cGMP-dependent protein kinase

Overview
NamecGMP-dependent protein kinase
Smed IDSMED30024190
Length (bp)2617
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cGMP-dependent protein kinase (SMED30024190) t-SNE clustered cells

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30024190) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cGMP-dependent protein kinase (SMED30024190) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30024190) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024190

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024190 Contig5488GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30024190SMESG000007783.1 dd_Smed_v4_6967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024190SMESG000007783.1 dd_Smed_v4_6967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024190SMESG000007783.1 dd_Smed_v4_6967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 323/684 (47.22%), Postives = 446/684 (65.20%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQ----RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESD-IPPDENSGWDKDF 2462
            E    ++L+   + E+D+K+  I++LQ E+DK +SV+            S+     + R+KR  IS E +          TL  +PKS + K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L E  L K+ +++E   Y +G+ IIRQG   D+FFII  G V VT++ +   D + +R +  G++FGEKAL  E  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +  +    NLK     L+DF I+ TLG GGFGRVELV    + +K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KI   AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  ++D  PPD+NSGWD DF
Sbjct:   17 ELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQG--EPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFA----NLK-----LSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 686          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 322/680 (47.35%), Postives = 441/680 (64.85%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRF----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESD-IPPDENSGWDKDF 2462
            E  ++  ++ + EK  +I+EL+R++ K +SVL                  I  R+ R  GIS E   ++ F    Q   KF KS   K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L E  L K+ +++E   Y +G+ IIRQG   D+FFII  G V VT++ +   D + +R +  G++FGEKAL  E  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +  +    NLK     L+DF I+ TLG GGFGRVELV    + +K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KI   AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  ++D  PPD+NSGWD DF
Sbjct:   16 EERIKELEKRLSEKEEEIQELKRKLHKCQSVL------------PVPSTHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFA----NLK-----LSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 318/649 (49.00%), Postives = 418/649 (64.41%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRFQTLNKFP----------KSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE--VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQ--------TKEYDDESR-AKMSLS---MHSRNSAESNNLKRE------SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            R  + G+S E +   R   LNK P          K +  KK+I  A+  N  L +LDP Q+ +++ECMY ++  +  ++I++GE G  ++V  EG  EV++ EKL+  +     FGELA+LYNC RTASVKA+     W LDR +FQ IM +T   R +  + FL SV+L ++L E KL KI++ +EV+ Y  G  IIR+GEE  +FFI+  G VKVTQ   G +    ++ +  GEYFGEKAL+ +  R+ANI A +     L + R+ F++ +G    LQ            DDE R AK S+S   +    S E   LK +      S    + EI+ATLG GGFGRVELV   K+   ++A+K ++K++IV TKQQ+HV SEK+IL E  S +I +LY TF DNKYVY+L E CLGGELW+ILRDR  FD+  ++FC+ACV EA  YLH  GI+YRDLKPENL++   GYLKL DFGFAKKIG G +TWTFCGTPEYVAPE+ILNK HDFSVDFWS+GIL YELL G PPF   D M  YN+ LKGIE+ +     KIT +   LI+RLCR  P ERLGN KNGI +I+ H++  GF+WEG+K+ ++ SP   ++ GP D S FDK+  E  +PPDE SGWDKDF
Sbjct:  119 RGAKAGVSAEPTT--RTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELV-KVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPR--KITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 318/649 (49.00%), Postives = 418/649 (64.41%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRFQTLNKFP----------KSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE--VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQ--------TKEYDDESR-AKMSLS---MHSRNSAESNNLKRE------SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            R  + G+S E +   R   LNK P          K +  KK+I  A+  N  L +LDP Q+ +++ECMY ++  +  ++I++GE G  ++V  EG  EV++ EKL+  +     FGELA+LYNC RTASVKA+     W LDR +FQ IM +T   R +  + FL SV+L ++L E KL KI++ +EV+ Y  G  IIR+GEE  +FFI+  G VKVTQ   G +    ++ +  GEYFGEKAL+ +  R+ANI A +     L + R+ F++ +G    LQ            DDE R AK S+S   +    S E   LK +      S    + EI+ATLG GGFGRVELV   K+   ++A+K ++K++IV TKQQ+HV SEK+IL E  S +I +LY TF DNKYVY+L E CLGGELW+ILRDR  FD+  ++FC+ACV EA  YLH  GI+YRDLKPENL++   GYLKL DFGFAKKIG G +TWTFCGTPEYVAPE+ILNK HDFSVDFWS+GIL YELL G PPF   D M  YN+ LKGIE+ +     KIT +   LI+RLCR  P ERLGN KNGI +I+ H++  GF+WEG+K+ ++ SP   ++ GP D S FDK+  E  +PPDE SGWDKDF
Sbjct:  119 RGAKAGVSAEPTT--RTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELV-KVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPR--KITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 304/640 (47.50%), Postives = 401/640 (62.66%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRFQTLNKFP----------KSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE--VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQ--------TKEYDDESR-AKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            R  + G+S E +   R   LNK P          K +  KK+I  A+  N  L +LDP Q+ +++ECMY ++  +  ++I++GE G  ++V  EG  EV++ EKL+  +     FGELA+LYNC RTASVKA+     W LDR +FQ IM +T   R +  + FL SV+L ++L E KL KI++ +EV+ Y  G  IIR+GEE  +FFI+  G VKVTQ   G +    ++ +  GEYFGEKAL+ +  R+ANI A +     L + R+ F++ +G    LQ            DDE R AK S+S    N   S  L  E   L +                  V  K+   ++A+K ++K++IV TKQQ+HV SEK+IL E  S +I +LY TF DNKYVY+L E CLGGELW+ILRDR  FD+  ++FC+ACV EA  YLH  GI+YRDLKPENL++   GYLKL DFGFAKKIG G +TWTFCGTPEYVAPE+ILNK HDFSVDFWS+GIL YELL G PPF   D M  YN+ LKGIE+ +     KIT +   LI+RLCR  P ERLGN KNGI +I+ H++  GF+WEG+K+ ++ SP   ++ GP D S FDK+  E  +PPDE SGWDKDF
Sbjct:  119 RGAKAGVSAEPTT--RTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMS----NWKLSKALSLEMIQLKE-----------------KVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPR--KITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 733          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 319/698 (45.70%), Postives = 452/698 (64.76%), Query Frame = 3
Query:  441 NHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKA-------------------RSKRLGISGESSNHQ-RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGD--EIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRE--SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
              ++++    + I E   ++  LQRE DKL+SVL+Q     +           +                    R+K++ +S E +N + +  TL  + K+   K++IR A+  N  L +L   Q+ E++ CMYE  A    +VI+EGE G++L+V  EGE +V ++  L+GKM      GELA+LYNC RTASV+AL    LWVLDR++FQ I  + G+ER   L  FL  V++F++LSE ++ K+ ++++   Y  G  IIRQGE+ D+FF+I +G VKVTQ+I G+    E+R ++ G++FGE+ALL E  RTANI A     EVL L R++F +LIGDL  L+ K+Y D+ R    +          ++ + E     L + + +ATLG GGFGRVELV  + D  K++ALK +KK++IV T+QQ+H+ +E+ I++E  + +I +LY TF D K+VY+L EVCLGGELW  LRDR HFDDY  RF +ACVLE L YLH + IVYRDLKPEN L+ N+GYLKL DFGFAKK+  G +TWTFCGTPEYV+PEIILNK HD + D+W++GI   EL+ G PPF A+DPMK Y + LKG++   I  N +I   A +L+++LCR  P ERLG+G  G+ +IR H++F GFDWEG++S T+K P  PK++ P D +NFD +  ++D+PPDE SGWD+ F
Sbjct:   54 QQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 749          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 319/698 (45.70%), Postives = 452/698 (64.76%), Query Frame = 3
Query:  441 NHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKA-------------------RSKRLGISGESSNHQ-RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGD--EIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRE--SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
              ++++    + I E   ++  LQRE DKL+SVL+Q     +           +                    R+K++ +S E +N + +  TL  + K+   K++IR A+  N  L +L   Q+ E++ CMYE  A    +VI+EGE G++L+V  EGE +V ++  L+GKM      GELA+LYNC RTASV+AL    LWVLDR++FQ I  + G+ER   L  FL  V++F++LSE ++ K+ ++++   Y  G  IIRQGE+ D+FF+I +G VKVTQ+I G+    E+R ++ G++FGE+ALL E  RTANI A     EVL L R++F +LIGDL  L+ K+Y D+ R    +          ++ + E     L + + +ATLG GGFGRVELV  + D  K++ALK +KK++IV T+QQ+H+ +E+ I++E  + +I +LY TF D K+VY+L EVCLGGELW  LRDR HFDDY  RF +ACVLE L YLH + IVYRDLKPEN L+ N+GYLKL DFGFAKK+  G +TWTFCGTPEYV+PEIILNK HD + D+W++GI   EL+ G PPF A+DPMK Y + LKG++   I  N +I   A +L+++LCR  P ERLG+G  G+ +IR H++F GFDWEG++S T+K P  PK++ P D +NFD +  ++D+PPDE SGWD+ F
Sbjct:   54 QQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 749          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 319/698 (45.70%), Postives = 452/698 (64.76%), Query Frame = 3
Query:  441 NHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKA-------------------RSKRLGISGESSNHQ-RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGD--EIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRE--SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
              ++++    + I E   ++  LQRE DKL+SVL+Q     +           +                    R+K++ +S E +N + +  TL  + K+   K++IR A+  N  L +L   Q+ E++ CMYE  A    +VI+EGE G++L+V  EGE +V ++  L+GKM      GELA+LYNC RTASV+AL    LWVLDR++FQ I  + G+ER   L  FL  V++F++LSE ++ K+ ++++   Y  G  IIRQGE+ D+FF+I +G VKVTQ+I G+    E+R ++ G++FGE+ALL E  RTANI A     EVL L R++F +LIGDL  L+ K+Y D+ R    +          ++ + E     L + + +ATLG GGFGRVELV  + D  K++ALK +KK++IV T+QQ+H+ +E+ I++E  + +I +LY TF D K+VY+L EVCLGGELW  LRDR HFDDY  RF +ACVLE L YLH + IVYRDLKPEN L+ N+GYLKL DFGFAKK+  G +TWTFCGTPEYV+PEIILNK HD + D+W++GI   EL+ G PPF A+DPMK Y + LKG++   I  N +I   A +L+++LCR  P ERLG+G  G+ +IR H++F GFDWEG++S T+K P  PK++ P D +NFD +  ++D+PPDE SGWD+ F
Sbjct:   54 QQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 749          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 319/698 (45.70%), Postives = 452/698 (64.76%), Query Frame = 3
Query:  441 NHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKA-------------------RSKRLGISGESSNHQ-RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGD--EIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRE--SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
              ++++    + I E   ++  LQRE DKL+SVL+Q     +           +                    R+K++ +S E +N + +  TL  + K+   K++IR A+  N  L +L   Q+ E++ CMYE  A    +VI+EGE G++L+V  EGE +V ++  L+GKM      GELA+LYNC RTASV+AL    LWVLDR++FQ I  + G+ER   L  FL  V++F++LSE ++ K+ ++++   Y  G  IIRQGE+ D+FF+I +G VKVTQ+I G+    E+R ++ G++FGE+ALL E  RTANI A     EVL L R++F +LIGDL  L+ K+Y D+ R    +          ++ + E     L + + +ATLG GGFGRVELV  + D  K++ALK +KK++IV T+QQ+H+ +E+ I++E  + +I +LY TF D K+VY+L EVCLGGELW  LRDR HFDDY  RF +ACVLE L YLH + IVYRDLKPEN L+ N+GYLKL DFGFAKK+  G +TWTFCGTPEYV+PEIILNK HD + D+W++GI   EL+ G PPF A+DPMK Y + LKG++   I  N +I   A +L+++LCR  P ERLG+G  G+ +IR H++F GFDWEG++S T+K P  PK++ P D +NFD +  ++D+PPDE SGWD+ F
Sbjct:   42 QQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 737          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 319/698 (45.70%), Postives = 452/698 (64.76%), Query Frame = 3
Query:  441 NHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKA-------------------RSKRLGISGESSNHQ-RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGD--EIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRE--SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
              ++++    + I E   ++  LQRE DKL+SVL+Q     +           +                    R+K++ +S E +N + +  TL  + K+   K++IR A+  N  L +L   Q+ E++ CMYE  A    +VI+EGE G++L+V  EGE +V ++  L+GKM      GELA+LYNC RTASV+AL    LWVLDR++FQ I  + G+ER   L  FL  V++F++LSE ++ K+ ++++   Y  G  IIRQGE+ D+FF+I +G VKVTQ+I G+    E+R ++ G++FGE+ALL E  RTANI A     EVL L R++F +LIGDL  L+ K+Y D+ R    +          ++ + E     L + + +ATLG GGFGRVELV  + D  K++ALK +KK++IV T+QQ+H+ +E+ I++E  + +I +LY TF D K+VY+L EVCLGGELW  LRDR HFDDY  RF +ACVLE L YLH + IVYRDLKPEN L+ N+GYLKL DFGFAKK+  G +TWTFCGTPEYV+PEIILNK HD + D+W++GI   EL+ G PPF A+DPMK Y + LKG++   I  N +I   A +L+++LCR  P ERLG+G  G+ +IR H++F GFDWEG++S T+K P  PK++ P D +NFD +  ++D+PPDE SGWD+ F
Sbjct:   42 QQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 737          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: Pkg21D (gene:FBgn0000442 transcript:FBtr0078042)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 319/634 (50.32%), Postives = 421/634 (66.40%), Query Frame = 3
Query:  597 IKARSKRLGISGESSNHQRFQT----LNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKAL-KTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKI---NGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRA-KMSLSMHSRNSAESNNLKRE--SFHLNDFEIVATLGFGGFGRVELV-VNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            + A  K+ G+S ES      Q+    + K+ K    K+ I+ AIM+N  L  +D SQV E+++ MY K      FVIREGE G  LYV+  GEF V +  K++ KM   K FGELA+LYNC RTAS++ L +   +WVLDR +FQ IMM TGL+R ++   FL SV L  +LSE  L KI +++E++ Y+ G  IIRQG   DSFF+I  G V+VTQK+   + +E E+R +S G+YFGE+AL+ E KRTANI A+    E L L R +F  LIGDL  L+ K+Y DESR   M  +  S        L++E     L D E+V+TLG GGFGRVELV  + +D    +ALK +KK++IV TKQ++H+ SE+ I+L  +S +ICRLY TF D KYVY+L E C+GGE+W +LRDR  F+D   +F + CVL+A  YLH+RGI+YRDLKPENL++   GY+K+ DFGFAK+IG   +TWTFCGTPEYVAPEIILNK HD +VD+W++GIL +ELLNG PPF A DPM+ YN+ LKGI+   I     I+  A  LI+RLCR +P ERLG    GI++I+ HK+F GFDW+G+ S  +  PF   I  P D   FD+F  + + PPDE SGWD DF
