IK  + L   + D Y   +   D+     + T +  L     D NDN P        + + E   G    I Q  A D D G+NA V Y+I N+   R++     +F+I+   G L AL++LDRE    + +++   D G P  +    I++ + D ND+AP +   S   +I +N    T P   +    A D D   N  V Y++ +         F ++   G++ + E LT
Sbjct:    3 VRVLDGNNNDPIFQQSSYWVALPEGSPIGTELLRVTAEDLDSGSNADVKYQSSNDI-----------FAVDETTGTITL--QYQASRNKKYSFTVTAFDQGKPSRSSVATVYVSIHSFSDSPPVFRKSTYEK--------RIPENFALKRGIVRVEALANGGGAGGELRYYLVGGDPQ------SQFNVDRLTGELSLKKPLDYEKVASYRLRIRAVQKTWRPNMPELPAEATVLITVTDINDNAPRFAIPREPLVTSIHQFRPAGTTVTKVTAYDQDSGSHA--LVKYGLENADSFPFTITPQTGVIKTTAELRHFERDFYAFVVTATDSTPPFHKVTANIQLG----DVNDNPPLFAQPVYKVFVRENLQG-GHVIGQFAARDPDKGANARVTYSIINFEDSRSD----NLFSIHPFTGVLTALSTLDREDLSRHILTIQAKDTGVPRMSGLAQIVIIVDDVNDHAPRFSSGSFHVEIPLN----TPPDSRVFQARALDPDGGHNGLVRYSIIQGN---KQGYFSINHIDGSLFLDEKLT 499          
BLAST of protocadherin-9 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 208.379 bits (529), Expect = 1.243e-54
Identity = 198/771 (25.68%), Postives = 335/771 (43.45%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGP-NNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDA---TRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQ-TKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQI-IATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGNTPLKSVPTTLTIR 2385
            ++++E S    +IG++   SR    N+E + + I   +   +   ++  TG  Y+   +D E I S         ++A++         P   + NV I + DIND+ P F  +  ++ + E   I          D D G    +    L  P  +F L+        L L   +DY     ++Y+L ++A DGG P +     L ++V D ND  P+F    Y  +V E T   S I  V+ATD DSG  G I+Y     V   K  +        +N G+I +  KLD +    + +++ A D G       A +K+I++D+ND+ P                + EN     Y+G +  +D D G NG V+   +    + ++       D+    I  +   DREA++ +  SI   D G  P      + + + DVN+  P  + N   V ++ED+ +G    T+   D D      +I+++I        FS+++  G + + S LDRE   R+I+ +V  D K       T   + ++V+D NDN P  +N +    + E    +   +  V A+D+D G N  V Y I           +  F IN   G +  L +LD E  + Y + +  TD G   Q T  +++ + + D NDN P +     +N II       P    + TI A+D+D+  N+ + YT+    P  +   FK++   G IQ T  +    +  + L ++A+D   T    +  T T++
Sbjct:  710 FTIQEHSQALSVIGHVHAISRDKGTNAE-VVYSI--SKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLT-----VQAKDKGTP-----PLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSN---TGALSLTKLIDYG-NSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL--------RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQA------SYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIV-------DKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI--VAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASD-KGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPE-KLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGN------TDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFD----KNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAH---FKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLK 1425          

HSP 2 Score: 189.889 bits (481), Expect = 9.622e-49
Identity = 190/711 (26.72%), Postives = 319/711 (44.87%), Query Frame = 1
Query:  289 ICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF----EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQP--SDIFGLNYEPPFILNLYL-----KSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGES-PLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIA-NHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKI-------YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTK--VEPPLNSNIFKLHETQGTIQVTEFL---TLKMFVLHLQASDNGN 2346
            + + K V D + + A N  +      PK +   V + ++D+ND+ P F         V E D+    +F   L +A D D G N+ Q Y +      ++F L  +     +LY       S +  D     +Y L + A DGG+P   G  +LSI V D NDN P F    Y   + E   VG+ I +V A+D+D G    I Y    S+  H     +  F I   +G I+ N +LD +   S+ + ++A D G S  L   A+++I + D+ND+ P I +            + EN      +  + V+D D G+NG+V+  +   +    +K     D+    SIIA   + DRE    F +   C D G PP +T ++  I + DVN+  P  + +  E  + E+ ++      V   D+D   N S L+    N         +F+ID   G I   ++LDRE+I + ++ ++V D        + + S+ V++ D+NDN PY   SS   ++ E N      + Q+ A D DIG N+++ Y+I        +     F ++ + G +    +LD E    Y   +  TD G   ++    + V++ D NDN P++   S   +    T+I   GQ I  + A D D+ +     + +T+  +E      +F + +  G I + + L   T   ++L ++A D G 
Sbjct:   13 VITTKTVLDREKVSAYNLTIVEFSTPPKSY--TVLVYVQDLNDNSPSFVRGTSAKLVVFENDK----DFRQKL-IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQY----SIETHSDPQAI--FGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYT---LGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDE----SIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSN-SELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGS--PPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFE-NSPSGSPVVQLLAQDPDIGENSLILYSI--------LTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRI---GQSICQLKAIDRDSPK-----FAITRFIIEQGNADEVFSV-DGSGLITLAKLLDRETQDNYLLTVKAVDGGG 680          

HSP 3 Score: 189.119 bits (479), Expect = 1.324e-48
Identity = 181/668 (27.10%), Postives = 308/668 (46.11%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQ--PSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGT-QFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASD-NGNTPLKSV 2364
            V +++ D+ND+ PVF+P+   +E  E   I        A D D     I  + +EQ    ++F ++        + L   LD +  D  NY L ++A DGG         ++I V D ND PPIF K+EY   + E +   S I  V A  RD G    + Y + +  +++          +  ++G + L  ++D +  PS ++ ++A D G  PL G A + I + DIND++PQ +          ++ LPE+         + V D D G  G+VS  +  +   +    SN G      S+     +   A S +T+ +  +D G PP S++  +E+ + DVN++ PV  N     ++ E          V   D D+  N  IS+     ++   F + R  GKI IKS LDRE I+ Y + ++  D+   GT + ++S  + V V D NDN P+   +S    + E N  V   +  V A D+D GSN  V Y     ++  ++ +   F ++++ G++     LDRE    Y  S++ TD G+ P+  +  + V + D ND +P  KF   +  +     +     ++  I   D+    N+++TY +  V  P     F L++  G + +   L  ++    +LH+ ASD  GN  L+++
Sbjct:  585 VHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGL----ITLAKLLDRETQD--NYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDN--------IVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSS------SILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTG----ALSLTKLIDYGNSARS-YTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL-RNGGKIFIKSKLDREDIEEYNLKVIAIDH---GTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKE-NEPVATYLGAVSASDSDEGSNGHVTY-----RFDTQVAQ---FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSP--KFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI--VAGP---KAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETI 1207          

HSP 4 Score: 162.925 bits (411), Expect = 2.185e-40
Identity = 178/709 (25.11%), Postives = 302/709 (42.60%), Query Frame = 1
Query:  307 VGDSDPLKAQNCK-LSLTVFVPKEHWINV------EITIEDINDHVPVFEPNWKVIEIDERVSINFETPLAL---AKDLDIGPNNIQEYKL--EQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIF---------------------------MKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFF-MRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQN-GKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKP-YLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLL--TDKGNPPQTKEEIILVNIIDKNDNAPI-----WKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTI 2280
            V  +D L  ++ K   L +    + W+++      +I + D ND+ P F P+  + ++ E     F+    +   A D+D G N    Y +     + +F ++     I    L   LD +     ++ L++R  D G P +  + ++ + V D NDNPP+F                            +S    N+   +  G  I RV ATD+DSG    I Y    + S+         +KI  ++G I   R +D ++  SF  + ++A D G  P      ++III          + +PK ++P     +PEN      +  + VTD   G   G++S  I   E     ++   G    + S+  N   D E +  F + ++  D   P       + I +SDVN+  PV   +      SE + +G     V   DKD+  N  + F IQ   +K  F+IDRK G I+ +  LD E I  + + +   D  +      T  S+T+ V+D NDN P + +     + ++E N  +  +++++ A D D G+NA + +T+           + +F I++ +G L    + D E   VY+ SL +  TD GNPP +    I+VN+ D+++  P      +KF  P N  I        G  +  + A D D+ +   V +      P   SN  K++ T G I
Sbjct: 2019 VASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGA-FKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKL---LDRETT--ASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQID------YKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIII----------TREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNI---ENSNYFRI---GQRSGVISV--NKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATD--EGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLE-NLPLNSRLYEINATDRDSGANARLSFTVI------GGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKI--------GDFVGQVTATDRDSGDQGRVFFVF--YNP--TSNALKMNATTGII 2676          