Sbjct:  137 MPAAIKKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKLAMKQAQESCRDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTYNLILKGIDM--IAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDELSGWDADF 768          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089310)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 292/628 (46.50%), Postives = 410/628 (65.29%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRF----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVT--QKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLY--RQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDEN-SGWDKDF 2462
            R + LGIS E  +         +  K+ K    +++I+ AI++N  +  LD +Q+ EI++CMY         +I+EG+ G  +YV ++G  EV ++ K +  +S  K  GELA+LYNC+RTA++ A+  C LW ++R  FQTIMM+TGL RQ +   FL+SV +F+ L+E  L+KI +++E   Y  G  I+RQG   D+FFII  G V+VT  Q+   +E  +R +  G++FGEKAL  +  RTANI   +    V CL   R+ F++LI +L+ ++ + YDDE       +M  R   E    +    +L D  ++ATLG GGFGRVELV  + D ++S+ALK MKK  IV+T+QQ H+MSEK+I+ E    +I +L+ TF D KY+Y+L E CLGGELW ILRD+ +FDD  TRF  ACV+EA  YLHSR I+YRDLKPENLL+   GY+KL DFGFAKK+  G +TWTFCGTPEYVAPE+ILN+ HD S D+WS+G+L +ELL G PPF  +DPM+ YN+ LKGI+      N  IT  A++LI++LCR  P ERLG  + GI EI+ HK+F GF W G+++ T++ P  P +    DT+NFD +  + + PP ++ +GWDKDF
Sbjct:  475 RQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIIC-ESADGVSCLVIDRETFNQLISNLDEIKHR-YDDEG------AMERRKINE----EFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRN--ITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089312)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 292/628 (46.50%), Postives = 410/628 (65.29%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRF----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVT--QKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLY--RQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDEN-SGWDKDF 2462
            R + LGIS E  +         +  K+ K    +++I+ AI++N  +  LD +Q+ EI++CMY         +I+EG+ G  +YV ++G  EV ++ K +  +S  K  GELA+LYNC+RTA++ A+  C LW ++R  FQTIMM+TGL RQ +   FL+SV +F+ L+E  L+KI +++E   Y  G  I+RQG   D+FFII  G V+VT  Q+   +E  +R +  G++FGEKAL  +  RTANI   +    V CL   R+ F++LI +L+ ++ + YDDE       +M  R   E    +    +L D  ++ATLG GGFGRVELV  + D ++S+ALK MKK  IV+T+QQ H+MSEK+I+ E    +I +L+ TF D KY+Y+L E CLGGELW ILRD+ +FDD  TRF  ACV+EA  YLHSR I+YRDLKPENLL+   GY+KL DFGFAKK+  G +TWTFCGTPEYVAPE+ILN+ HD S D+WS+G+L +ELL G PPF  +DPM+ YN+ LKGI+      N  IT  A++LI++LCR  P ERLG  + GI EI+ HK+F GF W G+++ T++ P  P +    DT+NFD +  + + PP ++ +GWDKDF
Sbjct:  475 RQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIIC-ESADGVSCLVIDRETFNQLISNLDEIKHR-YDDEG------AMERRKINE----EFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRN--ITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089304)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 292/628 (46.50%), Postives = 410/628 (65.29%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRF----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVT--QKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLY--RQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDEN-SGWDKDF 2462
            R + LGIS E  +         +  K+ K    +++I+ AI++N  +  LD +Q+ EI++CMY         +I+EG+ G  +YV ++G  EV ++ K +  +S  K  GELA+LYNC+RTA++ A+  C LW ++R  FQTIMM+TGL RQ +   FL+SV +F+ L+E  L+KI +++E   Y  G  I+RQG   D+FFII  G V+VT  Q+   +E  +R +  G++FGEKAL  +  RTANI   +    V CL   R+ F++LI +L+ ++ + YDDE       +M  R   E    +    +L D  ++ATLG GGFGRVELV  + D ++S+ALK MKK  IV+T+QQ H+MSEK+I+ E    +I +L+ TF D KY+Y+L E CLGGELW ILRD+ +FDD  TRF  ACV+EA  YLHSR I+YRDLKPENLL+   GY+KL DFGFAKK+  G +TWTFCGTPEYVAPE+ILN+ HD S D+WS+G+L +ELL G PPF  +DPM+ YN+ LKGI+      N  IT  A++LI++LCR  P ERLG  + GI EI+ HK+F GF W G+++ T++ P  P +    DT+NFD +  + + PP ++ +GWDKDF
Sbjct:  475 RQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIIC-ESADGVSCLVIDRETFNQLISNLDEIKHR-YDDEG------AMERRKINE----EFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRN--ITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0446099)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 292/628 (46.50%), Postives = 410/628 (65.29%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRF----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVT--QKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLY--RQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDEN-SGWDKDF 2462
            R + LGIS E  +         +  K+ K    +++I+ AI++N  +  LD +Q+ EI++CMY         +I+EG+ G  +YV ++G  EV ++ K +  +S  K  GELA+LYNC+RTA++ A+  C LW ++R  FQTIMM+TGL RQ +   FL+SV +F+ L+E  L+KI +++E   Y  G  I+RQG   D+FFII  G V+VT  Q+   +E  +R +  G++FGEKAL  +  RTANI   +    V CL   R+ F++LI +L+ ++ + YDDE       +M  R   E    +    +L D  ++ATLG GGFGRVELV  + D ++S+ALK MKK  IV+T+QQ H+MSEK+I+ E    +I +L+ TF D KY+Y+L E CLGGELW ILRD+ +FDD  TRF  ACV+EA  YLHSR I+YRDLKPENLL+   GY+KL DFGFAKK+  G +TWTFCGTPEYVAPE+ILN+ HD S D+WS+G+L +ELL G PPF  +DPM+ YN+ LKGI+      N  IT  A++LI++LCR  P ERLG  + GI EI+ HK+F GF W G+++ T++ P  P +    DT+NFD +  + + PP ++ +GWDKDF
Sbjct:  129 RQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIIC-ESADGVSCLVIDRETFNQLISNLDEIKHR-YDDEG------AMERRKINE----EFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRN--ITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 742          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 326/684 (47.66%), Postives = 446/684 (65.20%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQ----RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQK--INGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E    ++L+   + E+D+K+  I++LQ E+DK +SV+      +              R+KR  IS E +          TL  +PKS + K++I++AI++N  +  L+ SQ+ EI++CMY     +   +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+V+ L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L E  L K+ +++E   YSDG+ IIRQG   D+FFII  G V VT++   NG  + +R +  G++FGEKAL  E  RTAN+ A +  T  L + R++F  LIG L+ +  K YDD           ++   E+ N    +  L DF I+ TLG GGFGRVELV    + TK++A+K +KK++IV T+QQ+H+ SEK+I+ E  S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KIT  A +LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  ++ D PPD+NSGWD DF
Sbjct:   17 ELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQVHKQSALQE----HQRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVIAAEAVT-CLVIDRESFKHLIGGLDDVSNKGYDDAG---------AKAKYEAENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 684          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 326/681 (47.87%), Postives = 442/681 (64.90%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRFQ-----TLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQK--INGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E  ++  +R +  K  ++ EL+R++ K +SVL  T               I  R++R  GIS E    + FQ      L K  KS   K++I++AI++N  +  L+ SQ+ EI++CMY     +   +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+V+ L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L E  L K+ +++E   YSDG+ IIRQG   D+FFII  G V VT++   NG  + +R +  G++FGEKAL  E  RTAN+ A +  T  L + R++F  LIG L+ +  K YDD           ++   E+ N    +  L DF I+ TLG GGFGRVELV    + TK++A+K +KK++IV T+QQ+H+ SEK+I+ E  S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KIT  A +LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  ++ D PPD+NSGWD DF
Sbjct:   16 EERIKEMERLLSAKEQEVNELKRKLHKYQSVLPST---------------IGPRTRRAQGISAEPQTARSFQDLKSEALRKHHKSVRSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVIAAEAVT-CLVIDRESFKHLIGGLDDVSNKGYDDAG---------AKAKYEAENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 669          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1a (protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1308])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 324/679 (47.72%), Postives = 438/679 (64.51%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRF--QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQK-INGDE-IEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDD-ESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E  +R  +R + E+  +I EL+R++ K +SVL                  I  R+ R  GIS E   HQ    Q+  +  KS+  K +I+ AI++N  +  L+ SQ+ EI++CMY     +N  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+V+ + +  LW +DR  FQTIMM+TGL +  +    L+SV  F  L E  L K+ +++E   Y DG  IIRQG   D+FFII  G V +T++   G E + +R M  G+ FGEKAL  E  RTAN+ A +  T  L + R ++  LIG L  +  K  +D E++AK           E+ N    + +L+DF I+ TLG GGFGRVELV    D  K++A+K +KK++IV T+QQ+H+ SEK I+ E  S +I RLY TF D+KY+Y+L E CLGGELW ILRDR +FDD  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KIT  AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+W+G++  T+  P  P +    DTSNFD F  ++ D PPD+NSGWD DF
Sbjct:   16 EERIRDLERRLLEREDEISELKRKLHKCQSVLPSAQ--------------IGPRTHRAQGISAEPQTHQDLSNQSFRRVAKSDRSKDLIKSAILDNDFMKNLEMSQIQEIVDCMYPVDYDKNSCIIKEGDVGSLVYVMEDGKVEVTKEGLKLCTMGPGKVFGELAILYNCTRTATVRTVSSVKLWAIDRQCFQTIMMRTGLIKHAEYMELLKSVLTFRGLPEEILSKLADVLEETHYEDGNYIIRQGARGDTFFIISKGKVTMTREDCPGQEPVYLRSMGRGDSFGEKALQGEDIRTANVIAAETVT-CLVIDRDSYKHLIGGLEDVSNKGCEDAEAKAKY----------EAENAFFSNLNLSDFNIIDTLGVGGFGRVELVQLKSDEMKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGNFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAANLIKKLCRDTPSERLGNLKNGVKDIQKHKWFEGFNWDGLRKGTLMPPIIPNVTSSTDTSNFDSFPEDNEDPPPDDNSGWDIDF 667          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 311/681 (45.67%), Postives = 420/681 (61.67%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRFQ-----TLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQK--INGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E  ++  +R +  K  ++ EL+R++ K +SVL  T               I  R++R  GIS E    + FQ      L K  KS   K++I++AI++N  +  L+ SQ+ EI++CMY     +   +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+V+ L    LW +DR               + L  F+       H S               YSDG+ IIRQG   D+FFII  G V VT++   NG  + +R +  G++FGEKAL  E  RTAN+ A +  T  L + R++F  LIG L+ +  K YDD           ++   E+ N    +  L DF I+ TLG GGFGRVELV    + TK++A+K +KK++IV T+QQ+H+ SEK+I+ E  S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KIT  A +LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  ++ D PPD+NSGWD DF
Sbjct:   16 EERIKEMERLLSAKEQEVNELKRKLHKYQSVLPST---------------IGPRTRRAQGISAEPQTARSFQDLKSEALRKHHKSVRSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDR---------------QSLTAFISI-----HSSP---------TPDTHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVIAAEAVT-CLVIDRESFKHLIGGLDDVSNKGYDDAG---------AKAKYEAENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 640          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 291/615 (47.32%), Postives = 397/615 (64.55%), Query Frame = 3
Query:  678 KSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE--VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQ--------TKEYDDESR-AKMSLSMHSRNSAESNNL----KRES-----FHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            K   VKK++  A+  N  L +L+  QV +++ECMYE+   +  +VI++GE G  L+V  +G+ +VY+  KL+  ++    FGELA+LYNC RTASVKA      W LDR +F  IM  T   R +  + FL SV+L   L   KL KIV+ +EV+ Y+ G  IIR+GEE ++F+II  G +KVTQ     E    +  +  G+YFGEKAL+ +  R+ANI A +   E L + R+ FS+ +G  + L+        +   DD+ R AK S S    N+  S+++    +RES           E +ATLG GGFGRVELV   K+   ++ALK +KK++IV  +Q++H+ SE++ILLE    +I ++Y T+ DNKYVY+L E CLGGE+W++LRDR  F++Y  +FC+ CV EA  YLH+ GI+YRDLKPENL++   GY+KL DFGFAKK+  G RTWTFCGTPEYVAPEIILNK H  SVDFWS+GIL +ELL G+PPF  +D M IY   LKGIE+ +     KIT +   LI++LCR  P ERLGN KNGI +I+ H++F GF W G+K+  + SP   ++ GP D S FD +  E +IPPDE SGWD DF
Sbjct:  158 KEQSVKKLLTDALNKNQYLRRLEVQQVKDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKKRNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELV-KLKNENVTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACLGGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVDFGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSDQMIIYTFILKGIEKMDFPK--KITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGFSWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTDF 769          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 325/684 (47.51%), Postives = 444/684 (64.91%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESS----NHQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E    ++L+   + E+D+K+  I+ LQ E+DK +SV+      +   + ++     + R+KR  IS E +          TL  +PKS + K++I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L E  + K+ +++E   Y  G  IIRQG   D+FFII  G V VT++ +   D I +R +  G++FGEKAL  E  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +       NLK     L DF I+ TLG GGFGRVELV    D  K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  FDD  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KIT  AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  ++ D PPD+NSGWD DF
Sbjct:   17 ELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNPTTLG---EQRTKRQAISAEPTAIDIQELSHVTLPFYPKSPQSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF----FGNLK-----LADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 685          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 325/684 (47.51%), Postives = 444/684 (64.91%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESS----NHQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E    ++L+   + E+D+K+  I+ LQ E+DK +SV+      +   + ++     + R+KR  IS E +          TL  +PKS + K++I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L E  + K+ +++E   Y  G  IIRQG   D+FFII  G V VT++ +   D I +R +  G++FGEKAL  E  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +       NLK     L DF I+ TLG GGFGRVELV    D  K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  FDD  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KIT  AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  ++ D PPD+NSGWD DF
Sbjct:   17 ELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNPTTLG---EQRTKRQAISAEPTAIDIQELSHVTLPFYPKSPQSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF----FGNLK-----LADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 685          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 326/681 (47.87%), Postives = 439/681 (64.46%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRF-----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E  +R  +  + EK  +I+EL+R++ K +SVL              S + I  R+ R  GIS E  + + +     Q   KF KS   K++I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L E  + K+ +++E   Y  G  IIRQG   D+FFII  G V VT++ +   D I +R +  G++FGEKAL  E  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +       NLK     L DF I+ TLG GGFGRVELV    D  K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  FDD  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KIT  AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  ++ D PPD+NSGWD DF
Sbjct:   16 EERIRDLENRLSEKEKEIQELKRKLHKYQSVL-----------AMPSTSHIGPRTTRAQGISAEPQSFRSYHDLTRQAFKKFTKSERSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF----FGNLK-----LADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 673          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: tnpo2 (transportin 2 [Source:Xenbase;Acc:XB-GENE-968452])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 323/699 (46.21%), Postives = 443/699 (63.38%), Query Frame = 3
Query:  471 REIDEKNLKIEELQRE-------IDKLKSVL--DQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQRFQTLNKFP------KSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLES-VNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDE--IEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQT--KEY------DDESRAKMSLSMH---SRNSAESNNLKR------ESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            +E+ EK+ KI +L++E       IDKL+  L  + T +          L+  + +  + G+S E ++   +   ++ P      K +  KK+I  AIM+N  L +L+ S V  +++CMYE+   ++  VI+EG  G  LYV  +G  +V ++ +L+G+M     FGELA+LYNCKRTA+VKA+    +WVLDR +FQ IMM +   + ++  +FL   V LF  +  R L  I        Y  G  IIR+GEE ++FFII  G V VTQ + G +   E++ +  G+YFGEKAL+ E  R+ANI A +  T+ L + R  F++++G    LQT  +EY      +D  R     S+H   SR+++E N L+        +      +++ TLG GGFGRVELV   KD   ++ALK +KK++IV T QQ+HV  EK IL +   S+I RLY TF D KYVY+L EVCLGGELW+ILRD   F++   RFC  CVLEA  YLH+RGIVYRDLKPENLL+ + GY+K+ DFGFAKKIG G +TWTFCGTPEYVAPEII+N+ HDF  D+WS+GIL YELL G+PPF   DP+KIYNM LKGIE+ +  H  +I  ++  +I+RLCR  P ERLGN KNGI +IR HK+FQGF+WEG+++  + SP   +I G  D S FD F+ ES+ PPDE SGWDK+F
Sbjct:   53 KELQEKDEKILQLEKELEVKVIQIDKLQDALGYNVTQTSPKGSQKKKLLSAHRRQKAKEGVSAEPTSRHYYNPSSQNPDVTCVRKDSSAKKLITGAIMSNDFLRQLEASHVRCMVDCMYERVYSKSQLVIQEGAAGNHLYVLADGLLDVIQNSRLLGQMHPGTAFGELAILYNCKRTATVKAVTDSKIWVLDRQVFQNIMMSSAQAQHQEYFSFLRRYVGLFSVMIYRLLYTIKN---TDFYDKGDYIIREGEEGNTFFIIAKGKVCVTQAVEGSQEPQEIKTLGVGDYFGEKALISEDVRSANIIAEEDDTQCLVIDRDTFNQMVGTYQELQTYLREYVFQLALNDHDRRNARKSLHHSMSRDNSEVNQLRELVSKFSSTSPFRYLDVITTLGTGGFGRVELV-KLKDEDMTFALKCIKKKHIVDTHQQEHVYWEKNILQQINCSFIIRLYRTFRDAKYVYMLLEVCLGGELWSILRDTGPFEEGTARFCTGCVLEAFDYLHNRGIVYRDLKPENLLLDSEGYIKMVDFGFAKKIGPGKKTWTFCGTPEYVAPEIIMNRGHDFGADYWSLGILIYELLTGSPPFSGTDPIKIYNMVLKGIEKVDFPH--RIGRRSEDVIRRLCRINPAERLGNRKNGISDIRKHKWFQGFNWEGLRNRKLLSPLKREIKGITDHSYFDNFLPESEEPPDELSGWDKNF 745          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: ptafr (platelet activating factor receptor [Source:Xenbase;Acc:XB-GENE-968925])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 302/654 (46.18%), Postives = 411/654 (62.84%), Query Frame = 3
Query:  600 KARSKRLGISGESS------NHQRFQTLNKFPKSNEVKKV-IRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQ--------TKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLN----------------DFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            K +  + G+S E +      +H RF       + N  +K+ I  A+  N  + ++D  Q+ +++ECMYE+  ++  F+IR+GE G Q++V  +G+ EV+++ KL+  +     FGELA+LYNC RTASVKA+     W LDR +FQ IM KT   + ++  +FL+SV L + L E KL+KI + +E++ Y     IIR+GEE  +FFII  G VKVTQ   G  +   ++ +  G+YFGEKAL+ +  R+ANI A     E L + R+ F++ +G    L             DDE R       H+++     +L+  S  LN                + EIV TLG GGFGRVELV   K+    +ALK +KK++IV  +QQ+H+ SEK IL E  S +I +LY TF DNKYVY+L E CLGGELW+ILRDR  FD+   +FC  CV EA  YLH +G++YRDLKPENLL+ + GY+KL DFGFAKKI  G +TWTFCGTPEYVAPE+ILNK H FSVDFWS+GIL YELL G+PPF   D M IYN+ L+GIE+     N  IT +   LI+RLCR  P ERLGN KNGI +I+ H++F GF+WEG+ + ++ SP  P++ GP D S FD +  + +IPPDE SGWD+DF
Sbjct:  144 KRKGAKEGVSAEPTSRYDGGDHPRFSFEKARVRKNTSEKILISDALNKNQFMKRMDHHQIQDMVECMYERIYLQGEFIIRQGEPGSQIFVLADGKAEVFQENKLLTSIPVWTTFGELAILYNCTRTASVKAITGVRTWALDREVFQNIMRKTAQSKHEEYLSFLKSVPLLKELPEHKLMKIADCLELEFYEMDDYIIREGEEGSTFFIISKGKVKVTQSTEGYKEPQYIKFLEKGDYFGEKALISDDVRSANILAYGDRVECLVMDRETFNKTVGTYEELMKCLEGYVANLTLDDERR-------HAKSPVNERHLRAVSMELNKMKQTLARFPSASPFENLEIVTTLGVGGFGRVELV-KVKNENLVFALKCIKKRHIVDNRQQEHIHSEKNILEEACSPFIVKLYCTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTAKFCTGCVTEAFEYLHQKGVLYRDLKPENLLLDSEGYVKLVDFGFAKKIFPGQKTWTFCGTPEYVAPEVILNKGHSFSVDFWSLGILLYELLTGSPPFTGPDQMIIYNLILQGIEKIEFYKN--ITKRPEDLIRRLCRENPAERLGNMKNGIADIKKHRWFNGFNWEGLNTRSLPSPLKPELEGPTDHSYFDSYPPDEEIPPDEVSGWDQDF 787          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 323/684 (47.22%), Postives = 446/684 (65.20%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQ----RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESD-IPPDENSGWDKDF 2462
            E    ++L+   + E+D+K+  I++LQ E+DK +SV+            S+     + R+KR  IS E +          TL  +PKS + K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L +  L K+ +++E   Y +G+ IIRQG   D+FFII  G V VT++ +   D + +R +  G++FGEKAL  E  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +  +    NLK     L+DF I+ TLG GGFGRVELV    + +K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KI   AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  +SD  PPD+NSGWD DF
Sbjct:   17 ELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQG--EPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFA----NLK-----LSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 686          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 319/649 (49.15%), Postives = 422/649 (65.02%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRFQTLNKFP----------KSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE--VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQ--------TKEYDDESR-AKMSLS---MHSRNSAESNNLKRE------SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            R  + G+S E +   R   LNK P          K +  KK+I  A+  N  L +LDP Q+ +++ECMY ++  +  +VI++GE G  ++V  EG  EV++ EKL+  +     FGELA+LYNC RTASVKA+     W LDR +FQ IM +T   R ++ + FL SV+L ++L E KL KI++ +EV+ Y  G  IIR+GEE  +FFI+  G VKVTQ   G +    ++ +  GEYFGEKAL+ +  R+ANI A +     L + R+ F++ +G  + LQ        T   DDE R AK S+S   +    S E   LK +      +    + EI+ATLG GGFGRVELV   K+   ++A+K ++K++IV TKQQ+HV SEK+IL E  S +I +LY TF DNKYVY+L E CLGGELW+ILRDR  FD+  ++FC+ACV EA  YLH  GI+YRDLKPENL++   GYLKL DFGFAKKIG G +TWTFCGTPEYVAPE+ILNK HDFSVDFWS+GIL YELL G PPF   D M  YN+ LKGIE+ +     KIT +   LI+RLCR  P ERLGN KNGI +I+ H++  GF+WEG+K+ ++ SP   +++GP D S FDK+  E  +PPDE SGWDKDF
Sbjct:  119 RGAKAGVSAEPTT--RTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELV-KVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPR--KITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 322/680 (47.35%), Postives = 441/680 (64.85%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRF----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESD-IPPDENSGWDKDF 2462
            E  ++  ++ + EK  +I+EL+R++ K +SVL                  I  R+ R  GIS E   ++ F    Q   KF KS   K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L +  L K+ +++E   Y +G+ IIRQG   D+FFII  G V VT++ +   D + +R +  G++FGEKAL  E  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +  +    NLK     L+DF I+ TLG GGFGRVELV    + +K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KI   AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  +SD  PPD+NSGWD DF
Sbjct:   16 EERIKELEKRLSEKEEEIQELKRKLHKCQSVL------------PVPSTHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFA----NLK-----LSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 305/640 (47.66%), Postives = 405/640 (63.28%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRFQTLNKFP----------KSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE--VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQ--------TKEYDDESR-AKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            R  + G+S E +   R   LNK P          K +  KK+I  A+  N  L +LDP Q+ +++ECMY ++  +  +VI++GE G  ++V  EG  EV++ EKL+  +     FGELA+LYNC RTASVKA+     W LDR +FQ IM +T   R ++ + FL SV+L ++L E KL KI++ +EV+ Y  G  IIR+GEE  +FFI+  G VKVTQ   G +    ++ +  GEYFGEKAL+ +  R+ANI A +     L + R+ F++ +G  + LQ        T   DDE R AK S+S    + A    L  E   L +                  V  K+   ++A+K ++K++IV TKQQ+HV SEK+IL E  S +I +LY TF DNKYVY+L E CLGGELW+ILRDR  FD+  ++FC+ACV EA  YLH  GI+YRDLKPENL++   GYLKL DFGFAKKIG G +TWTFCGTPEYVAPE+ILNK HDFSVDFWS+GIL YELL G PPF   D M  YN+ LKGIE+ +     KIT +   LI+RLCR  P ERLGN KNGI +I+ H++  GF+WEG+K+ ++ SP   +++GP D S FDK+  E  +PPDE SGWDKDF
Sbjct:  119 RGAKAGVSAEPTT--RTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKA----LSLEMIQLKE-----------------KVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPR--KITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 733          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 392.119 bits (1006), Expect = 1.249e-128
Identity = 200/387 (51.68%), Postives = 256/387 (66.15%), Query Frame = 3
Query: 1305 EEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESD-IPPDENSGWDKDF 2462
            EE  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +  +    NLK     L+DF I+ TLG GGFGRVELV    + +K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KI   AA+LI++LCR                     +F+GF+WEG++  T+  P  P +  P DTSNFD F  +SD  PPD+NSGWD DF
Sbjct:   29 EEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFA----NLK-----LSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKIAKNAANLIKKLCR---------------------WFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 382          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|A8X6H1|EGL4_CAEBR (cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae OX=6238 GN=egl-4 PE=3 SV=2)

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 321/698 (45.99%), Postives = 458/698 (65.62%), Query Frame = 3
Query:  444 HESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXX-------------------XXXXXXXXXXIKARSKRLGISGESSNHQ-RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDE--IEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFH---LNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
             +S++    + I E   ++  LQRE DKL+SVL+Q     +                           +  + R+K++ +S E +N + +  TL  + K+   K++IR A+  N  L +L   Q+ E++ CMYE  A    +VI+EGE G++L+V  EGE +V ++   +GKM      GELA+LYNC RTASV+AL    LWVLDR++FQ I  + G+ER   +  FL  V++F +L+E ++ KI ++++   Y  G  I+RQGE+ D+FF+I +G VKVTQ+I G++   E+R ++ G++FGE+ALL +  RTANI A     EVL L R++F++LIGDL+ L+ K+Y D+ R   +L     +  +  +  RE F    L + + +ATLG GGFGRVELV  + D +K+YALK +KK++IV T+QQ+H+ +E+ I++E  + +I +LY TF D K+VY+L EVCLGGELW  LRDR HFDDY  RF +ACVLE L YLH + IVYRDLKPEN L+ NSGYLKL DFGFAKK+  G +TWTFCGTPEYV+PEIILNK HD + D+W++GI   EL+ G PPF A+DPMK Y + LKG++   I  N +I   A +L+++LCR  P ERLG+G  G+ +IR H++F GFDWEG+++ T+K P  PK+N P D +NFD +  ++D+PPDE SGWD+ F
Sbjct:   55 QQSIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGQPPSPSPRTDQLGNDLQQKAVFPADGTQQRAKKIAVSAEPTNFENKPATLQHYNKTVAAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGATLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQIINFLSKVSIFANLTEDRISKIADVMDQDYYDGGHYILRQGEKGDAFFVINSGQVKVTQQIEGEKEAREIRILNQGDFFGERALLGDEVRTANIIAQAPGVEVLTLDRESFTKLIGDLDTLR-KDYGDKERV-ATLVREPPSPVKIVDDFREEFANVTLKNVKRLATLGVGGFGRVELVCVNGDKSKTYALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANSGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRTKTLKPPILPKVNNPADVTNFDNYPPDNDVPPDEFSGWDEGF 749          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|O76360|EGL4_CAEEL (cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans OX=6239 GN=egl-4 PE=1 SV=2)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 319/698 (45.70%), Postives = 452/698 (64.76%), Query Frame = 3