HSP 5 Score: 151.754 bits (382), Expect = 5.394e-37
Identity = 165/628 (26.27%), Postives = 264/628 (42.04%), Query Frame = 1
Query:  580 YEPPF--ILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIF--RVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTP------QISIKPKPDIPDCMLSL-PENNDKNAYI----------GLIIV----TDGDIGQNGKVSC---VINKDEEKILLKVSNNGDDRMIYSIIANHTFD-REAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQG--TIQVT---EFLTLKMFVLHLQASDNGNTPLKS 2361
            Y  PF  ++++     LDY+    KN+ L L A   G     G+  L I V D NDN P F  S  +  ++E T      F  +V ATD DSG  G + Y ++          E   F I   +G I   + LD + T SF + +   DSG  P      +K+++ D+ND+ P      +++I+        + S+   + DK + +          G+ I+    TD D G N ++     + N D+  I  K+     D     I A  T D R  +S   I +   D G PP      + I I+      P          + E+  +G    TV V D  A   +  +     N  YF I ++ G I +   LD E   R+++ +   D+            + VS  D ND KP    S  +    EG   V   +  V A D D G+N  V + I     +        F I+RK G +    +LD E    + +S+  TD+G+PP   +  + + ++D NDN P+++ P P ND+  L  +    ++   I+A D D+  NA +++T+          +F + +  G  T  +T   E   +  + L ++A+D GN PL S
Sbjct: 2009 YVDPFTGVISVASADALDYE--STKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIW-------TGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQ--IDYKI-----DADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVS--DVNDEKPVFGQSGYMAQWSEG-IPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGS------FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGP-NDVQVLENLPLNSRLYE-INATDRDSGANARLSFTVIG---GTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSS 2602          

HSP 6 Score: 135.576 bits (340), Expect = 4.525e-32
Identity = 186/759 (24.51%), Postives = 305/759 (40.18%), Query Frame = 1
Query:  106 VKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVF-EPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQP-SDIFGLNYEPPFILNLYLKSKLDY-DVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQ-ISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATR--NISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDI--GSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVT-----EFLTLKMFVLHLQASDNG 2343
            + E  P N  +  IK     S  NS    +   + +  + +F+I  +TG       IDRE I  +        LK +    + T      +   ++I I+D+ND+ P F   N   +  DE    NF+     A D D G     EY++  P +  F L+ +      L L   LDY DVP    Y+L + A D G P    +Q  ++ V D NDNPP F +  ++  VSE    G+ + +V A DRDSG    + Y +          VE+  F I K+SG I+ N  LD +   ++F+ + A        +    ++I + D ND+ P+ IS       P   L +PEN+     I  + V D D G N KV   I          +      R    +      DRE ++ + +S+  KD   P  +    I I I D N++PPV   ++    ISE    G     +   DKD+    NI + +      +Y SID + G +   +  +      Y    + +D  Q          + + + D N++ P    +   ++I   N      +  V A D D    +N  V Y ++  K    +     F +    G +             + + ++  D G+PP     I+ + I +  D+ P +   +P    +++ + +  G  I T+ A  +    +A VTY++           F +    G I V      ++ + K F LHL A+  G
Sbjct: 1339 IYENVPINTNVTTIKAHDDDSGLNSR--IWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYS-------LKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDE--PFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGV---LKLIGSLDYEDVP---QYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI-------PSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFIS-------PVVTLKVPENSPAR-LIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIG-----RSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVY-SIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQ--DPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFP-NTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSL-----FVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPAR--VSIPENSKVGSYITTVRARAS---SDAQVTYSIISGN---KGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQG 2043          

HSP 7 Score: 92.0485 bits (227), Expect = 9.887e-19
Identity = 94/374 (25.13%), Postives = 158/374 (42.25%), Query Frame = 1
Query:  121 PPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSF----KEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSD--IFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIF-MKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTP--SFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV 1215
            P N ++G      R+++  +     +I  + E  NYFRI +++G   V   +D ET   F      + D+ P K         V VP      V I + D+ND  PVF  +  + +  E + +        A D D G N    + ++   D   F ++ +   I     +  LD++    K + + +RA D G P       ++IRV D NDNPP+F +     V V E   + S ++ + ATDRDSG    +++ +               F I K SG +  N   D + T    + + ++A D+G  PL     + + + D +++ P  +        D    +P N     ++G +  TD D G  G+V
Sbjct: 2314 PENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKP--------VRVP------VYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRT---QRALDHETI--KTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQG-------LFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRM------DYKFDVPGNAKIGDFVGQVTATDRDSGDQGRV 2655          

HSP 8 Score: 75.485 bits (184), Expect = 1.219e-13
Identity = 72/274 (26.28%), Postives = 124/274 (45.26%), Query Frame = 1
Query: 1597 GKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTT---SFSLTVSVMDANDNKP-YLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFA-------LTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQI---------IATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTI---QVTEFLTLKMFVLHLQASDNGNT 2349
            G I  K+ LDREK+  Y + IV         +F+T   S+++ V V D NDN P ++  +S  + + E +   ++K+    A+D+D GSN+   YTI      N     K+ +    +G+L+A          +DRE+ D Y +++  +D GNP       + + + D NDN P              + ++Y G I         I  + A D D   NA + Y++     P    IF +H T G I      ++   + +++ ++A D G++
Sbjct:   12 GVITTKTVLDREKVSAYNLTIV---------EFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKL---IAVDSDFGSNSTQSYTIVSGNVGNVF---KLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKP------------EFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDP--QAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSS 256          

HSP 9 Score: 66.2402 bits (160), Expect = 7.988e-11
Identity = 68/273 (24.91%), Postives = 112/273 (41.03%), Query Frame = 1
Query:  112 EESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETI----CSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFE-PNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKK 900
            E  P   ++ N+    + S  N   + F I   ++K + F I  KTG       +D ETI     S +   +  P              P    ++V I + D+ND+ PVF  P    +++ E + +N       A D D G N    +       + G   +  F+++     L      DY+      YSL ++A D G+P    +  + + V D ++  P F + +Y  +V     +G  + +V ATDRDSG  G + +  Y   SN  K
Sbjct: 2418 EGIPVGTIVVNVSAADKDSGANGR-VWFAIQSGDDKGS-FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSP--------------PMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFT------VIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALK 2668          
BLAST of protocadherin-9 vs. Ensembl Nematostella
Match: EDO35413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL0])

HSP 1 Score: 206.453 bits (524), Expect = 4.682e-54
Identity = 148/506 (29.25%), Postives = 240/506 (47.43%), Query Frame = 1
Query:  712 LSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNI----SFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFS-LTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYT 2214
            ++I V D NDN P+F   E+ V+++E    G+ +  V ATD D+G    ++Y  Y     +K       F I  +SGRI      D +    + + + A D G        V+ + + D ND++P+      P +   +  + E+    A IG +  +D DIG+N +++  I   E+         G+      I      DRE  + ++I +T  D G PPLS S  I + + D N+H PV  ++I  V I E+ S G E  T++  D D+  N     +F+   + N   F+I+   G+++   NLDRE   R+ + ++  D   LG     S + +TV + D NDN+P    S     + EG   V+  I  V A D DIGS+  V Y I   +      +  +F IN   G +     LDRE    Y + +  TD G+P  + E  ++VN++D+ND+AP++   +P    + + + T  G  +  + A D D   NA+VTY+
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVSYATYGGSHGNK-------FAIDASSGRIYTTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKF-----PAL-HYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPEKATFSMNPVTGE------ITVGQRLDREGAN-YSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNS--FTINSITGRLRTARNLDRETTPRFTLEVLAYD---LGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGV--VESNIVTVVAEDRDIGSDGSVTYCITQGR------EGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVF---TPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYS 470          

HSP 2 Score: 178.333 bits (451), Expect = 2.648e-45
Identity = 184/737 (24.97%), Postives = 309/737 (41.93%), Query Frame = 1
Query:  223 NYFRIVEKTGEFYVAGRIDRETICSFK-EVGDSD---PLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSD-IFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDN-DIGSNAVVEYTINYIKYRNEIIK---EKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWK---FPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM---FVLHLQASDNGNTPLKSVPTT-LTIR 2385
            N F I   +G  Y  G  DRET   +   V  SD   P K+  C               V +T+ D ND+ P F     V +I E  ++        A D DIG N    Y +  P    F +N   P    + +  +LD +   G NYS+ + A D G P      ++++ V+DYND+ P+F+     V + E  + G+EI  + A D DSG+   I Y      SN+        F I+  +GR+   R LD + TP F + + A+D G         + +++ D+ND+ P  ++       +    + E+N     I  ++  D DIG +G V+  I +  E  L  ++ N       +I      DRE +S +T+ +   D G P LS+   + + + D N+H PV       V + ED   G     V   D D   N       T +    +++R     K  S L    I      + V         +    ++ + V+D ND+ P  + S  ++  ++ + G    I +V A+D  D G NA+V Y         E I       F +  + GE+   +SL  +    Y I +  +D G P  +    + V + ++N + P++    + + +N+ I +      G  + T+ A D D   N  ++Y +       +   F +  T G++ V++ L  +    + L++ A+D G  P  S  T  +T+R
Sbjct:   61 NKFAIDASSGRIYTTGTFDRETKDDYSINVTASDHGNPSKSSTCV--------------VLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPEKATFSMN---PVTGEITVGQRLDRE---GANYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNS-------FTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEY--AAEVSEGVVESN-----IVTVVAEDRDIGSDGSVTYCITQGREGGLFVINEN-----TGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADV----TYSTGMITLNRAI-AFKPFSALPNPNIYN----LTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQ-DAGSGVSIGRVEAVDKFDYGPNALVRY---------EAISGNGTGRFRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAV------GSALLTVTATDRDFGRNGEISYDIIAGN---SQEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLR 730          