Query:  441 NHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKA-------------------RSKRLGISGESSNHQ-RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGD--EIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRE--SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
              ++++    + I E   ++  LQRE DKL+SVL+Q     +           +                    R+K++ +S E +N + +  TL  + K+   K++IR A+  N  L +L   Q+ E++ CMYE  A    +VI+EGE G++L+V  EGE +V ++  L+GKM      GELA+LYNC RTASV+AL    LWVLDR++FQ I  + G+ER   L  FL  V++F++LSE ++ K+ ++++   Y  G  IIRQGE+ D+FF+I +G VKVTQ+I G+    E+R ++ G++FGE+ALL E  RTANI A     EVL L R++F +LIGDL  L+ K+Y D+ R    +          ++ + E     L + + +ATLG GGFGRVELV  + D  K++ALK +KK++IV T+QQ+H+ +E+ I++E  + +I +LY TF D K+VY+L EVCLGGELW  LRDR HFDDY  RF +ACVLE L YLH + IVYRDLKPEN L+ N+GYLKL DFGFAKK+  G +TWTFCGTPEYV+PEIILNK HD + D+W++GI   EL+ G PPF A+DPMK Y + LKG++   I  N +I   A +L+++LCR  P ERLG+G  G+ +IR H++F GFDWEG++S T+K P  PK++ P D +NFD +  ++D+PPDE SGWD+ F
Sbjct:   85 QQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 780          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q03042|KGP1_DROME (cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster OX=7227 GN=Pkg21D PE=1 SV=2)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 319/634 (50.32%), Postives = 421/634 (66.40%), Query Frame = 3
Query:  597 IKARSKRLGISGESSNHQRFQT----LNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKAL-KTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKI---NGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRA-KMSLSMHSRNSAESNNLKRE--SFHLNDFEIVATLGFGGFGRVELV-VNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            + A  K+ G+S ES      Q+    + K+ K    K+ I+ AIM+N  L  +D SQV E+++ MY K      FVIREGE G  LYV+  GEF V +  K++ KM   K FGELA+LYNC RTAS++ L +   +WVLDR +FQ IMM TGL+R ++   FL SV L  +LSE  L KI +++E++ Y+ G  IIRQG   DSFF+I  G V+VTQK+   + +E E+R +S G+YFGE+AL+ E KRTANI A+    E L L R +F  LIGDL  L+ K+Y DESR   M  +  S        L++E     L D E+V+TLG GGFGRVELV  + +D    +ALK +KK++IV TKQ++H+ SE+ I+L  +S +ICRLY TF D KYVY+L E C+GGE+W +LRDR  F+D   +F + CVL+A  YLH+RGI+YRDLKPENL++   GY+K+ DFGFAK+IG   +TWTFCGTPEYVAPEIILNK HD +VD+W++GIL +ELLNG PPF A DPM+ YN+ LKGI+   I     I+  A  LI+RLCR +P ERLG    GI++I+ HK+F GFDW+G+ S  +  PF   I  P D   FD+F  + + PPDE SGWD DF
Sbjct:  137 MPAAIKKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKLAMKQAQESCRDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTYNLILKGIDM--IAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDELSGWDADF 768          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|P00516|KGP1_BOVIN (cGMP-dependent protein kinase 1 OS=Bos taurus OX=9913 GN=PRKG1 PE=1 SV=2)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 323/680 (47.50%), Postives = 441/680 (64.85%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRF----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQK--INGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESD-IPPDENSGWDKDF 2462
            E  ++  ++ + EK  +I+EL+R++ K +SVL                  I  R+ R  GIS E   ++ F    Q   KF KS   K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L E  L K+ +++E   Y +G+ IIRQG   D+FFII  G V VT++   N D + +R +  G++FGEKAL  E  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +  +    NLK     L+DF I+ TLG GGFGRVELV    + +K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KI   AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  ++D  PPD+NSGWD DF
Sbjct:   16 EERIKELEKRLSEKEEEIQELKRKLHKCQSVL------------PVPSTHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPNEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFA----NLK-----LSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|P0C605|KGP1_MOUSE (cGMP-dependent protein kinase 1 OS=Mus musculus OX=10090 GN=Prkg1 PE=1 SV=1)

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 322/680 (47.35%), Postives = 441/680 (64.85%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRF----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESD-IPPDENSGWDKDF 2462
            E  ++  ++ + EK  +I+EL+R++ K +SVL                  I  R+ R  GIS E   ++ F    Q   KF KS   K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L +  L K+ +++E   Y +G+ IIRQG   D+FFII  G V VT++ +   D + +R +  G++FGEKAL  E  RTAN+ A +  T  L + R +F  LIG L+ +  K Y+D        +  +  +    NLK     L+DF I+ TLG GGFGRVELV    + +K++A+K +KK++IV T+QQ+H+ SEK+I+    S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KI   AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P +  P DTSNFD F  +SD  PPD+NSGWD DF
Sbjct:   16 EERIKELEKRLSEKEEEIQELKRKLHKCQSVL------------PVPSTHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFA----NLK-----LSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A1S3HLV4 (cGMP-dependent protein kinase OS=Lingula unguis OX=7574 GN=LOC106156342 PE=3 SV=1)

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 347/667 (52.02%), Postives = 462/667 (69.27%), Query Frame = 3
Query:  498 IEELQREIDKLKSVLDQTXXXX------XXXXXXXXXXXIKARSKRLGISGESSNHQRFQ-TLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESR-AKMSLSMHSRNSAESNNLKRE--SFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            +++L+REIDKL+SVL+ T          +   + S +     R K+ G+SGES+N  R    L  F K    K++I+ AI++N  L  LD +Q+ E+I+CMYE+   +  F+I EGE G+ L+V+ EGE  V KD + +G M+  + FGELA+LYNC RTASVKAL    LWVLDR++FQ IMMKTGL+RQ +   FL SV+L + L   KL KI  ++E+  + +G+CIIR+GE  D+FFII  G V+V QK+ G  D  ++R +  G+YFGEKALL E  RTA++ A     E L + R++F++LIGDLN L+ K+Y DE+R A+ +       S     ++RE  +  L+  E++ATLG GGFGRVEL+  S D TK+YALK +KK++IV+T+QQ+H+ SEKKI++  +S++I RLY TF DNKYVY+L E CLGGELW ILRDR HFD+   RFC+ACV+EA  YLHS+GI+YRDLKPENLL+   GY+KL DFGFAK++G G +TWTFCGTPEYVAPEIILNK HD +VD+WS+GIL YELL G+PPF  +DPMK YN+ LKGI+      +  I   A +LI++LCR  P ERLG  KNGI +I+ HK+FQGFDW G+    +  P  P++ GP D SNFD +  + DIP DE SGWD DF
Sbjct:   85 VQKLEREIDKLRSVLELTVHKDGKPDILATIQEDSVMVGQATRGKKQGVSGESTNFSRSSVALKHFDKDFRSKQLIKDAILDNDFLKNLDKAQLREVIDCMYERTTQKGQFIITEGEAGQHLFVSAEGELNVLKDGRSLGTMTAGRAFGELAILYNCTRTASVKALSDARLWVLDRSVFQAIMMKTGLQRQAENIKFLRSVSLLKRLPSEKLAKIASVLEMDFFHEGECIIREGEAGDTFFIINKGEVEVQQKLKGFSDPQKIRNLKRGDYFGEKALLSEDYRTASVVAKAPGVECLTIDRESFTQLIGDLNELREKDYGDEARNAQRASESDIPASPGRQKMERELANVGLHQLEVLATLGLGGFGRVELIQLSTDRTKTYALKCLKKKHIVETRQQEHIYSEKKIMMNARSNFIARLYRTFKDNKYVYMLMEACLGGELWTILRDRGHFDEVTARFCVACVIEAFDYLHSKGIIYRDLKPENLLLDTKGYVKLVDFGFAKRVGHGSKTWTFCGTPEYVAPEIILNKGHDHAVDYWSLGILMYELLTGSPPFSTSDPMKTYNIILKGIDVVEFTQH--IRKNAQNLIKKLCRDNPAERLGYQKNGIADIKKHKWFQGFDWHGLHRQILTPPIQPRVRGPTDFSNFDNYPKDKDIPQDELSGWDNDF 749          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A0X3NTH0 (cGMP-dependent protein kinase, isozyme 1 OS=Schistocephalus solidus OX=70667 GN=KGP1 PE=4 SV=1)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 359/711 (50.49%), Postives = 469/711 (65.96%), Query Frame = 3
Query:  489 NLKIEELQREIDKLKSVLDQTXXXXX--XXXXXXXXXXIKARSKRLGISGESSNHQRFQTLNKF-PKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING-----DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGP-TEVLCLYRQAFSELIGDLNVLQTKEYDD----ESRAKM-----SLSMHSRNSAES----------NNLKR-------------------------ESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            N   + LQR+  K  S  DQT           S  +  + A +KRLG+SGE +       + K+  K  + ++ IR A+ NN  L  LD  Q+ EI+ CMYE    E C++I EGE+G  LYVA EGE+EV+   K +  M    CFGELALLYNCKRTAS+KA++   LWVL+R +FQ IMMKTG+E+ ++   FL SV L ++L E KL +I +++E Q +  G+CIIRQ E+ADSFFII++G VKVT K+ G     +EIE+R M+ GEYFGEKALL EG+RTANIYA+     ++LCLYR+ F ELIG++  L  +EY D    E+R+ +     S  M + NSA +            L+R                         E+  + D E VA +G GGFGRVELV  + D +  +ALK MKK +IV+TKQQ+HV SEK+IL+   S +IC+L+ TF DNK+VY+L E C GGELW +LRDR  FDD +TRF LACV+EA  YLH   I+YRDLKPEN+L+  +GY+KLCDFGFAK++G   +TWTFCGTPEYVAPE+ILNK HD + D+WS+GILT ELL G PPF A++P+KIY   L+GIE  ++ H+  I+ KA  LI+RLCR  P ERLG G+ GI+EIR  KYFQGFDWEG+++ +  SPF+PK++GP D SNFD+F    D+PPDE SGWDKDF
Sbjct:  287 NSMTKTLQRQSSKGSSGSDQTSVVTPGLELSPSLPVMSMAAVNKRLGVSGEPTTEPTTPLVMKYYDKDAKSRQEIRNALRNNEYLKNLDAVQLQEIVSCMYEYSIKEGCYIILEGEDGNHLYVAAEGEYEVWAGGKYLYTMGPGNCFGELALLYNCKRTASIKAVRAARLWVLERNVFQHIMMKTGIEKMEERVKFLSSVPLLKNLDEAKLQRITDVLEAQFHPAGECIIRQDEQADSFFIIQSGEVKVTMKVTGADGNQNEIEIRRMTRGEYFGEKALLGEGRRTANIYAISPSGVDLLCLYRKDFLELIGNIEDLHHREYVDLEHLEARSGLQKPEDSTVMLTENSAYALKTLQQASVDQQLERRQQEELRKEKTPSSKKLYLREYQICENLRITDLERVAVIGQGGFGRVELVKPTNDSSIGFALKRMKKVHIVETKQQEHVHSEKRILMCVDSPFICKLFKTFKDNKFVYMLMEFCPGGELWTVLRDRRVFDDKLTRFSLACVIEAFDYLHHNSIIYRDLKPENMLLTVNGYIKLCDFGFAKRLGGQRKTWTFCGTPEYVAPEVILNKGHDLAADYWSLGILTCELLMGTPPFQASEPIKIYMKALRGIEAYDLAHHKNISAKAHQLIKRLCRLNPTERLGMGRLGIQEIRNQKYFQGFDWEGVRNRSSPSPFHPKVSGPLDFSNFDQFPITDDLPPDETSGWDKDF 997          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A0X3PBC4 (cGMP-dependent protein kinase, isozyme 1 OS=Schistocephalus solidus OX=70667 GN=KGP1 PE=4 SV=1)

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 359/711 (50.49%), Postives = 469/711 (65.96%), Query Frame = 3
Query:  489 NLKIEELQREIDKLKSVLDQTXXXXX--XXXXXXXXXXIKARSKRLGISGESSNHQRFQTLNKF-PKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING-----DEIEVREMSSGEYFGEKALLEEGKRTANIYAVK-GPTEVLCLYRQAFSELIGDLNVLQTKEYDD----ESRAKM-----SLSMHSRNSAES----------NNLKR-------------------------ESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            N   + LQR+  K  S  DQT           S  +  + A +KRLG+SGE +       + K+  K  + ++ IR A+ NN  L  LD  Q+ EI+ CMYE    E C++I EGE+G  LYVA EGE+EV+   K +  M    CFGELALLYNCKRTAS+KA++   LWVL+R +FQ IMMKTG+E+ ++   FL SV L ++L E KL +I +++E Q +  G+CIIRQ E+ADSFFII++G VKVT K+ G     +EIE+R M+ GEYFGEKALL EG+RTANIYA+     ++LCLYR+ F ELIG++  L  +EY D    E+R+ +     S  M + NSA +            L+R                         E+  + D E VA +G GGFGRVELV  + D +  +ALK MKK +IV+TKQQ+HV SEK+IL+   S +IC+L+ TF DNK+VY+L E C GGELW +LRDR  FDD +TRF LACV+EA  YLH   I+YRDLKPEN+L+  +GY+KLCDFGFAK++G   +TWTFCGTPEYVAPE+ILNK HD + D+WS+GILT ELL G PPF A++P+KIY   L+GIE  ++ H+  I+ KA  LI+RLCR  P ERLG G+ GI+EIR  KYFQGFDWEG+++ +  SPF+PK++GP D SNFD+F    D+PPDE SGWDKDF
Sbjct:  175 NSMTKTLQRQSSKGSSGSDQTSVVTPGLELSPSLPVMSMAAVNKRLGVSGEPTTEPTTPLVMKYYDKDAKSRQEIRNALRNNEYLKNLDAVQLQEIVSCMYEYSIKEGCYIILEGEDGNHLYVAAEGEYEVWAGGKYLYTMGPGNCFGELALLYNCKRTASIKAVRAARLWVLERNVFQHIMMKTGIEKMEERVKFLSSVPLLKNLDEAKLQRITDVLEAQFHPAGECIIRQDEQADSFFIIQSGEVKVTMKVTGADGNQNEIEIRRMTRGEYFGEKALLGEGRRTANIYAISPSGVDLLCLYRKDFLELIGNIEDLHHREYVDLEHLEARSGLQKPEDSTVMLTENSAYALKTLQQASVDQQLERRQQEELRKEKTPSSKKLYLREYQICENLRITDLERVAVIGQGGFGRVELVKPTNDSSIGFALKRMKKVHIVETKQQEHVHSEKRILMCVDSPFICKLFKTFKDNKFVYMLMEFCPGGELWTVLRDRRVFDDKLTRFSLACVIEAFDYLHHNSIIYRDLKPENMLLTVNGYIKLCDFGFAKRLGGQRKTWTFCGTPEYVAPEVILNKGHDLAADYWSLGILTCELLMGTPPFQASEPIKIYMKALRGIEAYDLAHHKNISAKAHQLIKRLCRLNPTERLGMGRLGIQEIRNQKYFQGFDWEGVRNRSSPSPFHPKVSGPLDFSNFDQFPITDDLPPDETSGWDKDF 885          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: V3Z912 (cGMP-dependent protein kinase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_127769 PE=3 SV=1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 346/681 (50.81%), Postives = 468/681 (68.72%), Query Frame = 3
Query:  459 RAAKREIDEKNLKIEELQREIDKLKSVLD-------QTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQRFQT-LNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESF---HLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            R   ++I+E N +I  L+ E+ KLKSVL        +     +       +   + RSK+ G+SGESS++ +    L    K    K++I+ AI++N  L  LD +QV EI++CMY+K   E  ++I+EGE G  LYV+ +GE EV K+  ++G+M++ + FGELA+LYNC RTASVKAL    +WVLDR MFQ IMMKTG++R+ +   +L SV L   L   KL K+ +++E+  Y +G+ IIR+G   DSFFI+  G VKVTQ+I G  +  E+R++  G+YFGEK+LL E +RTAN+ A+    E L + R +F++LIGDLN L+TK+Y DE+R    LS      +   +   E F    ++D ++VATLG GGFGRVELV  S D  K+YALK +KK++IV T+QQ+H+ SEK+I+L  ++ +I RL+ TF DNKYVY++ E CLGGELW ILRDR  FDD  TRF ++CV+EA  YLH +GI+YRDLKPENLL+ N GY+KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD + D+WS+GIL +ELL G+PPF  +DPMK YN+ LKGI+   I    KI+  A +LI++LCR  P+ERLG GKNGI +I+ HK+FQGFDWEG+ + ++  P  PK+  P D SNFD +  ++DIP DE SGWD DF
Sbjct:   48 RDKTKQINENNKEITRLKEEVHKLKSVLQLKVHKDGKPDILATIQETEPPVVVQEVRSKKQGVSGESSSNSQSNVELKHHDKDFRSKQLIKDAILDNDFLKNLDSTQVREIVDCMYDKKIKEGHYIIKEGESGNHLYVSADGEVEVQKEGTILGRMASGRAFGELAILYNCTRTASVKALTEVRVWVLDRAMFQAIMMKTGIQRRDENIRYLRSVPLLRDLPADKLAKLADVLEIDFYHEGEYIIREGATGDSFFILNKGEVKVTQRIQGHNNPQEIRKLKRGDYFGEKSLLSEDRRTANVIALPPGVECLTVDRDSFNQLIGDLNELRTKDYGDEARGASRLSGELTPGSRDKDRILEEFVNIKIDDLDVVATLGMGGFGRVELVQLSNDKMKTYALKCLKKKHIVDTRQQEHIYSEKQIMLTSRTPFIARLFKTFRDNKYVYMMMEACLGGELWTILRDRGSFDDKTTRFYVSCVVEAFKYLHHKGIIYRDLKPENLLLDNKGYIKLVDFGFAKKIGAGKKTWTFCGTPEYVAPEIILNKGHDHAADYWSLGILMFELLTGSPPFSGSDPMKTYNIILKGIDV--IEFPRKISRNAHALIKKLCRDAPVERLGYGKNGITDIKKHKWFQGFDWEGLLNHSITPPIIPKVKNPTDYSNFDSYPKDNDIPADETSGWDADF 726          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A5N4A4B0 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_14115 PE=4 SV=1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 347/695 (49.93%), Postives = 473/695 (68.06%), Query Frame = 3