HSP 3 Score: 163.31 bits (412), Expect = 1.140e-40
Identity = 154/584 (26.37%), Postives = 255/584 (43.66%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILN-----LYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVT----DGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIAN----HTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKD--ATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTK-EEIILVNIIDKNDNAPIW 2091
            V IT++D+ND+ PVF  +   + I E V          A D D G N    Y        +G ++   F ++     +Y     D +  D  +YS+ + A D G+P +     + + V D NDN P F    Y+ +++E  AVG+ I  V A+D D G    + Y +   VS  K +     F ++  +G I + ++LD +   ++ +R+ A D G  PL     + +I++D NDH P         I    +      D+NA  G  I+T    DGD G N ++         +      N+ +   I SI          DRE    FT+ +   D G P   +   + + + DVN++ PV   +     +SE V +     TV  ED+D  +  ++++ I +      F I+   G I I + LDRE   +Y + +   D        ++   + V+V+D ND+ P    ++  + + E + G    + +V A+D D+GSNA V Y+   I   N  I  K F+    N  ++ LT   R  Y              PP  K +  I + ++D ND+AP++
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVSYA------TYGGSHGNKFAIDASSGRIYTTGTFDRETKD--DYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSI---VSPEKAT-----FSMNPVTGEITVGQRLD-REGANYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVF----LSHIGTVFI------DENASPGTEIITLQAVDGDSGVNAEI---------RYAFVTGNSNNSFTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGV-VESNIVTVVAEDRDIGSDGSVTYCITQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGS--PALSSEADVIVNVLDQNDHAPVFTPATLTVKVQE-DTGSGTTVIKVSAVDGDVGSNADVTYSTGMITL-NRAIAFKPFSA-LPNPNIYNLTVRARNIY--------------PPHYKADAAIQIEVLDTNDHAPVF 528          

HSP 4 Score: 158.303 bits (399), Expect = 4.852e-39
Identity = 160/613 (26.10%), Postives = 268/613 (43.72%), Query Frame = 1
Query:  388 VEITIEDINDHVPVFEPN----WKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENND-KNAYIGLIIVTDGD-IGQNG-KVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTS---QTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVED--NKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDND 2184
            ++I + D NDH PVF  +    + V +    VSI     +      D GPN +  Y+    +   G     P    + + S L  DV   K Y + +RA D G P       + + V + N +PP+F K+ Y  + +E  AVGS +  V ATDRD G  G I+Y +    S         +F I   +G + +++ LD +   ++ + + A D G+ P    A ++I + D+ND+ P  S    P    C L+  EN   ++  +  +  TD D  GQ   + S +    ++K ++       D     I A   FD E      + I  KD G  P  T+    ++ I I+ VNE  PV   ++    ++E+  IG     V   DKD   +  + + +  + N+  F +D   G + +  +LD E+     + ++ ++     +        ++ V+V DAND  P  L S    ++ EG+  +   +  V A+D+D    ++  Y I+     N  + + V    R   EL      DRE    Y++++  TD G PP T    ++V + D NDN P     +P   I  +T+    G  + T++A D D
Sbjct:  514 IQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGR---VEAVDKFDYGPNALVRYEAISGNGT-GRFRVAPETGEVLIASSLRDDV--NKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGNSQE-------YFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFS----PIEYRCELA--ENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDKFVI-------DERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDAND-PPRFLKSVYSAHVTEGSR-IGHVVTNVTAVDDDSDIRSI-RYGISAGNTGNAFVMDAVTGFVRTAAEL------DREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHL---TPLPCIGRVTENKPQGTQVMTLNAEDPD 1088          

HSP 5 Score: 157.147 bits (396), Expect = 1.066e-38
Identity = 192/773 (24.84%), Postives = 322/773 (41.66%), Query Frame = 1
Query:  100 YSVKEESPPNYLIGNIKK-DSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNL---YLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCM-LSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMI----YSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINK---IYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEG-NYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQ-IIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVT-EF---LTLKMFVLHLQASDNGNTPLKSV 2364
            + + E++     IG +   D+ + E  +  LT+ I   E  K  F +   TGE  V  R+DRE        G +  ++     L      P    + + + ++D NDH PVF  +   + IDE  S   E     A D D G N    Y       + G N    F +N     L++  + D      ++L + A D G P +     +++ + D NDN P+F  SEY   VSE   V S I  V+A DRD G  GS+ Y +        +  E   F I++N+G I +  KLD +    + +R++A D G   L  +A + + + D NDH P  +       P  + + + E+      +  +   DGD+G N  V+         I L       +R I    +S + N        +++ +++  ++   P       I+I + D N+H PV   ++  +   +D   G     VE  DK      + +  E I+      F +  + G++ I S+L  +    Y I +   D  Q   + + +  + V V + N + P    S  V    E  +  V   +  V A D D G N  + Y I           ++ F I   NG L+    LD E  + Y +++  TD G  P+T    + + + D NDN P++   SP      L + T P   ++ ++ A D D     +V Y++         + F + E  G I+ T EF   +T+  F++ + A D G +P ++ 
Sbjct:  127 FDIAEDAAVGASIGTVSASDADIGE--NARLTYSIVSPE--KATFSMNPVTGEITVGQRLDRE--------GANYSIRVTATDLGTP---PLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAF-----VTG-NSNNSFTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEG-VVESNIVTVVAEDRDIGSDGSVTYCI-------TQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFT-------PATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVT----YSTGMITL-------NRAIAFKPFSALPN-------PNIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQ--PKMSDTAGVYVEVTERNLHPPVF--SKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGN------SQEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVF---SPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGS---GKDKFVIDERTGEIRATVEFDFEVTMSSFLM-IAAKDEGLSPQRTA 828          

HSP 6 Score: 140.584 bits (353), Expect = 1.411e-33
Identity = 189/749 (25.23%), Postives = 314/749 (41.92%), Query Frame = 1
Query:  229 FRIVEKTGEFYVAGRI-DRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNL-----YLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIF-RVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQ---AVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV-SCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQ----PPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDA-TRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQ-FTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSN-AVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSG 2421
            FR+  +TGE  +A  + D      +  V  SD  +    K+S T        + VE+T  + N H PVF         +E +++        A D D G N    Y      DI   N +  F + L     Y+   LDY+    +NYSL + A DGG   +  +  + I + D NDN P+F   EY   ++E T   S +   V ATDRD     S+ Y +       K       F I + +G I    + D ++T S F+ + A D G SP       A + I+I  +N+  P + ++          ++ EN      +  +  TD D G +G V   ++  D ++     SN G      ++  +   D E   + T+ +  K+  Q    P      TI + ++D N+ PP    ++   +++E   IG     V   D D+  R+I + I        F +D   G ++  + LDRE I  Y + +   DN   GT   T + +L V++ D NDN P+L     +  + E N     ++  + A D D+  N    +Y+I+   Y +       F +N  +G +  + SLDREK D Y IS+ +TD      +     ++++ D+NDN P     + ++  ++  +  + G ++A +   D D  +      T   + PP N NIF        +    +     F L +  SD     L +V   +T+R+      +L  G
Sbjct:  577 FRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQP---KMSDTA------GVYVEVT--ERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISY------DIIAGNSQEYFGIGLTNGSLYVSKPLDYE--HQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDK-------FVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLP-VFVQSV-----FTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDSNTG------TLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDAND-PPRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDSDIRSIRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDN---GTPPMTGNATLVVTLDDINDNPPHLTPLPCIGRVTE-NKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDYGS-------FRLNVSSGVVSTVKSLDREKQDAYNISIKVTDARG--LSAVNFCMIHVEDQNDNRPKA---TSRDVYVHTFEGKFLGGVVADVRPDDPDIDD----LMTCALLNPPQN-NIFSFPRGNCELSSLAYSQDARFDLSVNGSDG----LGAVTYLITLRFLGYTETTLQQG 1261          
BLAST of protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 279.641 bits (714), Expect = 1.524e-78
Identity = 218/771 (28.27%), Postives = 358/771 (46.43%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKI-TYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + I L   I+Q+L Y ++EE   N LIGNI KD  +S  +     S +L +++          R++  TGE F  + RIDRE +C      D++      C   + V V P +++  I ++I ++D ND+ P+F      I I E   IN    +  A D D GPN++ +Y+L      FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V D NDN P+F +++  V++ E + +G+ + ++ ATD D G    I+Y     VS   K +    F ++  SG I + R LD + T    + + A D   SP   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I KD    L  V +N      Y +  +   D E    +   I   D G+P L+ +  + + + D N++PP+    + E+ + E+        T+   D+D+ +N   + Q   N  +F +DRK G +      DRE  DR++  +   DN     Q     ++ V+V+D NDN P   ++     + E N      +  +   D+D G NA +  +I        +   + F ++  +G + +  S DRE+   Y   +   D G PP +    + +N+ID NDN PI  +P P N    L  + + PG ++A + A D+DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLKDFYLLGSLLACIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAE------CSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRL----FALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP--ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQ-----YLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQ--AQAAVIVTVLDENDNNPKFTHNHFQFFVSE-NLPKYSTVGVITVTDSDAGENAAISLSI--------LNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 738          
BLAST of protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 278.87 bits (712), Expect = 1.525e-77
Identity = 218/771 (28.27%), Postives = 358/771 (46.43%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKI-TYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + I L   I+Q+L Y ++EE   N LIGNI KD  +S  +     S +L +++          R++  TGE F  + RIDRE +C      D++      C   + V V P +++  I ++I ++D ND+ P+F      I I E   IN    +  A D D GPN++ +Y+L      FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V D NDN P+F +++  V++ E + +G+ + ++ ATD D G    I+Y     VS   K +    F ++  SG I + R LD + T    + + A D   SP   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I KD    L  V +N      Y +  +   D E    +   I   D G+P L+ +  + + + D N++PP+    + E+ + E+        T+   D+D+ +N   + Q   N  +F +DRK G +      DRE  DR++  +   DN     Q     ++ V+V+D NDN P   ++     + E N      +  +   D+D G NA +  +I        +   + F ++  +G + +  S DRE+   Y   +   D G PP +    + +N+ID NDN PI  +P P N    L  + + PG ++A + A D+DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLKDFYLLGSLLACIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAE------CSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRL----FALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP--ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQ-----YLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQ--AQAAVIVTVLDENDNNPKFTHNHFQFFVSE-NLPKYSTVGVITVTDSDAGENAAISLSI--------LNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 738          
BLAST of protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 278.87 bits (712), Expect = 1.964e-77
Identity = 218/771 (28.27%), Postives = 358/771 (46.43%), Query Frame = 1
Query:   22 ELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKN-----SESLTFQIYEDEEKKNYFRIVEKTGE-FYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV-PKEHW--INVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNY----EPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKI-TYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTE 2292
            +L  FY+     + I L   I+Q+L Y ++EE   N LIGNI KD  +S  +     S +L +++          R++  TGE F  + RIDRE +C      D++      C   + V V P +++  I ++I ++D ND+ P+F      I I E   IN    +  A D D GPN++ +Y+L      FGL+     E      L ++  LD +  D   Y + ++  DGG P +     L + V D NDN P+F +++  V++ E + +G+ + ++ ATD D G    I+Y     VS   K +    F ++  SG I + R LD + T    + + A D   SP   +A + I + D+ND+ P I ++      +  + L E +  N  I LI V+D D   NGKV C I KD    L  V +N      Y +  +   D E    +   I   D G+P L+ +  + + + D N++PP+    + E+ + E+        T+   D+D+ +N   + Q   N  +F +DRK G +      DRE  DR++  +   DN     Q     ++ V+V+D NDN P   ++     + E N      +  +   D+D G NA +  +I        +   + F ++  +G + +  S DRE+   Y   +   D G PP +    + +N+ID NDN PI  +P P N    L  + + PG ++A + A D+DT  NA + YT+       N  +F++    G I + E
Sbjct:    2 DLKDFYLLGSLLACIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAE------CSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKD--TYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRL----FALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP--ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQ-----YLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQ--AQAAVIVTVLDENDNNPKFTHNHFQFFVSE-NLPKYSTVGVITVTDSDAGENAAISLSI--------LNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGN---NKGLFRIDPVTGNITLEE 738          
BLAST of protocadherin-9 vs. Ensembl Medaka
Match: ENSORLT00000005206.2 (pep primary_assembly:ASM223467v1:10:14854024:14859556:-1 gene:ENSORLG00000030362.1 transcript:ENSORLT00000005206.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.929 bits (681), Expect = 1.947e-75
Identity = 204/702 (29.06%), Postives = 344/702 (49.00%), Query Frame = 1
Query:   16 MNELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV--PKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGL----NYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQE-TINKI----YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLL-----NSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIID 2067
            MN+ +  ++ L S  L  +  Q+S    YS+ EE P   L+GNI +D  L  K   S   +IY       Y  +  + G   V  RIDRE +C+   +          C L   + +  P EH+  V I I DIND+ PVFE      +I E   I  +  L  A DLD+G N++Q Y L +P+D F +    N      + + L+  LD +    +  SL+L A DGG+P   G   + + V D NDN P+F +  Y   V+E +  G+ +  V A+D D G    I Y +  ++ N +++     F +++ +G+I L   +D + +  F + L A DSG   L     + + ++DIND+ P+I+I  K ++      + EN   N  + +I + D D G+NG+V C IN  E   L+  +NN     IY+++ +   DRE  S + I++TC D G P LS+S T+ + ISDVN++ PV   +  E  I E+ + G   FTV+  D D  +N  +S+++++ ++N +    Y S+    G I    + D E+I  +  C+  +D        +++ ++ + + D NDN P +L       S V  ++  +  V   + +V A+D D G NA + Y +     R       +F +  +NGE+  +  +  +     ++++++ D G P ++   I+ V + D
Sbjct:    8 MNQRVLLFVCLVS--LASVLGQVS----YSIPEEMPKGSLVGNIAQDLGLEMKRLISGKAKIYS-RNSGEYMELNRERGVLLVKERIDREALCAETAL----------CALHFQIILENPMEHY-TVNIQITDINDNAPVFEKTKMNFKISESAVIGAKFVLERAVDLDVGTNDLQNYVL-KPADHFIVKPQSNTHSQRSVEMVLQKPLDRE--KEEQISLVLTAVDGGEPQMSGTMMIVVTVLDVNDNAPVFTQQTYKATVTENSPKGTVVAAVTASDADQGSNSRITYSITNTLDNVRRA-----FNVNEENGQICLIDDVDFEKSKHFEINLLASDSGG--LTDSCKVLVDVKDINDNKPEINIMSKTNV------ISENAQVNTVVTMINIDDLDSGENGRVECSINDKEPFSLISSTNN-----IYNLLTDSELDRETASEYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPMSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGG--SPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKATDR------ALFEVGSQNGEIRTVRQVTEKDLLKQRLTVIVEDNGQPSRSATVIVNVAVAD 662          

HSP 2 Score: 146.747 bits (369), Expect = 1.342e-35
Identity = 166/648 (25.62%), Postives = 285/648 (43.98%), Query Frame = 1
Query:  703 HQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINY-------FMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETIN-KIYFSIDRKFGKIK---IKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNY-GVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP---GQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTI----QVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRY---WPMETGSLLSG-------HDSVSFNLIVTMAVVTCLI--CLSLLIAIVVVRRRQNYTCSHSQSP 2553
            H  ++I++ D NDN P+F K++    +SE   +G++     A D D G     NY       F+ +  SN            S+ S  ++L + LD +      + L A D GE  + G  ++ + + D+ND+ P  + +          ++ EN+ K   +  +  +D D G N +++  I    + +    + N ++  I  I      D E    F I++   D G   L+ S  + + + D+N++ P IN   K   ISE+  +      + ++D D+  N    ++ +IN K  FS+      I      S LDRE    Y I +   D        ++S +LT+ + D NDN P    SS    I+E N  GV   IF V A D D   NA V Y +      N +      +++  +G + A+ S D E+   ++  +   D G+PP +    + + I D+NDN P   +P      +    +      G ++  + A D D+ +NA ++Y L K     +  +F++    G I    QVTE   LK   L +   DNG  P +S    + +     +P E  S  +        +D+++F L++ +AVV+ L   CL ++I++ + R RQ+    HS  P
Sbjct:  113 HYTVNIQITDINDNAPVFEKTKMNFKISESAVIGAKFVLERAVDLDVGTNDLQNYVLKPADHFIVKPQSNTH----------SQRSVEMVLQKPLDREKEEQISLVLTAVDGGEPQMSGTMMIVVTVLDVNDNAPVFTQQTY------KATVTENSPKGTVVAAVTASDADQGSNSRITYSITNTLDNVRRAFNVNEENGQICLI---DDVDFEKSKHFEINLLASDSGG--LTDSCKVLVDVKDINDNKPEINIMSKTNVISENAQVNTVVTMINIDDLDSGEN--GRVECSINDKEPFSLISSTNNIYNLLTDSELDRETASEYNITVTCSDEGV--PSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVS--IFTVKATDADWKQNARVSYILEDSSV-NGVPMSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGGSPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKAT---DRALFEVGSQNGEIRTVRQVTEKDLLKQR-LTVIVEDNGQ-PSRSATVIVNVAVADSFP-EVLSEFTDFPHDKDYNDNLTFYLVLALAVVSFLFITCLVVIISVKIYRWRQSRILYHSSLP 726          