Query:  444 HESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-----------GISGESSN--------HQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNI-LHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            H  LL + ++E+  K  ++ +LQRE+ KLKSVL Q     +     +SL +  A + R+           G+S ESS+        H     + K  K    K++I+ AIM+N+ L  LD  QV EI++ MY +      +VIREG+ G  LYV+ EG+FEV KD+K++G+M + K FGELA+LYNC RTAS++ +    +WVLDR +FQ IM++TGL+R +D   FL SV L  +LS   L KI +++EV+ Y  G  I+RQG   D+FFII +G VK+TQ+I+G  DE ++R ++ G+YFGE+ALL E  RTA++ A+    E L L R++F +LIGDL+V + K+Y D+ R  M  S  +   AE      +   L+D +I+ATLG GGFGRVELV  + D + ++ALK +KKQ+IV T+QQDH+ SEK I++ C+S +ICRLY TF D+KYVY+L E CLGGE+W ILRDR  FDD+ TRF  ACV+EA  YLH+RGI+YRDLKPENLL+ N GY+KL DFGF+K++G   +TWTFCGTPEYVAPE ILNK HD +VD+W++GIL YELL G+PPF A+DPMK YN+ LKGI+  +   HN  ++  A SLI++LCR LP ERLG  + GI++I+ HK+FQGFDW+G+++ ++  P    + GP DTSNFD F  + DIPPDE S WD DF
Sbjct:  263 HTKLLES-RKEVHSKESQVIKLQREVHKLKSVLQQATCFSNESDILTSLQEQHAMANRVPPAAVTFNKKQGVSAESSDIIGPAGDIH-----VQKHEKDFRSKQLIKDAIMDNNFLKHLDSLQVREIVDSMYPRQCEAGSYVIREGDAGAHLYVSAEGDFEVIKDDKVLGRMGSGKAFGELAILYNCTRTASIRVVTDSKVWVLDRKVFQQIMVRTGLQRLQDNINFLRSVPLLANLSNDVLAKIADVLEVEFYPSGAYIVRQGASGDTFFIISSGNVKITQRISGGLDEEDIRTLTRGDYFGEQALLREECRTASVIAMSPGVECLTLDRESFIQLIGDLSVFKEKDYGDDQRMLMRPSSVASVCAEKQEY--DYMRLDDLDIIATLGVGGFGRVELVQYANDQSMTFALKCLKKQHIVDTQQQDHIFSEKMIMMCCRSPFICRLYRTFRDSKYVYMLLEACLGGEVWTILRDRACFDDHTTRFITACVIEAFDYLHNRGIIYRDLKPENLLLDNDGYVKLVDFGFSKRLGYSSKTWTFCGTPEYVAPETILNKGHDRAVDYWALGILMYELLTGSPPFTASDPMKTYNLILKGIDMIDFEKHN--VSRSAQSLIKKLCRDLPSERLGYQRGGIQDIKKHKWFQGFDWDGLRARSLPVPITKLVRGPCDTSNFDCFDKDVDIPPDELSDWDIDF 947          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 323/681 (47.43%), Postives = 435/681 (63.88%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRFQ-----TLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIEV--REMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E  +R  +  + EK  +I EL+R++ K +SVL                  +  R++R  GIS E      FQ      L K  KS+  K++I++AI++N  +  L+ SQ+ EI  C           +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+V+ L    LW +DR  FQTIMM+TGL +  +   FL+SV  F+ L+E  L K+ +++E   Y DG+ IIRQG   D+FFII  G V VT++ +  +  V  R +  G++FGEKAL  E  RTAN+ A    T  L + R +F  LIG L+ + +K Y+D           ++   E+ N    +  L DF I+ TLG GGFGRVELV    + TK++A+K +KK++IV T+QQ+H+ SEK I+ E  S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KIT  AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P  P ++ P DTSNFD F  +S D PPD+NSGWD DF
Sbjct:   16 EERIREMELRLAEKEEEIAELKRKLHKCQSVLPSAPL-------------MGPRTRRAQGISAEPQPFTSFQQLTSEALRKHAKSDRSKELIKEAILDNDFMKNLELSQIQEIESC-----------IIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLAEEILSKLADVLEETHYDDGEYIIRQGARGDTFFIISKGKVNVTREDSPSDTPVYLRALGKGDWFGEKALQGEDIRTANVIAADAVT-CLVIDRDSFKHLIGGLDDVSSKGYEDAG---------AKAKYEAENAFFSNLKLADFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKHIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPDVSSPTDTSNFDSFPEDSEDPPPDDNSGWDTDF 660          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000002114.2 (cGMP-dependent protein kinase 2-like [Source:NCBI gene;Acc:103041230])

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 333/723 (46.06%), Postives = 457/723 (63.21%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQ----------------REIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGE-SSNH----QRFQTLN----KFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQT--KEY------DDESRAKMSLSMHSRNSAESNNLKRESFH-----------LNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            E    E  L+  +RE++ K L+I++LQ                R   +L SV++Q  +             +KA+    G+S E +S H     R Q ++    +  K + +KK+I +AIMNN  L KL+P    E+++CMYEK    N  VI+EGE G  LYV  EG  EV ++ KL+G+M     FGELA+LYNCKRTA+VKA+    +W LDR  FQ+IMM++   R ++  +FL SV+L + L E KL KIV+ +E+  +  G+ IIR+GEE ++FFII  G V VTQ   G  + +E++ +  G+YFGEKAL+ E  R+ANI A +  T+ L + R  F++++G    LQ   +EY      +DE R   + S     S ++  L+  S H           L   +I+ATLG GGFGRVELV   K+   ++ALK +KK++IV T+QQ+H+ SEK IL +   ++I RL+ TF D KYVY+L EVCLGGELW++LRD   F++   RFC+ CVLEA  YLH  GIVYRDLKPENLL+   GY+K+ DFGFAK+IG+G +TWTFCGTPEYVAPE+I+NK HDF  D WS+GIL +ELL G+PPF  +DP+KIY M L GIE+ +I    +I+ +   LI+RLC+  P ERLGN KNGI +I+ HK+FQGF+WEG++   + SP   ++NGP D S+FD F  E + PPDE SGWDKDF
Sbjct:   57 ELRAQELQLQTLQRELEAKVLQIDKLQDAIGYNNLGRSPPAPARPSHRLLSVINQGSTRFHRVAVEVHRR-LKAKE---GVSAEPTSGHFCKEHRTQHVSIERTRIRKDSGIKKLINEAIMNNDFLKKLEPQHTREMVDCMYEKVYTANQLVIQEGEPGNYLYVLAEGLLEVIQNGKLLGQMRPGTAFGELAILYNCKRTATVKAVTQSHIWALDRQTFQSIMMRSTQARHEEYFSFLRSVSLLKDLPEEKLAKIVDCLEIDYFDKGEYIIREGEEGNTFFIIAKGEVSVTQSTEGYSEPLEIKILGVGDYFGEKALISEDVRSANIIAKENDTQCLVVDRDNFNQMVGTYEELQAYLREYVEQLSINDERRIAATQSPLYERSPQAAELR--SLHEKAARLSSCSFLQQLQIIATLGMGGFGRVELV-KLKNEDTAFALKCIKKKHIVDTRQQEHIYSEKNILQQTNCNFIVRLFRTFRDEKYVYMLLEVCLGGELWSVLRDMSFFEEATARFCIGCVLEAFDYLHGMGIVYRDLKPENLLLDAEGYVKMTDFGFAKRIGLGKKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILIFELLIGSPPFSGSDPIKIYTMVLHGIEKVDIPK--RISKRPEDLIRRLCKLNPAERLGNKKNGIIDIKKHKWFQGFNWEGLRRRKLASPLRRELNGPLDHSHFDMFPPELEEPPDELSGWDKDF 770          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 294/647 (45.44%), Postives = 414/647 (63.99%), Query Frame = 3
Query:  600 KARSKRLGISGE-SSNHQRFQTLNKFP-------KSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE--VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVL--------QTKEYDDESR-AKMSLSMHSRNSAESNN---LKRESF----HLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            K +  + G+S E SS      ++ KF        K   VKK++  A+  N  L +L+  Q+ +++ECMYE+   +  FVI++GE G  L+V  +G  +VY++ KL+  ++    FGELA+LYNC RTASVKA      WVLDR +F  IM  T   R +  ++FL SV+L   L E KL KIV+ +EV+ Y  G  +IR+GEE ++F+II  G VKVTQ     E    +  +  G+YFGEKAL+ +  R+ANI A +   E L + R+ F++ +G  + L        +T   DD+ R AK S S    +S  S +   L+ ++F      ++ EI+ATLG GGFGRVELV   K+   ++ALK +KK++IV  +Q++H+ SE++IL E  S +I ++Y TF D+KYVY+L E CLGGE+W++LRDR  F++   +FC+ CV EA  YLH++ I+YRDLKPENL++ + GY+KL DFGFAKK+  G +TWTFCGTPEYVAPEIILNK H  SVDFW++GIL +ELL G+PPF  +D M  Y   LKG+E+ +     KI+ +   LI++LC+  P ERLGN KNGI +I+ H++F GF W G+K+ T+ SP   ++ GP D S FD +  E +IPPDE SGWD DF
Sbjct:  124 KRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARDDKKRNAKRSGSNTPPSSPLSLDRIQLREKNFTSTLSFSNLEIIATLGIGGFGRVELV-KVKNENVTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFPK--KISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 767          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg1a (protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1308])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 306/685 (44.67%), Postives = 425/685 (62.04%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQ----RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQK--INGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDD-ESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E    ++L+   + E+D+K+  I++LQ E+DK +SV+      +    +       + R+KR  IS E +          TL   PKS + K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F  L E  L K+ +++E   Y DG  IIRQG   D+FFII  G V VT++   + + + +R +  G++FGEKAL        N   +   T + C    ++  LIG L  + +K  +D E++AK           E+ N    + HL+DF I+ TLG GGFGRVELV    D  K++A+K +KK++IV T+QQ+H+ SEK I+ E  S +I     TF D+KY+Y+L E CL      I   R  FDD  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + G     DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ L+GI+   I    KIT  AA+LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG++  T+  P +P +    DTSNFD F  ++ D PPD+NSGWD DF
Sbjct:   17 ELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQVQKHSELQE----QQRTKRQAISAEPTAFDIQELSHVTLPFNPKSAQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYSKDSCIIKEGDVGSLVYVMEDGKVEVTKEGLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFHGLPEEILSKLGDVLEETHYEDGDYIIRQGARGDTFFIISKGKVTVTREDAASQETVYLRSLGKGDWFGEKALQGNQISCLNTDLITLSTFINCW---SYKHLIGGLEDVSSKGSEDAEAKAKY----------EAENAFFFNLHLSDFNIIDTLGVGGFGRVELVQLKSDEYKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIT--VQTFKDSKYLYMLHEACLEESCGPIPETRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRG-----DFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAANLIKKLCRDTPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPSSP-VTSATDTSNFDSFPEDNEDPPPDDNSGWDGDF 674          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 532.332 bits (1370), Expect = 5.434e-178
Identity = 283/647 (43.74%), Postives = 397/647 (61.36%), Query Frame = 3
Query:  600 KARSKRLGISGE-SSNHQRFQTLNKFP-------KSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE--VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVL--------QTKEYDDESR-AKMSLSMHSRNSAESNN---LKRESF----HLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            K +  + G+S E SS      ++ KF        K   VKK++  A+  N  L +L+  Q+ +++ECMYE+   +  FVI++GE G  L+V  +G  +VY++ KL+  ++    FGELA+LYNC RTASVKA      WVLDR +F  IM  T   R +  ++FL SV+L   L E KL KIV+ +EV                          VKVTQ     E    +  +  G+YFGEKAL+ +  R+ANI A +   E L + R+ F++ +G  + L        +T   DD+ R AK S S    +S  S +   L+ ++F      ++ EI+ATLG GGFGRVELV   K+   ++ALK +KK++IV  +Q++H+ SE++IL E  S +I ++Y TF D+KYVY+L E CLGGE+W++LRDR  F++   +FC+ CV EA  YLH++ I+YRDLKPENL++ + GY+KL DFGFAKK+  G +TWTFCGTPEYVAPEIILNK H  SVDFW++GIL +ELL G+PPF  +D M  Y   LKG+E+ +     KI+ +   LI++LC+  P ERLGN KNGI +I+ H++F GF W G+K+ T+ SP   ++ GP D S FD +  E +IPPDE SGWD DF
Sbjct:  124 KRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEV--------------------------VKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARDDKKRNAKRSGSNTPPSSPLSLDRIQLREKNFTSTLSFSNLEIIATLGIGGFGRVELV-KVKNENVTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFPK--KISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 741          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002200.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 384.8 bits (987), Expect = 3.700e-127
Identity = 171/312 (54.81%), Postives = 230/312 (73.72%), Query Frame = 3
Query: 1527 EIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            +++ATLG GGFGRV+LV   KD   ++ALK +KK+++V+++QQ+HV SEK+IL EC   +I R Y TF D K+V+LL E CLGGELW++LRD   F +   RFC+ACV+EAL+YLH+RGI+YRDLKPENLL+   GY+K+ DFGFAKK+  G + WTFCGTPEYV PE+I+N+ HD   D W++G+L YELL G PPF   DPMK YN  L G+E+ +  +  ++  +A  +I+RLCR  P ERLGN K+G+ ++R HK+FQGFDWE ++S  + SP   +++GP D  NFD F  + D+PPDE SGWD DF
Sbjct:   35 DVIATLGVGGFGRVQLV-KLKDSDVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVRFYRTFRDQKFVFLLMEACLGGELWSVLRDSGGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPN--EVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHDF 343          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002201.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002201.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.553 bits (828), Expect = 1.224e-104
Identity = 154/310 (49.68%), Postives = 207/310 (66.77%), Query Frame = 3
Query: 1533 VATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            +ATLG GGFGRV+LV   KD   ++ALK +KK+++V+++QQ+HV SEK+IL EC   +I R                   GG           F +   RFC+ACV+EAL+YLH+RGI+YRDLKPENLL+   GY+K+ DFGFAKK+  G + WTFCGTPEYV PE+I+N+ HD   D W++G+L YELL G PPF   DPMK YN  L G+E+ +  +  ++  +A  +I+RLCR  P ERLGN K+G+ ++R HK+FQGFDWE ++S  + SP   +++GP D  NFD F  + D+PPDE SGWD DF
Sbjct:    1 IATLGVGGFGRVQLV-KLKDSDVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVR-------------------GG-----------FQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPN--EVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHDF 277          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.18 bits (583), Expect = 7.096e-69
Identity = 113/270 (41.85%), Postives = 171/270 (63.33%), Query Frame = 3
Query: 1608 ALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINE 2417
            +LK  K+  +V+ KQ +H ++EK+IL      ++ RL  +F DN  +Y++ E   GGE+++ LR    F +  +RF  A ++ A  YLHS  ++YRDLKPENLL+   GY+++ DFGFAK+  + GRTWT CGTPEY+APEIIL+K ++ +VD+W++G+L YE+  G PPF A+ P++IY   + G  +     +F   +K   L++ L +    +R GN KNG+ +I+ HK+F   DW  +    V++PF PK  GP D SNFD +  E
Sbjct:    8 SLKATKRTKVVKLKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKR--VKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLK--DLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFDDYEEE 271          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 2.414e-55
Identity = 115/333 (34.53%), Postives = 183/333 (54.95%), Query Frame = 3
Query: 1410 LQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLE-CKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKK-IGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFD 2402