HSP 3 Score: 120.168 bits (300), Expect = 2.901e-27
Identity = 132/495 (26.67%), Postives = 221/495 (44.65%), Query Frame = 1
Query:  916 FFKISKNSGRIILNRKLD--AKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKI--YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNG--ELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTL--TKVEPPLNSNIFKLHETQGTIQVT---EFLTLKMFVLHLQASDNGNTPLKS 2361
            + ++++  G +++  ++D  A    +    L      E+P M    + I I DIND+ P    K K +       + E+    A   L    D D+G N   + V+   +  I+   SN    R +  ++     DRE E   ++ +T  D G+P +S +  I + + DVN++ PV      +  ++E+   G     V   D D   N  I++ I  T++ +   F+++ + G+I +  ++D EK   + I ++  D+  L    T S  + V V D NDNKP +   SK  N+I  N  V   +  +   D D G N  VE +IN         KE    I+  N    L   + LDRE    Y I++  +D+G P  +    + + I D NDNAP+++  S +  I+   +   PG  I T+ A D D  +NA V+Y L  + V     S+   +    G I      ++  +K F   ++A D G+ PL S
Sbjct:   71 YMELNRERGVLLVKERIDREALCAETALCALHFQIILENP-MEHYTVNIQITDINDNAPVFE-KTKMN-----FKISESAVIGAKFVLERAVDLDVGTNDLQNYVLKPADHFIVKPQSNTHSQRSV-EMVLQKPLDREKEEQISLVLTAVDGGEPQMSGTMMIVVTVLDVNDNAPVFTQQTYKATVTENSPKGTVVAAVTASDADQGSNSRITYSITNTLDNVRRAFNVNEENGQICLIDDVDFEKSKHFEINLLASDSGGL----TDSCKVLVDVKDINDNKPEINIMSKT-NVISENAQVNTVVTMINIDDLDSGENGRVECSIND--------KEPFSLISSTNNIYNLLTDSELDRETASEYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIV---ENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPMSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGGSPPLSS 541          
BLAST of protocadherin-9 vs. Ensembl Medaka
Match: ENSORLT00000044497.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 268.855 bits (686), Expect = 6.454e-75
Identity = 207/700 (29.57%), Postives = 339/700 (48.43%), Query Frame = 1
Query:   16 MNELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFV--PKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYE--PPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQE-TINKIYFSIDRKF----GKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLL-----NSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIID 2067
            MN+ +  ++ L S  L  +  Q+S    YS+ EE P   L+GNI +D  L  K   S   +IY       Y  +  + G   V  RIDRE +C+   +          C L   + +  P EH+  V I I DIND+ P FE       I E   I  +  LA A+D D+  N +Q Y+L +P++ F LN    P    N+ +  +   D    +  SL+L A DGG+P   G   + + V D NDN P+F +  Y V V+E +  G+ +  V A+D D G    I Y +   V N +       F+I+K +G++ILN K+D + + SF + + A D G   L     + + + DIND+ P+I+I  K +I      +PEN   N  + +I + D D G NGKV C++N++   +L    NN      YS+  +   DRE  S + I++TC D G P LS+S T+ + ISDVN++ PV   +  E  I E+ + G   FTV+  D D  +N  +S+++++ ++N +  S         G I    + D E+I  +  C+  +D        +++ ++ + + D NDN P +L       S V  ++  +  V   + +V A+D D G NA + Y +     R       +F +  +NGE+  +  +  +     ++++++ D G P ++   I+ V + D
Sbjct:   21 MNQRVLLFVCLVS--LASVLGQVS----YSIPEEMPKGSLVGNIAQDLGLEMKRLISGKAKIYS-RNSGEYVELNRERGVLLVKERIDREALCAETAL----------CALHFQIILENPMEHY-TVNIQITDINDNAPAFEKTTVEFRISESAIIGAKFELATAEDSDVENNAVQRYEL-KPTNNFDLNLHSNPDGTKNVEMVLQKPLDREKEEQISLMLTAVDGGEPQMSGTMMIVVTVLDVNDNAPVFTQQTYKVTVTENSPKGTVVAAVTASDADQGSNSRITYSITNRVGNFRN-----LFEINKENGKVILNEKIDYEKSKSFQITVGATDDGG--LTASCKLIVDVLDINDNKPEINIMSKSNI------IPENAKLNTVVTMIHIEDLDSGNNGKVQCLMNENIPFLLKSTINN-----FYSLQTDSELDRETASEYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPVSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGG--SPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKATDR------ALFEVGSQNGEIRTVRQVTEKDLLKQRLTVIVEDNGQPSRSATVIVNVAVAD 675          

HSP 2 Score: 144.821 bits (364), Expect = 9.717e-35
Identity = 166/663 (25.04%), Postives = 282/663 (42.53%), Query Frame = 1
Query:  703 HQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFM---------YESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSI-------IANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDA----------TRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNY-GVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYP---GQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTI----QVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRY---WPMETGSLLSG-------HDSVSFNLIVTMAVVTCLI--CLSLLIAIVVVRRRQNYTCSHSQSP 2553
            H  ++I++ D NDN P F K+     +SE   +G++     A D D        Y +           S  +  K+VE            ++L + LD +      + L A D GE  + G  ++ + + D+ND+ P  + +         +++ EN+ K   +  +  +D D G N +++  I           +  G+ R ++ I       I N   D E    F I++   D G   L+ S  + + + D+N++ P IN   K   I E+  +      + +ED D+            NI FL++ TIN  Y         ++  S LDRE    Y I +   D        ++S +LT+ + D NDN P    SS    I+E N  GV   IF V A D D   NA V Y +      N +      +++  +G + A+ S D E+   ++  +   D G+PP +    + + I D+NDN P   +P      +    +      G ++  + A D D+ +NA ++Y L K     +  +F++    G I    QVTE   LK   L +   DNG  P +S    + +     +P E  S  +        +D+++F L++ +AVV+ L   CL ++I++ + R RQ+    HS  P
Sbjct:  126 HYTVNIQITDINDNAPAFEKTTVEFRISESAIIGAKFELATAEDSDVENNAVQRYELKPTNNFDLNLHSNPDGTKNVE------------MVLQKPLDREKEEQISLMLTAVDGGEPQMSGTMMIVVTVLDVNDNAPVFTQQ------TYKVTVTENSPKGTVVAAVTASDADQGSNSRITYSI----------TNRVGNFRNLFEINKENGKVILNEKIDYEKSKSFQITVGATDDGG--LTASCKLIVDVLDINDNKPEINIMSKSNIIPENAKLNTVVTMIHIEDLDSGNNGKVQCLMNENIPFLLKSTINNFY--------SLQTDSELDRETASEYNITVTCSDEGV--PSLSSSVTLTLQISDVNDNAPVFERSSYEAYIVENNTPGVS--IFTVKATDADWKQNARVSYILEDSSV-NGVPVSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGGSPPLSSNVTVKIQIQDQNDNPPQVLYPVQTAGSVVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKA---TDRALFEVGSQNGEIRTVRQVTEKDLLKQR-LTVIVEDNGQ-PSRSATVIVNVAVADSFP-EVLSEFTDFPHDKEYNDNLTFYLVLALAVVSFLFITCLVVIISVKIYRWRQSRILYHSSLP 739          

HSP 3 Score: 113.62 bits (283), Expect = 4.390e-25
Identity = 126/496 (25.40%), Postives = 213/496 (42.94%), Query Frame = 1
Query:  916 FFKISKNSGRIILNRKLD--AKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRN--ISFLIQETINKI--YFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFAL---TSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTL--TKVEPPLNSNIFKLHETQGTIQVT---EFLTLKMFVLHLQASDNGNTPLKS 2361
            + ++++  G +++  ++D  A    +    L      E+P M    + I I DIND+ P        +       + E+    A   L    D D+ +N  V     K      L + +N D      ++     DRE E   ++ +T  D G+P +S +  I + + DVN++ PV      +V ++E+   G     V   D D   N  I++ I   +      F I+++ GK+ +   +D EK   + I +   D+  L    T S  L V V+D NDNKP +   SK  NII  N  +   +  +   D D G+N  V+  +N         +   F +       ++L   + LDRE    Y I++  +D+G P  +    + + I D NDNAP+++  S +  I+   +   PG  I T+ A D D  +NA V+Y L  + V     S+   +    G I      ++  +K F   ++A D G+ PL S
Sbjct:   84 YVELNRERGVLLVKERIDREALCAETALCALHFQIILENP-MEHYTVNIQITDINDNAPAF------EKTTVEFRISESAIIGAKFELATAEDSDV-ENNAVQRYELKPTNNFDLNLHSNPDGTKNVEMVLQKPLDREKEEQISLMLTAVDGGEPQMSGTMMIVVTVLDVNDNAPVFTQQTYKVTVTENSPKGTVVAAVTASDADQGSNSRITYSITNRVGNFRNLFEINKENGKVILNEKIDYEKSKSFQITVGATDDGGL----TASCKLIVDVLDINDNKPEINIMSKS-NIIPENAKLNTVVTMIHIEDLDSGNNGKVQCLMN---------ENIPFLLKSTINNFYSLQTDSELDRETASEYNITVTCSDEGVPSLSSSVTLTLQISDVNDNAPVFERSSYEAYIV---ENNTPGVSIFTVKATDADWKQNARVSYILEDSSVNGVPVSSYVSVSADSGVIHAVRSFDYEQIKDFRFCVKAQDGGSPPLSS 554          
BLAST of protocadherin-9 vs. Planmine SMEST
Match: SMESG000023091.1 (SMESG000023091.1)