            LQ     ++++  M       N   S NL+ +    +DF+ +  LG G FG+V L+   K     YA+K MKK  I+Q K++ H+M+E+ +L++  +  ++  L+ +F     +Y + +   GGEL+  L+ +  F +   +F  A +  A+ YLHS  IVYRDLKPEN+L+   G++ L DFG  K+ I     T TFCGTPEY+APE++    +D +VD+W +G + YE+L G PPF + +  ++Y   L    Q         T  A S+++ L    P +RLG   + I EI+ H +F   +W  + +  + SP+NP ++GP D  NFD
Sbjct:   57 LQLDNPRNQTQGPMENDADHINLGPSANLQAKP---SDFDFLTVLGKGSFGKV-LLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPC----TTNAAISVLEGLLHKDPHQRLG-ATSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFD 380          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.037 bits (471), Expect = 3.508e-51
Identity = 107/313 (34.19%), Postives = 175/313 (55.91%), Query Frame = 3
Query: 1515 LNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAIL-RDRIHFDDYITRFCLACVLEALSYLHS-RGIVYRDLKPENLLVGNSGYLKLCDFGFAKK-IGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDI---PPD 2435
            +N+F+ +  LG G FG+V ++V  K   + YA+K +KK+ IV   +  H ++E ++L   K  ++  L  +F  +  +  + E   GGEL+  L R+R+  +D  TRF  A ++ AL YLH+ + +VYRDLK ENL++   G++K+ DFG  K+ I  G    TFCGTPEY+APE++ +  +  +VD+W +G++ YE++ G  PF   D  K++ + L      +I     ++  A +L+  L +  P +RLG G +  +EI  H +F G  W+ +    +  PF P++    DT  FD+      I   PPD
Sbjct:  147 MNNFDYLKLLGKGTFGKV-ILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDR-TRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL----MEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPD 453          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 235.343 bits (599), Expect = 3.833e-70
Identity = 116/304 (38.16%), Postives = 189/304 (62.17%), Query Frame = 3
Query: 1509 FHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKI-NGPKDTSNFDKFINE 2417
            + L+DF+I+ TLG G FGRV LV +  +  + YA+K +KKQ +V+ KQ +H   E+++L   +  ++ R++ TF D + ++++ +   GGEL+++LR    F + + +F  A V+ AL YLH+  I+YRDLKPEN+L+  +G++K+ DFGFAK++     TWT CGTP+Y+APE+I  K ++ SVD+WS+G+L YE+L G  PF    PMK Y   L+G     +++          L+ +L       R+GN ++G  +I+ H +F    WE + +  +++P+ P I +G  DTS FD++  E
Sbjct:   65 YTLHDFQIMRTLGTGSFGRVHLVRSVHN-GRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT--VTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQG----KVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEE 361          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 231.876 bits (590), Expect = 9.534e-69
Identity = 119/304 (39.14%), Postives = 185/304 (60.86%), Query Frame = 3
Query: 1509 FHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKI-NGPKDTSNFDKFINE 2417
            + L DF+I+ TLG G FGRV L+  S+   + YA+K +KK+ +V+ KQ +H   E+ +L      +I R++ TF D + ++++ +   GGEL+++LR    F + + +F  A V  AL YLHS+ I+YRDLKPEN+L+  +G++K+ DFGFAK   +   T+T CGTP+Y+APE++  K ++ S+D+WS GIL YE+L G  PF  ++ MK Y   L    +     N  +      L+ RL      +RLGN +NG E+++ H +F+   WE + S  +++P+ P I  G  DTS FDK+  E
Sbjct:   82 YSLQDFQILRTLGTGSFGRVHLI-RSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY--VPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDV----KDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEE 378          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 230.72 bits (587), Expect = 2.323e-68
Identity = 120/305 (39.34%), Postives = 189/305 (61.97%), Query Frame = 3
Query: 1509 FHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKG-IEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKI-NGPKDTSNFDKFINE 2417
            + L+DF+I+ TLG G FGRV L+ ++ +  + YALK +KK  IV+ KQ +H   E+++L      +I R++ TF D++ V+++ +   GGEL+++LR    F + + +F  A V  AL YLHS+ I+YRDLKPEN+L+  +G++K+ DFGFAK   +   T+T CGTP+Y+APE++  K ++ SVD+WS G+L YE+L G  PF  ++ MK Y   L   ++     H       A  L+++L      ERLGN +NG E+++ H +F    WE + +  +++P+ P I  G  DTS FD++  E
Sbjct:   83 YSLSDFQILRTLGTGSFGRVHLIRSNHN-GRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY--VPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHP-----DAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEE 379          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 197.978 bits (502), Expect = 5.087e-54
Identity = 118/334 (35.33%), Postives = 178/334 (53.29%), Query Frame = 3
Query: 1431 DESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAK-KIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFD-KFINESDI 2426
            D    K+++S+  + S      + +   ++DF+++  +G G FG+V + V  KD  K YALK ++K YIV   +  H ++E+ +L      +I  L  +F   + +Y +     GGEL+  L+    FD    RF  A +L AL  LH   +VYRDLKPEN+L+   G++ LCDFG  K  +    +T TFCGTPEY+APE++L   +  +VD+W++G+L YE+L G PP+   D  K+Y    K I Q  ++        A  L+  L    P  RL  G NG +EIR H +F    W+ +       P+ P ++   DTSNFD +F  E  I
Sbjct:  322 DNGLGKINISIDYKPS------RNKPLSIDDFDLLKVIGKGSFGKV-MQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMY----KKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRL--GYNGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPI 642          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 194.126 bits (492), Expect = 9.056e-53
Identity = 113/312 (36.22%), Postives = 171/312 (54.81%), Query Frame = 3
Query: 1497 KRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAK-KIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDK-FINESDI 2426
            K +   ++DF+++  +G G FG+V + V  KD  K YALK ++K YIV   +  H ++E+ +L      +I  L  +F   + +YL+     GGEL+  L+    F    +RF +A +L AL  LH   ++YRDLKPEN+L+   G++ LCDFG  K  +    +T TFCGTPEY+APEI+L + +  +VD+W++GIL YE++ G PP+   +   +Y    K I Q  +L        A  L+  L    P  RL  G NG +EIR H +F+   W+ +       P+ P +    DT+NFD+ F  E  I
Sbjct:  335 KNKPLSIDDFDLLKVIGKGSFGKV-MQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMY----KKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRL--GVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPI 639          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 338/673 (50.22%), Postives = 450/673 (66.86%), Query Frame = 3
Query:  462 AAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQRF----QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKIN--GDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            A ++E+  K+  I  L+ E+DK +SVL    S              +AR++R GIS E  + ++     + L + PK++  K++I++AI++N  L  L+ SQV E++ECM E+    + ++I+E E G  LYV +EG+ +V K+  ++G M   K FGELA+LYNC RTASV+A  +  LW +DR  FQTIMMKTGL R  +   FL SVNL + L+E  LLKI +++E   Y +G+ IIRQG   D+FFII++G V +TQ+ N   D + VR +S G YFGEKAL  E  RTAN  A KG    L L R+AF + IG+L+ +Q  +YDD  R    +   + +   +   +  +  L D  +V TLG GGFGRVELV  + D  +++ALK +KK +IV+T+QQDH+MSEKKI++E  S +I RL+ TF D KY+Y+L EVCLGGELW ILRDR  FDD  TRF + CV+EA  YLHS+GIVYRDLKPENLL+   GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL YELL G+PPF   DPMK YN+ LKGI+  +     KIT  A +LI++LCR  P+ERLG  K G+++I  HK+F GF+W+G++S  + SP  PKI  P D SNFD +  + DIPPD+ +GWDKDF
Sbjct:    2 ALEQELRRKDELIRRLESELDKYRSVLQPPASAGPGGRS-------RARNQRQGISAEPQSAKQVADSSKPLQRHPKNSRSKELIKEAILDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGKCQVTKEGTVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQTIMMKTGLMRTAEHMEFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNVDITQRTNVHSDPVHVRNLSKGAYFGEKALKGEDLRTANCIAGKGGVTCLVLDREAFVQFIGNLDDIQRDQYDDSQRG---VDPQTASHLRAQQDEFANVRLEDLTVVKTLGIGGFGRVELVQVAGD-KRTFALKTLKKHHIVETRQQDHIMSEKKIMMESNSPFIVRLHKTFKDKKYLYMLLEVCLGGELWTILRDRGSFDDSTTRFYVGCVIEAFQYLHSKGIVYRDLKPENLLLDGHGYCKLVDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGTDPMKTYNIILKGIDMIDFPR--KITRNAHALIKKLCRDNPVERLGYQKGGLKDIMKHKWFDGFNWDGLRSRKLNSPIAPKIKSPVDASNFDDYPADDDIPPDDMTGWDKDF 661          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 304/648 (46.91%), Postives = 414/648 (63.89%), Query Frame = 3
Query:  606 RSKRLGISGESSNHQRFQT-----LNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGD--EIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESR-AKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYF------------------QGFDWEGMKSMTVK-SPFN--PKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            + KR  +SGESS   + ++     L +FPK    K++I+ AI  N  L  L+ +QV EI++CMY      N  +I+EG+ G  LY   +G  +V ++ K++G+M     FGELA+LYNC+RTA+V A++   LW +DR +FQ IMM+TG+ RQ +   FL+SV L + L   +L K+ +++EV  Y  G  IIR+ E  D+F+II  G  +VTQ+I G     E+R++  G+YFGEKALL E +RTAN+ A +   E L + R  F  +IG+++ L+ K+Y DE R AK +L +       S         L D E+VATLG GGFGRVELV        +YALK +KK++I+ T+QQ+HV SEK+IL+E  S +IC++Y TF D KYVY+L E CLGGELW ILRDR  F+D   RFC+ACV+E   YLHS+GIVYRDLKPENLL+   GY+KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL +ELL G+PPF ++DPMK YN+ L+G++        +I     +LI+RLC+  P+ERLG  K+G+ +I+ HKY                   Q   W    +++ K SP     ++    D SNFD +  + DIPPDE SGWD++F
Sbjct:   19 KEKRQAVSGESSTKAQEESRTGKELERFPKDFRSKQLIKDAIFENDFLKNLEAAQVREIVDCMYSNTFQRNDVIIQEGDAGNALYAIADGRLQVTRENKVLGEMVAGMVFGELAILYNCRRTATVTAMEPTKLWKIDRRVFQIIMMRTGMIRQAEHMAFLKSVPLLKELPNAELSKLADVLEVDFYHAGDYIIRENERGDTFYIITKGSARVTQRIEGQTGPKEIRKLQKGDYFGEKALLSEDRRTANVIAEENGVECLVVDRTVFMTVIGNMDELREKDYGDEKRGAKRTLDVPEEERKVSKEFA--DLTLEDLEVVATLGTGGFGRVELV--------TYALKCLKKKHILDTRQQEHVYSEKRILMETNSPFICKIYRTFKDRKYVYMLLEACLGGELWTILRDRGTFEDATARFCIACVVEGFEYLHSKGIVYRDLKPENLLLDAKGYVKLVDFGFAKKIGSGRKTWTFCGTPEYVAPEIILNKGHDLSSDYWSLGILIFELLTGSPPFSSSDPMKTYNIILRGLDMVEFPK--RIGRNPQNLIKRLCKDNPVERLGYQKDGLSDIKKHKYVVPWFPLAGTHRRDPRTSNQTRFWLMTTTLSFKTSPIYLLIRVESSTDYSNFDVYSKDMDIPPDEMSGWDENF 654          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 251.136 bits (640), Expect = 2.493e-76
Identity = 136/322 (42.24%), Postives = 192/322 (59.63%), Query Frame = 3
Query: 1476 SAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKG-IEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES--DIPP 2432
            +A S   K +   L DFE+  TLG G FGRV L+   +   + YALK M    +++ KQ +HV +EK IL+  +  +I  L  T HD  ++Y+L E   GGEL+  LR    F++    F  + ++ A+ YLH   IVYRDLKPEN+L+   G++KL DFGFAK+  +  +TWT CGTPEY+APEII +K H+ +VD+W++GIL YE+L G PPF  ++P  IY   L G +E    + N      A  LI++L  +    RLG+ KNG E+++ HK+F+  DW  +    +K P NPKI+ P DT NFD +  E     PP
Sbjct:    2 AAVSTRKKDKRTTLQDFELSKTLGTGTFGRV-LLARDRRGGEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAKE--VHDKTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSGKVEWPKHMDN----TSAKDLIKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYPEEDWRGAPP 316          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 201.06 bits (510), Expect = 5.468e-57
Identity = 113/352 (32.10%), Postives = 190/352 (53.98%), Query Frame = 3
Query: 1428 DDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLE-CKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKK-IGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILH-----NFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            +DE        +   +  ESNN K +    +DF  +  +G G FG+V L  N ++  K YA+K + K  I +  +  H+M+E+ +L++     ++  L+ +F     +Y + +   GGEL+  L+   +F +   RF  A +  A+ YLH   I+YRDLKPEN+L+ + G++ L DFG  K+ I   G T TFCGTPEY+APE++  + +D SVD+W +G + YE++ G PPF + D  ++Y+         NILH        I+  A  +++ L +    +RLG+G+   E+IR H +F+  +W+ + +  ++ P+NP ++G  D  +FD       +P       D +F
Sbjct:   45 EDEQPGSDDADVEKIDLGESNNPKAKP---SDFLFLKVIGKGSFGKVFLSKNKQE-DKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYD---------NILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFDPEFVREPVPGSVGKSADSNF 383          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 200.29 bits (508), Expect = 1.161e-56
Identity = 124/329 (37.69%), Postives = 185/329 (56.23%), Query Frame = 3
Query: 1476 SAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKS--YALKYMKKQYIVQT-KQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAIL-RDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKK-IGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFD-KFINESDI-PPDEN 2441
            S E+ N K E      FE++  LG GG+G+V LV  +   +K   +A+K +KK  I+++ K   H  +E+ IL   K  +I  L   F     +YL+ E   GGEL+  L R+ I  +D    F L+ +  AL +LH +GIVYRDLKPEN+L+  +G++KL DFG  K+ I     T TFCGT EY+APEI+    H  +VD+WS+G L Y++L G PPF A++  K  +  LKG     ++    +T +A   I++L +  P  RLG        I+ H +F+   WE + +  V+ PF P I+G +D S FD KF  ++ +  PD++
Sbjct:   49 SEETVNPKDEKVGPESFELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTAC-FYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKG----KLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFDSKFTRQTPVDSPDDS 372          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 326/685 (47.59%), Postives = 448/685 (65.40%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQ----RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQK--INGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDD-ESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINES-DIPPDENSGWDKDF 2462
            E    ++L+   + E+D+K+  I+ LQ E+DK +SV+      +   ++       + R+KR  IS E +          TL  +PKS + K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F  L E  L K+ +++E   Y+ G+ IIRQG   D+FFII  G V VT++   NG+ + +R +  G++FGEKAL  E  RTA++ A +  T  L + R +F  LIG L  + +K +DD +++AK           E+ N    S +L DF I+ TLG GGFGRVELV    D  K++A+K +KK++IV T+QQ+H+ SEK I+ E  S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL +ELL G+PPF   DPMK YN+ L+GI+   I    KIT  A +LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG+K  T+  P  P +  P DTSNFD F  ++ D PPD+NSGWD DF
Sbjct:   17 ELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNELHE----QQRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPNGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAEAVT-CLVIDRDSFKHLIGGLEDVSSKGHDDADAKAKY----------EAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVTSPVDTSNFDSFPEDNEDPPPDDNSGWDVDF 684          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: ENSORLT00000001302.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 312/642 (48.60%), Postives = 421/642 (65.58%), Query Frame = 3
Query:  621 GISGESSNHQRF---------QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQT--KEY------DDESRAKMSLSMHSRNSAESNNLKR---------ESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            G+S E  +   F          T     K+++ K++I +AI++N  L KL+P  + E+++CMYEK   E   VI+EG+ G  LYV  EG  EV ++ KL+G+M     FGELA+LYNCKRTA+VKA+    +W L+R  FQTIMM+T   R ++  TFL SV+L + L E KL +IV+ +EV+ +  G+ IIR+GEE ++FFII  G V VTQ   G     E++ +  G+YFGE+AL+ E  R+ANI   +  T+ L + R  F++++G    LQT  KEY       DE R  +  S  S +S E+  L R          +    + E++ATLG GGFGRVELV   KD   ++ALK +KK+++V T+QQ H+ SEKKIL +  SS+I RL+ TF DNKY+Y+L EVCLGGELW +LRD   F++   RFC+ CVLEA  YLHS GI+YRDLKPENLL+   GY+K+ DFGFAK+IGIG +TWTFCGTPEYVAPE+I+NK HDF  D WS+GIL +ELL G PPF  +DP+KIY M L GI++ +     +I  +   LI+RLC+  P+ER+GN KNGI +I+ HK+FQGF+WEG++   + SP   ++ GP D SNFD F   S+  PDE SGWDKDF
Sbjct:  131 GVSAEPPSADNFLWRYRPSSVSTARTVHKNSDTKRLINEAILSNDFLKKLEPQHMREMVDCMYEKVYSEGQLVIQEGDAGNYLYVLAEGLLEVIQNGKLLGEMHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKLGRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVTQSSEGFTQPQEIKTLGVGDYFGERALISEDVRSANIICNENDTQCLVVDRDNFNQMVGTYEELQTYLKEYVGELSKSDERRHFLPHSQQS-DSPEAQELSRLRERTARIPANQPFQELEVIATLGMGGFGRVELV-KLKDEESTFALKCIKKKHVVDTRQQQHIYSEKKILQQTNSSFIIRLFRTFRDNKYIYMLLEVCLGGELWTVLRDMSCFEEQTARFCIGCVLEAFDYLHSMGIIYRDLKPENLLLDADGYVKMADFGFAKQIGIGRKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILVFELLTGNPPFSGSDPIKIYTMVLHGIDRVDFPK--RIGKRPDDLIRRLCKLNPVERIGNKKNGIMDIKKHKWFQGFNWEGLQGRKLPSPLKRELRGPMDHSNFDMFPPNSEEAPDELSGWDKDF 768          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:101158535])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 302/644 (46.89%), Postives = 419/644 (65.06%), Query Frame = 3
Query:  600 KARSKRLGISGE--SSNHQRFQ-TLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE--VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQ--------TKEYDDESRA-KMSLSMHSRNSAESN--------NLKRESFHLNDFEIVATLGFGGFGRVELV-VNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            + +  + G+S E  SS+ Q+F     + PK   VKK++  A+  N  L +L+  Q+ +++ECMYE++  +   VI++GE G  L+V  EG+ EV++  KL+  ++    FGELA+LYNC RTASV+A+     W LDR  FQ IM +T   R +  + FL SV+L  +L + KL KIV+ +EV+ Y  G+ IIR+GEE  +F+II  G VKVTQ     ++   +  +  G+YFGEKAL+ +  R+ANI A     E L + R+ F + +G+ N LQ        + + DD+ R  K S+S H   S            +L   S   +  E++ATLG GGFGRVELV V  +D T  +ALK +KK+++V+ KQ++H+ SE++IL E +S +I RLY TF D+KYVY+L E CLGGE+W++LRDR  FDD   +FC+ CV EA  YLH +G++YRDLKPENLL+   GY+KL DFGFAKKI  G +TWTFCGTPEYVAPEIILNK H+FSVDFW++GIL +ELL G+PPF  +D M IY   LKGIE+ +      I+ +   LI++LCR  P ERLGN KNGI +I+ H++F GF+WEG+K+ T+ SP   ++ GP D S FD +  + D PPDE SGWD+DF
Sbjct:  130 RRKGAKSGVSAEPTSSSLQKFSFEKARVPKDASVKKLLTDALNKNQYLRRLELQQIKDMVECMYERNYQQGECVIKQGEPGNHLFVLAEGKLEVFQHNKLLTWITVWTTFGELAILYNCTRTASVRAVNKVKTWALDREAFQNIMRRTAETRHEQYRNFLRSVSLLANLPDDKLSKIVDCLEVEYYDKGEYIIREGEEGSTFYIIAQGKVKVTQTTEAHKLPQIINALQKGDYFGEKALVSDDVRSANIIADDNGVECLVIDRETFDQTVGNFNELQKHLQGYVASLDRDDKKRHLKKSVSRHQSQSLSPGFMQLKDMVSLFTSSRPFHHLEVIATLGVGGFGRVELVKVKGEDVT--FALKAIKKKHVVENKQEEHIHSERRILAEARSPFIVRLYRTFKDSKYVYMLLEACLGGEVWSLLRDRGSFDDPTAKFCIGCVTEAFEYLHRKGVLYRDLKPENLLLDMEGYVKLVDFGFAKKIRSGQKTWTFCGTPEYVAPEIILNKGHNFSVDFWALGILVFELLTGSPPFSGSDQMTIYTFILKGIEKMDFPK--MISKRPEDLIRKLCRRNPSERLGNLKNGITDIKKHRWFTGFNWEGLKARTLASPLKRELKGPMDHSYFDSYPPDEDSPPDELSGWDEDF 769          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 308/649 (47.46%), Postives = 425/649 (65.49%), Query Frame = 3
Query:  447 ESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRL-GISGESSNHQRF--QTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQK--INGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDD-ESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKIN 2375
            E  +R  +R + ++  +I+EL+R++ K +SVL                  I  R++R  GIS E   HQ    Q L ++PKS+  K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F  L E  L K+ +++E   Y+ G+ IIRQG   D+FFII  G V VT++   NG+ + +R +  G++FGEKAL  E  RTA++ A +  T  L + R +F  LIG L  + +K +DD +++AK           E+ N    S +L DF I+ TLG GGFGRVELV    D  K++A+K +KK++IV T+QQ+H+ SEK I+ E  S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL +ELL G+PPF   DPMK YN+ L+GI+   I    KIT  A +LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG+K  T+  P  P ++
Sbjct:   16 EERIRDLERRLADREDEIQELKRKLHKCQSVLPSAQL-------------IGPRTRRAQGISAEPQTHQDLSRQALRRYPKSDWSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPNGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAEAVT-CLVIDRDSFKHLIGGLEDVSSKGHDDADAKAKY----------EAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVS 638          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 307/655 (46.87%), Postives = 427/655 (65.19%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQ----RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQK--INGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDD-ESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKIN 2375
            E    ++L+   + E+D+K+  I+ LQ E+DK +SV+      +   ++       + R+KR  IS E +          TL  +PKS + K +I++AI++N  +  L+ SQ+ EI++CMY     ++  +I+EG+ G  +YV ++G+ EV K+   +  M   K FGELA+LYNC RTA+VK L    LW +DR  FQTIMM+TGL +  +   FL+SV  F  L E  L K+ +++E   Y+ G+ IIRQG   D+FFII  G V VT++   NG+ + +R +  G++FGEKAL  E  RTA++ A +  T  L + R +F  LIG L  + +K +DD +++AK           E+ N    S +L DF I+ TLG GGFGRVELV    D  K++A+K +KK++IV T+QQ+H+ SEK I+ E  S +I RLY TF D+KY+Y+L E CLGGELW ILRDR  F+D  TRF  ACV+EA +YLHS+GI+YRDLKPENL++ + GY KL DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD S D+WS+GIL +ELL G+PPF   DPMK YN+ L+GI+   I    KIT  A +LI++LCR  P ERLGN KNG+++I+ HK+F+GF+WEG+K  T+  P  P ++
Sbjct:   17 ELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNELHE----QQRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPNGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAEAVT-CLVIDRDSFKHLIGGLEDVSSKGHDDADAKAKY----------EAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDM--IEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVS 654          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000007783.1 (SMESG000007783.1)

HSP 1 Score: 1399.42 bits (3621), Expect = 0.000e+0
Identity = 709/716 (99.02%), Postives = 711/716 (99.30%), Query Frame = 3
Query:  315 MGNENSKNLNIEYQRKLYGPDPKIXXXXXXXXXXXXXXXEAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            MGNENSKNLNIEYQRKLYGPDPKIKLMNSSNKLNSVSNVEAE HESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTHSDLSFDHDSSSLNDIKARSKRLGISGESSNHQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENC+VIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIG+LNVLQ KEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYIT FCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGP DTSNFDKF NESDIPPDENSGWDKDF
Sbjct:    1 MGNENSKNLNIEYQRKLYGPDPKIKLMNSSNKLNSVSNVEAEKHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTHSDLSFDHDSSSLNDIKARSKRLGISGESSNHQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCYVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGELNVLQAKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITSFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPIDTSNFDKFTNESDIPPDENSGWDKDF 716          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000008788.1 (SMESG000008788.1)

HSP 1 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 408/677 (60.27%), Postives = 510/677 (75.33%), Query Frame = 3
Query:  432 EAENHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            E EN  + L+  + E++EKN++IEELQREI+KL SVLDQT   L  +   SS+N I+ RSK+ G+SGES+  Q    L K+ KSN +K ++R++I+ N LL+ L   QV+E+IE MYE+     C+VI EGEEG+ LYVA+ G+FEV+K E+L+  +   +CFGELALLYNC+RTASVKAL    LWVLDR +FQ IMM+TG++RQ++L  FL+SV L + L E KL K+VEL+E+Q + +G+CIIRQGE AD FFII++G VKVTQ+ +G+E  +R ++ GEYFGEKALL    RTAN+YA    T+VLCLYR+ F ELIGDLN L+ K Y+DE       S       ++   K  +  L D E+V TLG GGFGRVELV  S D   +YALK MKK +IVQTKQQDHV+SEKKILLEC+S +ICRLY TF D K+VY+L EVCLGGELW  LRD+IHFDD IT+FCL CVLEA  YLHSRGI+YRDLKPENLL+  SGYLKLCDFGFAK+IGIG RTWTFCGTPEYV+PEIILNKSHDF+ D+WS+GILTYELL G PPF  NDPMKIY + LKGIE ++I HN +IT +A+S IQ LC++   ERLGNG  G+EEI+ HKYFQGFDWE ++   + SPF+PK+    D SNFD F +E ++PPDE SGWD++F
Sbjct:  187 EIENLRNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHLLSKSSSKVSICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEEF 863          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000016927.1 (SMESG000016927.1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 320/674 (47.48%), Postives = 441/674 (65.43%), Query Frame = 3
Query:  477 IDEKNLKIEELQREIDKLKSVLDQTXXXXXXXXXXXXXXXIKARSKRLGISGESSNHQ--RFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE-----VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLY--RQAFSELIGDLNVLQTKEYD---DESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            + +K+ KI EL  ++DK +SV   T    +      +    + R + LGIS E    +   FQ  + F K ++ K++I+++I+ N  +  L+ SQ+  I++CM       N  +I+EGE G  +YV ++G+  V K+   + +M N+  FGELA+LYNC RTA+V A+  C LW +DR  FQ+IMM+TGL + ++   FL+SV +F+ L E  L KI  ++E   Y++G  IIRQG + D+FFII +G V+VT+K   D+ +     +R+M  GE+FGEKAL +E  RTANI A   P  V CL   R+++ +LIGDL  LQ    D   D  +  +  S   +N A           L D  ++ATLG GGFGRVELV    +  K+YALK +KK +IV+T+QQ+H+M+E+ IL   +S +I RL+ TF D K++Y+L EVCLGGELW+ILRDR  FD+  T+F  ACV+EAL YLHSRGIVYRDLKPENLL+ N G+ K+ DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD   D WS+GIL +ELL G PPF A DPMKIYN+ LKGI+   I    KI+  A +LI++LCR  P ER+G GK G++E + H + + F+W+G+ S T+K P  P+IN P D SNFD++  E+++PPD+ SGWD+DF
Sbjct:   26 LQQKDEKIAELTSQLDKYQSVFSATQKQNNVQSGPHNN---QTRVRGLGISAEPQTAKIANFQP-SFFQKDSKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTKEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAAD-PAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDSPKEILGPSKEYKNLA-----------LKDLVVIATLGIGGFGRVELVQIGDNAKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDA--IEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 681          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000016927.1 (SMESG000016927.1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 311/630 (49.37%), Postives = 421/630 (66.83%), Query Frame = 3
Query:  606 RSKRLGISGESSNH-QRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE-----VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLY--RQAFSELIGDLNVLQTKEYD---DESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            R KR+ ISGES       + L  F K  + K++I+++I+ N  +  L+ SQ+  I++CM       N  +I+EGE G  +YV ++G+  V K+   + +M N+  FGELA+LYNC RTA+V A+  C LW +DR  FQ+IMM+TGL + ++   FL+SV +F+ L E  L KI  ++E   Y++G  IIRQG + D+FFII +G V+VT+K   D+ +     +R+M  GE+FGEKAL +E  RTANI A   P  V CL   R+++ +LIGDL  LQ    D   D  +  +  S   +N A           L D  ++ATLG GGFGRVELV    +  K+YALK +KK +IV+T+QQ+H+M+E+ IL   +S +I RL+ TF D K++Y+L EVCLGGELW+ILRDR  FD+  T+F  ACV+EAL YLHSRGIVYRDLKPENLL+ N G+ K+ DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD   D WS+GIL +ELL G PPF A DPMKIYN+ LKGI+   I    KI+  A +LI++LCR  P ER+G GK G++E + H + + F+W+G+ S T+K P  P+IN P D SNFD++  E+++PPD+ SGWD+DF
Sbjct:  179 RMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTKEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAAD-PAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDSPKEILGPSKEYKNLA-----------LKDLVVIATLGIGGFGRVELVQIGDNAKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDA--IEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 794          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000005347.1 (SMESG000005347.1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 306/627 (48.80%), Postives = 412/627 (65.71%), Query Frame = 3
Query:  600 KARSKRLGISGESSNHQRFQ--TLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKIN--GDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLY--RQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFINESDIPPDENSGWDKDF 2462
            K R+KR  ISGES+ +      T+ +  K ++ K++IR AI +N  +  LDPSQ+ EI+ECM      E  ++I+EGE G  +Y  ++G  EV K   +I +M     FGELA+LYNC RTASV+A   C LW +DR  FQ+IMMKTGL +Q+D   FL+SV  F+ ++   L KI  ++    YS G  IIR+GE+  +F+II  G VKVT+K +   +E+ +R +  G +FGEKAL +E  RTA+I A + P+ V CL   R++++ LIGD+ V   K+Y DE +A+   S            K     L D  ++ TLG GGFGRVELV    D  +++ALK +KK +IV+T QQ+HVM+E+ IL+E  S +I +LY TF D +Y+Y+L EVCLGGE+W ILR+++ FDD  T+F  A V+ AL YLH +GIV+RDLKPEN L+   GY KL DFGFAKKIG   +TWTFCGTPEYVAPEIILNK HDF+VD WS+GIL YEL  G PPF ++DPMK YN+ LKGI+   I  + KI+  A SLI++LCR  P ERLG GK G+ E + H +F+GF+WEG+ S   K P  P++    D SNFD +  + + P ++ SGWDKDF