HSP 1 Score: 2102.79 bits (5447), Expect = 0.000e+0
Identity = 1047/1047 (100.00%), Postives = 1047/1047 (100.00%), Query Frame = 1
Query:   16 MNELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRRQNYTCSHSQSPSNIMFAINTDQNRSQFITLRNDPYYLDPLAGDASVLSNKWFNQYDSKNDYSLSLQRNKMFLSDFQASSLGEPLLQSVPSMHLNSPRDTLIRKSFRTANXXXXXXXXXXXXXXXXXXQFHSPFMKNNECQMNSQNSNYYSTFTSSDGKQFVDKTTPYYPKMSLMSSRSIYGYHHTDSLASNTNDSTETKNNEYVCLVNSQKQ 3156
            MNELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRRQNYTCSHSQSPSNIMFAINTDQNRSQFITLRNDPYYLDPLAGDASVLSNKWFNQYDSKNDYSLSLQRNKMFLSDFQASSLGEPLLQSVPSMHLNSPRDTLIRKSFRTANGEIDGSSGDSGHGISEEDQFHSPFMKNNECQMNSQNSNYYSTFTSSDGKQFVDKTTPYYPKMSLMSSRSIYGYHHTDSLASNTNDSTETKNNEYVCLVNSQKQ
Sbjct:    1 MNELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRRQNYTCSHSQSPSNIMFAINTDQNRSQFITLRNDPYYLDPLAGDASVLSNKWFNQYDSKNDYSLSLQRNKMFLSDFQASSLGEPLLQSVPSMHLNSPRDTLIRKSFRTANGEIDGSSGDSGHGISEEDQFHSPFMKNNECQMNSQNSNYYSTFTSSDGKQFVDKTTPYYPKMSLMSSRSIYGYHHTDSLASNTNDSTETKNNEYVCLVNSQKQ 1047          
BLAST of protocadherin-9 vs. Planmine SMEST
Match: SMESG000008751.1 (SMESG000008751.1)

HSP 1 Score: 427.172 bits (1097), Expect = 2.396e-132
Identity = 282/852 (33.10%), Postives = 459/852 (53.87%), Query Frame = 1
Query:   28 LHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSR--LSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHD-SGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKIL-LKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVI---NIIEGNYGVKEKIFQVFALDN--------DIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM-----FVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRR 2520
            +  +I++ +F  +H  N  +  +KY +KEES  N LIGNI +DSR     K  E+ T++IY  +   N  ++  K G   V  RIDRE +C   +       K  +C+L L +    +HWI V I IEDIND+ P F    K I++ E +++  + PL  A D D+    +Q Y LE     F L Y P F L L +  KLD++    + ++L L ACDGG P+QC  QKL I V D NDN PIF +++    + E T +GS IF   A+D DSGL+G IN+ +  + +   K     +F ++ N+G ++L   L+AK+   F + +EA D +G  P   Q  + I ++D N+H P +S+  +       L++ EN+    ++G++I +DGD+  NGKV+CV+ K++   L L  S+N  D +IY ++    FDRE    FTI I+C+DYG PP  + Q   + + D+NE PP   ++   + ISED+ I      ++  DKD T ++++ +  ++N   F ID   G +K   + DRE I +YI+ + V D  + GT  T + ++ ++V D NDN P +    + +   N+    YG      Q   LDN        D+ S  V+   +++I+  N       F I++    LF  +SLDRE+ D YK++++++D G P ++  EII V + D+NDN+PIW++ + Q    +N+T  T     I  + A D D  +N+N++Y    V   +NS  ++ + T  T     F++  +     + L +QA+DNG+ P  S  T +T++    E  + L  +  +SF LIV  ++ +  IC++L++ I+++ R+
Sbjct:    1 MKLFIFI-NFLWMHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNKRIDREFLCPNVD-------KIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV----YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRES-----LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVND-KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVR-GTILTGTTTVYITVTDVNDNTPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNH-----SFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNF--VNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRK 825          
BLAST of protocadherin-9 vs. Planmine SMEST
Match: SMESG000008751.1 (SMESG000008751.1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.133e-131
Identity = 280/840 (33.33%), Postives = 452/840 (53.81%), Query Frame = 1
Query:   64 IHLTNQISQDLKYSVKEESPPNYLIGNIKKDSR--LSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHD-SGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKIL-LKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVI---NIIEGNYGVKEKIFQVFALDN--------DIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM-----FVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRR 2520
            +H  N  +  +KY +KEES  N LIGNI +DSR     K  E+ T++IY  +   N  ++  K G   V  RIDRE +C   +       K  +C+L L +    +HWI V I IEDIND+ P F    K I++ E +++  + PL  A D D+    +Q Y LE     F L Y P F L L +  KLD++    + ++L L ACDGG P+QC  QKL I V D NDN PIF +++    + E T +GS IF   A+D DSGL+G IN+ +  + +   K     +F ++ N+G ++L   L+AK+   F + +EA D +G  P   Q  + I ++D N+H P +S+  +       L++ EN+    ++G++I +DGD+  NGKV+CV+ K++   L L  S+N  D +IY ++    FDRE    FTI I+C+DYG PP  + Q   + + D+NE PP   ++   + ISED+ I      ++  DKD T ++++ +  ++N   F ID   G +K   + DRE I +YI+ + V D  + GT  T + ++ ++V D NDN P +    + +   N+    YG      Q   LDN        D+ S  V+   +++I+  N       F I++    LF  +SLDRE+ D YK++++++D G P ++  EII V + D+NDN+PIW++ + Q    +N+T  T     I  + A D D  +N+N++Y    V   +NS  ++ + T  T     F++  +     + L +QA+DNG+ P  S  T +T++    E  + L  +  +SF LIV  ++ +  IC++L++ I+++ R+
Sbjct:    1 MHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNKRIDREFLCPNVD-------KIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV----YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRES-----LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVND-KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVR-GTILTGTTTVYITVTDVNDNTPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNH-----SFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNF--VNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRK 814          
BLAST of protocadherin-9 vs. Planmine SMEST
Match: SMESG000025393.1 (SMESG000025393.1)

HSP 1 Score: 404.831 bits (1039), Expect = 1.392e-123
Identity = 267/818 (32.64%), Postives = 422/818 (51.59%), Query Frame = 1
Query:  106 VKEESPPNYLIGNIKKDSRL---SEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTP-SFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLT------KITYPGQIIATIHAYDNDTLENANVTYTL-TKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGH-DSVSFNLIVTMAVVTCLICLSLLIAIVVVRRRQ 2523
            V EE P   +IG+I KDS+L   S   ++   F +   ++ K   +I  ++ + +V+ R+DRE +C              NC L ++ F+  + WI V I I DIND+ P FE    V+E  E   I +   L LA D+DIGPN++  Y LE P D+F L Y PP  L L L+ K+DY+    + +   ++ACD G+   C    L+I +ND NDN PIF+K    V V E T +   +++V+  D D G  G +++ +  +  N    +   +F +   +G I L + L++   P  F + + A D G  PL  +  +   + DIN+H P I +KP      C +   EN      + LI+VTDGD G NGKV+C ++     ++L+          + +I     DRE  S   +SI C+D G P  ST ++I I + D+NE+PP +        I ED+ +   F  V   DKD   N+   I    N  +F ID  FG +K+   LDRE    + + ++V DN    ++ TTS +L +++ D NDN P LL  +   ++ E N      I Q+   D D G N  V++ + +    N+ + +  F +N  +G +F++  +DRE      + +LLTD+G+P  + EE I++ + D+NDN PIW FPS +N+  N +      +++     I  + A D D+ ENAN+++ L +  +  +   +F L    G +     L+  +++L + ASDNG  P  S   TL I+ +   +G    G  D +S  LIV +A VTC+IC+SLL+AI++VRR +
Sbjct:   32 VFEEVPVGKIIGHIIKDSKLAIGSNGVNKCQLFDMTSHDQSKGVIQIKPESCDLFVSSRLDREQLCD-----------KSNCILQMSAFINAQTWIKVFIEIIDINDNSPKFEYTSFVVEFYENSQIGYSQELPLATDIDIGPNSVHSYTLEPPLDLFELMYTPPRSLKLVLRGKVDYEKKSNRYFLTRVKACDAGEDQLCSKLNLNISINDVNDNRPIFLKCNESVRVMEDTQLNQTVYQVLVKDLDEGENGRVSFEINHTPENR---LARRYFSVKSINGDIYLRKSLNSIDIPDKFHLAITARDHGAIPLSSECKLIFNVIDINNHAPSIIVKPTLG-NKCQII--ENTIGMTTVALIMVTDGDKGNNGKVNCELSNTSYFVILERWEFTSS--TFKLIIKKPLDRELMSSINVSIVCRDNGIPVKSTLKSISISVIDINEYPPALKVEPSYNVIPEDLPVNSSFAKVIATDKDPDANLKLTIISD-NDGFFEID-VFGNLKLMKPLDRELRPFHPLVVLVTDNSPPNSR-TTSLALNITISDINDNIPKLLEPTS-FHLYE-NLNGNSTIGQLKVSDPDSGLNGKVKFLLIHAYTINDKLIKDTFFVNEDDGTIFSIRPIDREVTSEIILRILLTDQGSPSLSHEEKIVLKVADENDNEPIWTFPSDENNQFNFSISSSAARLSARESFIVNVQASDPDSPENANISFKLISAFKDNIPVYLFTLELMTGNLGTNGELSEGLYILKMMASDNGRPPKHSKDATLYIKVYSSNSGFFFGGETDRLSLTLIVALASVTCIICVSLLVAIIIVRRHR 825          
BLAST of protocadherin-9 vs. Planmine SMEST
Match: SMESG000025393.1 (SMESG000025393.1)

HSP 1 Score: 404.445 bits (1038), Expect = 1.976e-123
Identity = 267/818 (32.64%), Postives = 422/818 (51.59%), Query Frame = 1
Query:  106 VKEESPPNYLIGNIKKDSRL---SEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTP-SFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLT------KITYPGQIIATIHAYDNDTLENANVTYTL-TKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGH-DSVSFNLIVTMAVVTCLICLSLLIAIVVVRRRQ 2523
            V EE P   +IG+I KDS+L   S   ++   F +   ++ K   +I  ++ + +V+ R+DRE +C              NC L ++ F+  + WI V I I DIND+ P FE    V+E  E   I +   L LA D+DIGPN++  Y LE P D+F L Y PP  L L L+ K+DY+    + +   ++ACD G+   C    L+I +ND NDN PIF+K    V V E T +   +++V+  D D G  G +++ +  +  N    +   +F +   +G I L + L++   P  F + + A D G  PL  +  +   + DIN+H P I +KP      C +   EN      + LI+VTDGD G NGKV+C ++     ++L+          + +I     DRE  S   +SI C+D G P  ST ++I I + D+NE+PP +        I ED+ +   F  V   DKD   N+   I    N  +F ID  FG +K+   LDRE    + + ++V DN    ++ TTS +L +++ D NDN P LL  +   ++ E N      I Q+   D D G N  V++ + +    N+ + +  F +N  +G +F++  +DRE      + +LLTD+G+P  + EE I++ + D+NDN PIW FPS +N+  N +      +++     I  + A D D+ ENAN+++ L +  +  +   +F L    G +     L+  +++L + ASDNG  P  S   TL I+ +   +G    G  D +S  LIV +A VTC+IC+SLL+AI++VRR +
Sbjct:   36 VFEEVPVGKIIGHIIKDSKLAIGSNGVNKCQLFDMTSHDQSKGVIQIKPESCDLFVSSRLDREQLCD-----------KSNCILQMSAFINAQTWIKVFIEIIDINDNSPKFEYTSFVVEFYENSQIGYSQELPLATDIDIGPNSVHSYTLEPPLDLFELMYTPPRSLKLVLRGKVDYEKKSNRYFLTRVKACDAGEDQLCSKLNLNISINDVNDNRPIFLKCNESVRVMEDTQLNQTVYQVLVKDLDEGENGRVSFEINHTPENR---LARRYFSVKSINGDIYLRKSLNSIDIPDKFHLAITARDHGAIPLSSECKLIFNVIDINNHAPSIIVKPTLG-NKCQII--ENTIGMTTVALIMVTDGDKGNNGKVNCELSNTSYFVILERWEFTSST--FKLIIKKPLDRELMSSINVSIVCRDNGIPVKSTLKSISISVIDINEYPPALKVEPSYNVIPEDLPVNSSFAKVIATDKDPDANLKLTIISD-NDGFFEID-VFGNLKLMKPLDRELRPFHPLVVLVTDNSPPNSR-TTSLALNITISDINDNIPKLLEPTS-FHLYE-NLNGNSTIGQLKVSDPDSGLNGKVKFLLIHAYTINDKLIKDTFFVNEDDGTIFSIRPIDREVTSEIILRILLTDQGSPSLSHEEKIVLKVADENDNEPIWTFPSDENNQFNFSISSSAARLSARESFIVNVQASDPDSPENANISFKLISAFKDNIPVYLFTLELMTGNLGTNGELSEGLYILKMMASDNGRPPKHSKDATLYIKVYSSNSGFFFGGETDRLSLTLIVALASVTCIICVSLLVAIIIVRRHR 829          
The following BLAST results are available for this feature:
BLAST of protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH91.045e-8028.15protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH98.808e-8028.15protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.113e-7928.15protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.249e-7928.15protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH12.765e-7727.74protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
back to top
BLAST of protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.369e-5227.25FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-15.586e-5127.38FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-42.346e-3724.75Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-16.168e-2927.06CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-14.840e-2724.96Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.589e-6028.33gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.589e-6028.33gene:FBgn0284247 transcript:FBtr0343249[more]
kug3.108e-5327.39gene:FBgn0261574 transcript:FBtr0332722[more]
kug3.962e-5327.39gene:FBgn0261574 transcript:FBtr0346077[more]
kug3.962e-5327.39gene:FBgn0261574 transcript:FBtr0332721[more]
back to top
BLAST of protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh95.144e-8228.17protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.18.259e-8228.17pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh91.266e-8128.17protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh91.266e-8128.17protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh1a2.167e-7427.40protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
back to top
BLAST of protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000027070.11.195e-8129.50pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
vapa1.013e-8028.21VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000047804.15.726e-7929.83protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.17.273e-7929.83protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.17.675e-7929.83protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh93.176e-8128.02protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh92.177e-7928.02protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh93.738e-7928.02protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh94.038e-7928.02protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh94.038e-7928.02protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC56|PCDH9_HUMAN5.998e-7928.15Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q08174|PCDH1_HUMAN1.328e-7627.74Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9BZA8|PC11Y_HUMAN2.027e-7529.48Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q71M42|PC11X_PANTR6.763e-7529.09Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA7.906e-7529.09Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
back to top
BLAST of protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7FMR54.302e-12131.56Protocadherin alpha-4 OS=Clonorchis sinensis OX=79... [more]
A0A183A8858.913e-12130.65Uncharacterized protein OS=Echinostoma caproni OX=... [more]
G7YNN21.915e-11931.56Protocadherin alpha-4 OS=Clonorchis sinensis OX=79... [more]
A0A2H1C5371.960e-11930.58Cadherin domain protein OS=Fasciola hepatica OX=61... [more]
A0A504YKU62.304e-11930.38Protocadherin-1 OS=Fasciola gigantica OX=46835 GN=... [more]
back to top
BLAST of protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh93.261e-8228.43protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh94.940e-8228.43protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh1a5.122e-7427.65protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
ENSAMXT00000035285.16.815e-7428.78pep primary_assembly:Astyanax_mexicanus-2.0:8:8923... [more]
pcdh1gc51.716e-7329.49protocadherin 1 gamma c 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh118.208e-6928.10protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.16.070e-5626.20protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.16.403e-4924.25pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.19.487e-4723.98pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000006996.17.894e-4325.79pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354121.028e-6227.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461894.478e-6126.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464181.501e-5625.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.243e-5425.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354134.682e-5429.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.524e-7828.27protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh91.525e-7728.27protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh91.964e-7728.27protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
ENSORLT00000005206.21.947e-7529.06pep primary_assembly:ASM223467v1:10:14854024:14859... [more]
ENSORLT00000044497.16.454e-7529.57protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of protocadherin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023091.10.000e+0100.00SMESG000023091.1[more]
SMESG000008751.12.396e-13233.10SMESG000008751.1[more]
SMESG000008751.11.133e-13133.33SMESG000008751.1[more]
SMESG000025393.11.392e-12332.64SMESG000025393.1[more]
SMESG000025393.11.976e-12332.64SMESG000025393.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024198 ID=SMED30024198|Name=protocadherin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=3228bp
CAAATTTAGTATTAAATGAATGAATTATTGCATTTTTATATATATTTATT
TAGTTTTTCATTGATTCATTTAACAAATCAAATCAGTCAAGACTTAAAAT
ATTCAGTTAAAGAAGAATCTCCACCGAATTATTTGATAGGAAATATCAAA
AAAGACAGCCGACTGTCAGAGAAGAATTCTGAATCGTTAACTTTCCAGAT
CTACGAAGATGAAGAGAAGAAAAATTATTTTCGAATCGTGGAAAAGACCG
GTGAATTTTACGTAGCAGGTCGGATTGATAGGGAAACGATTTGCTCTTTT
AAGGAGGTTGGCGATTCAGATCCACTCAAAGCTCAAAATTGTAAATTAAG
CCTAACGGTTTTCGTTCCAAAAGAACATTGGATAAATGTTGAGATCACCA
TCGAGGACATCAACGACCATGTGCCGGTATTTGAACCTAATTGGAAAGTC
ATCGAAATCGACGAAAGAGTAAGCATAAATTTCGAAACACCTCTTGCATT
AGCGAAAGATTTGGATATCGGTCCAAACAATATTCAAGAGTACAAGTTGG
AACAACCATCAGACATATTTGGATTAAACTACGAACCACCTTTTATTTTG
AATTTATATCTCAAGTCGAAATTAGATTACGATGTACCAGATGGAAAGAA
TTACAGCTTGATTCTGAGAGCTTGCGACGGAGGGGATCCGATTCAATGTG
GACATCAGAAATTGAGTATACGAGTCAATGATTATAACGATAATCCGCCG
ATTTTCATGAAAAGTGAATACATGGTAAATGTCAGTGAAAAGACTGCAGT
CGGTAGTGAAATATTCCGTGTAATTGCAACGGATCGCGATAGTGGACTGT
ATGGCTCAATAAATTATTTCATGTACGAGTCAGTAAGTAATCATAAAAAG
TCTGTTGAAGTGCCATTTTTTAAAATTTCGAAAAATAGCGGTAGGATTAT
CCTCAATCGAAAATTAGACGCCAAGTTGACCCCGTCATTTTTTATGAGAT
TAGAAGCTCACGATTCAGGAGAATCTCCGTTAATGGGCCAAGCGGTGATG
AAGATAATAATTGAAGACATAAACGATCACACTCCACAAATTTCAATTAA
ACCGAAACCGGATATTCCGGACTGTATGTTATCACTTCCGGAGAATAATG
ACAAAAATGCTTACATCGGTTTGATAATTGTTACTGACGGAGATATCGGT
CAAAACGGAAAAGTGTCCTGTGTTATAAATAAAGATGAAGAAAAAATACT
TTTGAAAGTTTCAAACAATGGAGATGACCGAATGATCTATAGCATCATAG
CAAATCATACGTTTGATCGGGAAGCCGAAAGTCTTTTTACGATTTCTATT
ACTTGCAAAGATTATGGTCAACCACCTCTCTCAACCAGCCAAACAATTGA
AATTTGTATAAGCGACGTCAATGAACACCCTCCAGTTATAAATAATAATA
TTAAAGAAGTTAATATTAGTGAAGACGTTTCAATAGGACAAGAATTCTTT
ACCGTTGAAGTTGAAGACAAAGATGCAACAAGAAATATTTCGTTTTTAAT
TCAAGAAACTATTAATAAAATTTATTTCTCCATTGATAGAAAGTTTGGTA
AGATCAAAATCAAATCGAATCTAGACCGAGAAAAGATTGATAGGTATATA
ATTTGTATAGTTGTGGAGGATAACAAACAATTGGGTACCCAATTTACGAC
CTCATTTTCACTGACGGTTTCGGTAATGGATGCAAATGATAATAAGCCCT
ACCTCTTAAACTCCAGTAAAGTCATCAACATTATTGAAGGTAACTATGGC
GTTAAAGAAAAAATATTTCAGGTCTTTGCTCTTGATAACGACATTGGTAG
CAATGCGGTTGTTGAGTACACAATAAATTACATAAAATATCGCAATGAAA
TTATCAAAGAAAAGGTATTTACCATCAATCGAAAGAACGGAGAGTTATTT
GCTTTGACATCTCTTGATCGAGAGAAATATGATGTTTACAAAATATCTTT
ATTATTAACTGACAAAGGAAATCCACCCCAAACCAAAGAGGAAATAATCC
TTGTAAATATAATAGACAAAAACGATAATGCTCCAATTTGGAAATTTCCG
AGCCCACAGAACGACATAATCAATCTCACGAAAATCACGTACCCGGGCCA
AATCATTGCCACCATTCATGCTTATGATAATGACACATTGGAAAACGCGA
ATGTTACGTATACCCTAACAAAGGTAGAACCACCTCTAAATTCCAACATC
TTCAAACTCCATGAAACACAAGGAACGATTCAGGTGACAGAATTCTTGAC
GTTGAAAATGTTCGTGCTGCATCTTCAAGCATCTGACAATGGAAATACCC
CCTTGAAATCAGTACCAACCACTCTCACTATTCGTTACTGGCCGATGGAA
ACCGGCAGTTTATTGTCCGGTCACGATTCAGTCAGTTTTAATTTAATCGT
CACAATGGCCGTAGTTACTTGTCTGATTTGTTTGTCTCTGTTGATTGCGA
TAGTCGTTGTCCGTCGGAGACAAAATTACACTTGTTCCCACAGTCAAAGT
CCAAGTAACATCATGTTCGCCATTAATACCGATCAAAACCGTAGCCAATT
TATAACGTTGCGCAACGATCCTTACTATTTGGATCCGTTAGCTGGTGATG
CGTCTGTGTTGAGTAACAAATGGTTTAACCAGTATGACTCGAAGAATGAT
TACTCGCTCTCACTTCAAAGAAACAAAATGTTTTTATCCGACTTTCAAGC
AAGTTCCTTAGGTGAACCACTTCTACAGTCCGTTCCATCAATGCACTTGA
ACTCTCCTAGAGATACTTTAATTCGCAAGTCATTTCGAACTGCAAATGGC
GAAATCGACGGTTCAAGTGGCGACTCCGGACACGGGATTAGCGAGGAAGA
TCAGTTTCATTCTCCATTCATGAAAAATAATGAATGCCAAATGAACTCGC
AAAATTCCAATTACTATTCAACATTCACAAGTTCTGATGGGAAACAATTT
GTGGATAAAACGACTCCATATTACCCTAAAATGAGCTTGATGTCGTCTAG
GTCCATTTATGGCTATCATCATACAGATTCTTTAGCTTCCAATACCAACG
ATTCAACTGAGACTAAGAACAATGAATATGTCTGCCTTGTAAATTCTCAA
AAACAATAATTATTAACGTATTCAAACAAACAAAAAAACAAAGATTAGAT
TATTGAAATAAGATTATATCCAAATAGC
back to top