Sbjct:  249 KMRAKRNAISGESAKYLTTNGITMKRVEKPSKSKELIRSAIYDNDYMKHLDPSQITEIVECMSPVTYHEGSWIIQEGEIGSIVYALEDGLVEVTKSGAIIREMGPGTVFGELAILYNCTRTASVRATTECKLWAIDRQCFQSIMMKTGLRKQEDYIRFLKSVPTFQDMNMETLGKIAGVLGENHYSQGDYIIREGEKGATFYIIEKGRVKVTKKTSKSDEEVFIRHLDRGSWFGEKALRDEDVRTASIIA-ESPSGVDCLVLDRESYNLLIGDI-VNFDKQYPDEDKARRRAS------------KFPELALRDLCVITTLGVGGFGRVELVRIGNDDRRTFALKVLKKYHIVETHQQEHVMNERDILMEVDSEFIVKLYKTFKDRRYLYMLMEVCLGGEVWTILREKVSFDDATTKFYTASVILALEYLHRKGIVFRDLKPENCLLDEKGYCKLTDFGFAKKIGFARKTWTFCGTPEYVAPEIILNKGHDFAVDIWSLGILMYELFTGTPPFTSSDPMKTYNIILKGIQ--TIDFSSKISKHAQSLIKKLCRENPSERLGYGKLGVAEAQKHAWFEGFNWEGLLSKKTKPPIIPQVKSAVDVSNFDLYSPDEETPAEDISGWDKDF 859          
The following BLAST results are available for this feature:
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKG10.000e+047.22protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG10.000e+047.35protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG20.000e+049.00protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG20.000e+049.00protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG20.000e+047.50protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-40.000e+045.70cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+045.70cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+045.70cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+045.70cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+045.70cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkg21D0.000e+050.32gene:FBgn0000442 transcript:FBtr0078042[more]
for0.000e+046.50gene:FBgn0000721 transcript:FBtr0089310[more]
for0.000e+046.50gene:FBgn0000721 transcript:FBtr0089312[more]
for0.000e+046.50gene:FBgn0000721 transcript:FBtr0089304[more]
for0.000e+046.50gene:FBgn0000721 transcript:FBtr0446099[more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg1b0.000e+047.66protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1b0.000e+047.87protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1a0.000e+047.72protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:... [more]
prkg1b0.000e+045.67protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg20.000e+047.32protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk40.000e+047.51calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+047.51calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+047.87calcium/calmodulin-dependent protein kinase IV [So... [more]
tnpo20.000e+046.21transportin 2 [Source:Xenbase;Acc:XB-GENE-968452][more]
ptafr0.000e+046.18platelet activating factor receptor [Source:Xenbas... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkg10.000e+047.22protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg20.000e+049.15protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg10.000e+047.35protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg20.000e+047.66protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg11.249e-12851.68protein kinase, cGMP-dependent, type I [Source:MGI... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8X6H1|EGL4_CAEBR0.000e+045.99cGMP-dependent protein kinase egl-4 OS=Caenorhabdi... [more]
sp|O76360|EGL4_CAEEL0.000e+045.70cGMP-dependent protein kinase egl-4 OS=Caenorhabdi... [more]
sp|Q03042|KGP1_DROME0.000e+050.32cGMP-dependent protein kinase, isozyme 1 OS=Drosop... [more]
sp|P00516|KGP1_BOVIN0.000e+047.50cGMP-dependent protein kinase 1 OS=Bos taurus OX=9... [more]
sp|P0C605|KGP1_MOUSE0.000e+047.35cGMP-dependent protein kinase 1 OS=Mus musculus OX... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HLV40.000e+052.02cGMP-dependent protein kinase OS=Lingula unguis OX... [more]
A0A0X3NTH00.000e+050.49cGMP-dependent protein kinase, isozyme 1 OS=Schist... [more]
A0A0X3PBC40.000e+050.49cGMP-dependent protein kinase, isozyme 1 OS=Schist... [more]
V3Z9120.000e+050.81cGMP-dependent protein kinase OS=Lottia gigantea O... [more]
A0A5N4A4B00.000e+049.93Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg1b0.000e+047.43protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
ENSAMXT00000002114.20.000e+046.06cGMP-dependent protein kinase 2-like [Source:NCBI ... [more]
prkg20.000e+045.44protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg1a0.000e+044.67protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:... [more]
prkg25.434e-17843.74protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002200.13.700e-12754.81pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 ... [more]
ENSPMAT00000002201.11.224e-10449.68pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 ... [more]
ENSPMAT00000001814.17.096e-6941.85pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
ENSPMAT00000006766.12.414e-5534.53pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000008480.13.508e-5134.19pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK23.833e-7038.16cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK19.534e-6939.14cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK32.323e-6839.34cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK15.087e-5435.33S/T protein kinase; phosphorylates, downregulates ... [more]
YPK29.056e-5336.22Protein kinase similar to S/T protein kinase Ypk1p... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO384070.000e+050.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383990.000e+046.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352282.493e-7642.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378005.468e-5732.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411661.161e-5637.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg10.000e+047.59protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
ENSORLT00000001302.20.000e+048.60cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
prkg20.000e+046.89protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg10.000e+047.46protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
prkg10.000e+046.87protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007783.10.000e+099.02SMESG000007783.1[more]
SMESG000008788.10.000e+060.27SMESG000008788.1[more]
SMESG000016927.10.000e+047.48SMESG000016927.1[more]
SMESG000016927.10.000e+049.37SMESG000016927.1[more]
SMESG000005347.10.000e+048.80SMESG000005347.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024190 ID=SMED30024190|Name=cGMP-dependent protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2617bp
CACAGATATAACCCGCTGTCAGATTAGATGCACAGACCGATGAATTTTTG
GCAACATTACATTCGCAGCATCAGTTTAATTCATCATCATCATCATTCAG
AATTTACTGTAATTCATCTATCATTCTCGCTATCAGTTTACATGAGACTT
TCAAATTCGTCTGACTGAGTTTTGGAAAATTCATTTTGAAGATTTATCAC
TGATCACAGCTTCATATATTATTTCTACTCAATACAGCTTCATATAGTTA
GTGGACTCATTTAATGTGATCTTTGATTTATGAGAGACTGATTTTCAATA
AATGATAGTCAATTATGGGCAATGAAAACAGTAAAAATTTGAATATAGAA
TACCAGAGAAAACTATATGGACCAGATCCGAAAATCAAACTGATGAATTC
CTCAAACAAATTGAATTCCGTTAGCAATGTCGAAGCGGAAAACCATGAAA
GTCTTCTCCGTGCGGCTAAAAGAGAAATCGATGAGAAAAATTTAAAAATC
GAGGAGCTGCAAAGAGAAATAGACAAATTGAAATCCGTATTGGATCAGAC
TCACAGTGATCTCAGTTTTGATCATGATTCCAGCTCCTTAAATGATATAA
AAGCAAGATCCAAACGACTTGGAATATCTGGAGAATCTTCAAATCATCAA
AGATTTCAGACTTTAAATAAATTTCCAAAATCAAATGAGGTAAAAAAAGT
CATCCGTCAAGCCATCATGAACAACCATCTCCTCAATAAACTTGACCCTA
GTCAAGTAAATGAAATCATCGAATGCATGTATGAGAAACATGCTGTTGAA
AATTGTTTTGTAATAAGAGAAGGTGAAGAAGGTGAACAACTTTACGTAGC
TCAAGAAGGCGAATTTGAAGTTTATAAAGATGAAAAGTTAATTGGTAAAA
TGAGCAATAAAAAATGTTTTGGAGAATTAGCATTGCTATATAATTGTAAA
AGAACAGCCTCAGTTAAAGCTTTGAAAACTTGCACTTTATGGGTTCTCGA
TCGCACTATGTTTCAAACAATAATGATGAAAACGGGTTTAGAAAGACAAA
AAGATCTCAAAACGTTCTTGGAAAGTGTTAATTTATTTGAGCATCTTTCG
GAACGCAAATTATTGAAAATTGTTGAATTAGTTGAAGTTCAGAGTTATTC
AGATGGACAGTGCATTATTCGCCAAGGAGAAGAAGCTGATAGTTTTTTCA
TTATTCGTACTGGATGGGTTAAAGTTACCCAAAAAATAAACGGAGATGAA
ATTGAAGTTAGAGAAATGTCGTCTGGAGAATATTTTGGAGAAAAAGCTTT
ACTTGAAGAAGGAAAACGAACAGCGAATATTTATGCAGTTAAAGGTCCGA
CAGAGGTTTTGTGCCTTTACAGACAAGCATTTTCAGAGTTGATTGGAGAC
CTAAATGTGTTACAAACTAAAGAGTATGATGATGAGTCAAGAGCCAAAAT
GTCTTTGAGCATGCATTCAAGGAACTCAGCCGAAAGCAATAATCTGAAAC
GCGAAAGTTTCCATCTGAATGATTTTGAAATAGTTGCAACTTTAGGATTT
GGAGGATTTGGAAGAGTGGAATTGGTGGTCAATTCTAAGGATCCTACTAA
AAGTTATGCACTGAAATACATGAAAAAACAATATATCGTGCAAACGAAAC
AACAAGATCATGTTATGTCTGAAAAGAAGATTTTGCTAGAATGTAAATCA
TCATATATTTGCAGATTGTATGCCACATTCCATGATAACAAATACGTGTA
TTTGTTAACTGAAGTTTGTTTGGGCGGTGAACTATGGGCCATATTGAGAG
ATCGTATACATTTTGATGATTACATAACGCGTTTCTGCTTGGCTTGCGTA
CTGGAAGCCCTCAGTTATCTCCACTCCAGGGGCATCGTTTATCGAGATTT
GAAGCCGGAAAATCTGCTAGTTGGAAATTCAGGATATCTGAAATTGTGTG
ACTTTGGTTTTGCTAAGAAAATCGGGATCGGCGGAAGGACTTGGACATTT
TGTGGCACTCCAGAATACGTTGCCCCAGAAATTATACTCAATAAAAGCCA
TGATTTTTCTGTGGACTTTTGGTCCATTGGAATATTAACTTATGAACTAC
TAAACGGAGCCCCTCCTTTTGTTGCCAATGATCCGATGAAGATATATAAT
ATGACATTAAAAGGAATCGAACAATCAAACATCCTTCACAATTTCAAAAT
AACGATAAAAGCAGCATCTTTAATCCAGAGACTTTGTCGTTACCTCCCGA
TTGAACGTTTAGGAAATGGCAAAAATGGAATTGAGGAAATTAGAATGCAC
AAATATTTTCAGGGATTTGACTGGGAAGGAATGAAATCAATGACTGTAAA
GTCACCATTTAATCCAAAGATAAATGGACCAAAAGATACATCGAATTTCG
ACAAATTCATTAATGAATCTGATATTCCACCAGATGAAAATTCAGGATGG
GATAAAGATTTTTGATCCTTTTTACGACTTAATATTTCATTAGAAAATTA
TAAATTTTACAATGCCAAAAATTATGAAGTTATTTAAACAACTGTATTGC
ACAAAATATTATTTTCTTATTTGTTGATTACATCTGAATTGCATTTTAAA
ATAAAGCAAGATTTAAG
back to top

protein sequence of SMED30024190-orf-1

>SMED30024190-orf-1 ID=SMED30024190-orf-1|Name=SMED30024190-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=717bp
MGNENSKNLNIEYQRKLYGPDPKIKLMNSSNKLNSVSNVEAENHESLLRA
AKREIDEKNLKIEELQREIDKLKSVLDQTHSDLSFDHDSSSLNDIKARSK
RLGISGESSNHQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNE
IIECMYEKHAVENCFVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKK
CFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKT
FLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTG
WVKVTQKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLC
LYRQAFSELIGDLNVLQTKEYDDESRAKMSLSMHSRNSAESNNLKRESFH
LNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHV
MSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHF
DDYITRFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFA
KKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAP
PFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLG
NGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPKDTSNFDKFIN
ESDIPPDENSGWDKDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035014STKc_cGK
IPR000961AGC-kinase_C
IPR000595cNMP-bd_dom
IPR000719Prot_kinase_dom
IPR014710RmlC-like_jellyroll
IPR002374cGMP_dep_kinase
IPR008271Ser/Thr_kinase_AS
IPR018488cNMP-bd_CS
IPR017441Protein_kinase_ATP_BS
IPR018490cNMP-bd-like
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0004692cGMP-dependent protein kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030553cGMP binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 41..82
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 489..685
e-value: 4.2E-98
score: 329.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 401..696
e-value: 4.2E-98
score: 329.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 694..716
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 701..716
NoneNo IPR availablePANTHERPTHR24353:SF90coord: 37..716
NoneNo IPR availablePANTHERPTHR24353CYCLIC NUCLEOTIDE-DEPENDENT PROTEIN KINASEcoord: 37..716
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 666..716
e-value: 4.4E-8
score: 42.8
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 666..716
score: 12.438
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 257..378
e-value: 1.2E-25
score: 101.2
coord: 139..252
e-value: 2.3E-19
score: 80.3
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 162..239
e-value: 2.6E-15
score: 56.3
coord: 276..360
e-value: 2.5E-20
score: 72.3
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 257..377
score: 30.546
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 139..254
score: 33.204
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 257..371
e-value: 1.77343E-28
score: 108.182
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 139..239
e-value: 1.34908E-23
score: 94.3149
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 404..665
e-value: 8.4E-79
score: 277.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 405..665
e-value: 2.0E-63
score: 214.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 404..665
score: 42.873
IPR002374cGMP-dependent kinasePIRSFPIRSF000559cGMP-dep_kinasecoord: 4..716
e-value: 7.8E-275
score: 911.2
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 107..243
e-value: 9.5E-45
score: 153.5
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 244..381
e-value: 4.7E-35
score: 122.2
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 324..341
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 284..300
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 202..219
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 524..536
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 410..434
IPR035014cGMP-dependent protein kinase, catalytic domainCDDcd05572STKc_cGKcoord: 410..672
e-value: 1.59724E-143
score: 418.167
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 251..363
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 112..239
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 384..706