protein sequence of SMED30024198-orf-1

>SMED30024198-orf-1 ID=SMED30024198-orf-1|Name=SMED30024198-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1048bp
MNELLHFYIYLFSFSLIHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRL
SEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGD
SDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDE
RVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLK
SKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKS
EYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVP
FFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIE
DINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKV
SCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDY
GQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVE
DKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVV
EDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKI
FQVFALDNDIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSL
DREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQND
IINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHE
TQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLL
SGHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRRQNYTCSHSQSPSNIM
FAINTDQNRSQFITLRNDPYYLDPLAGDASVLSNKWFNQYDSKNDYSLSL
QRNKMFLSDFQASSLGEPLLQSVPSMHLNSPRDTLIRKSFRTANGEIDGS
SGDSGHGISEEDQFHSPFMKNNECQMNSQNSNYYSTFTSSDGKQFVDKTT
PYYPKMSLMSSRSIYGYHHTDSLASNTNDSTETKNNEYVCLVNSQKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
IPR004170WWE-dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 674..691
score: 35.58
coord: 247..276
score: 34.26
coord: 70..89
score: 33.34
coord: 440..452
score: 23.64
coord: 640..666
score: 26.45
coord: 454..473
score: 36.02
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 269..357
e-value: 1.1E-14
score: 64.8
coord: 497..578
e-value: 1.2E-12
score: 58.0
coord: 387..473
e-value: 1.1E-13
score: 61.5
coord: 41..137
e-value: 0.25
score: 10.0
coord: 603..690
e-value: 4.7E-19
score: 79.3
coord: 717..793
e-value: 0.61
score: 6.0
coord: 161..245
e-value: 1.1E-7
score: 41.5
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 252..349
e-value: 2.5E-9
score: 37.5
coord: 710..789
e-value: 6.2E-8
score: 33.0
coord: 596..682
e-value: 1.6E-11
score: 44.5
coord: 373..464
e-value: 1.3E-7
score: 32.0
coord: 481..569
e-value: 2.1E-11
score: 44.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 690..794
e-value: 2.4E-12
score: 49.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 26..131
e-value: 4.1E-22
score: 80.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 133..242
e-value: 6.0E-14
score: 54.4
coord: 471..578
e-value: 2.2E-18
score: 68.7
coord: 243..356
e-value: 1.4E-26
score: 95.2
coord: 579..689
e-value: 6.7E-21
score: 76.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 357..470
e-value: 9.1E-19
score: 70.0
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 530..960
coord: 17..553
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 600..692
score: 21.226
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 140..247
score: 15.767
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 248..359
score: 20.722
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 373..475
score: 16.14
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 476..580
score: 20.525
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 696..790
score: 12.041
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 23..139
score: 13.663
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 29..135
e-value: 3.08285E-11
score: 58.8641
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 372..471
e-value: 7.62483E-17
score: 74.6573
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 251..355
e-value: 2.60632E-22
score: 90.4505
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 145..243
e-value: 3.93292E-11
score: 58.4789
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 481..576
e-value: 2.18089E-19
score: 81.9761
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 710..790
e-value: 2.91924E-12
score: 61.9457
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 600..688
e-value: 2.9571E-18
score: 78.8945
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.467
NoneNo IPR availableTMHMMTMhelixcoord: 810..832
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 27..96
e-value: 2.9E-11
score: 43.0
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 235..245
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 680..690
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 468..572
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 132..239
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 235..365
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 686..789
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 568..695
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 352..467
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 27..95