60S ribosomal protein L31

Overview
Name60S ribosomal protein L31
Smed IDSMED30024189
Length (bp)443
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L31 (SMED30024189) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L31 (SMED30024189) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L31 (SMED30024189) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L31 (SMED30024189) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024189

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024189SMESG000017099.1 SmedASXL_018687SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30024189SMESG000017099.1 SmedASXL_018687SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024189SMESG000017099.1 dd_Smed_v4_113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024189SMESG000017099.1 Contig32142newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024189SMESG000017099.1 Contig32142uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024189SMESG000017099.1 Contig35372newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024189SMESG000017099.1 Contig35372uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024189SMESG000017099.1 SMESG000017098.1 Contig11522newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024189SMESG000017099.1 SMESG000017098.1 Contig11522uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30024189SMESG000017099.1 OX_Smed_1.0.08460ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30024189SMESG000017099.1 dd_Smed_v6_113_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L31 vs. Ensembl Human
Match: RPL31 (ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC:10334])

HSP 1 Score: 164.081 bits (414), Expect = 1.385e-52
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. Ensembl Human
Match: RPL31 (ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC:10334])

HSP 1 Score: 164.081 bits (414), Expect = 1.385e-52
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. Ensembl Human
Match: RPL31 (ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC:10334])

HSP 1 Score: 159.073 bits (401), Expect = 9.954e-51
Identity = 72/95 (75.79%), Postives = 85/95 (89.47%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTV 406
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK K ++
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKSKFSI 120          
BLAST of 60S ribosomal protein L31 vs. Ensembl Human
Match: RPL31 (ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC:10334])

HSP 1 Score: 157.918 bits (398), Expect = 4.084e-50
Identity = 71/90 (78.89%), Postives = 82/90 (91.11%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFK 391
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFK 115          
BLAST of 60S ribosomal protein L31 vs. Ensembl Human
Match: RPL31 (ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC:10334])

HSP 1 Score: 156.762 bits (395), Expect = 8.133e-50
Identity = 71/90 (78.89%), Postives = 82/90 (91.11%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFK 391
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFK 115          
BLAST of 60S ribosomal protein L31 vs. Ensembl Celegans
Match: rpl-31 (60S ribosomal protein L31 [Source:UniProtKB/Swiss-Prot;Acc:Q9U332])

HSP 1 Score: 128.642 bits (322), Expect = 3.953e-39
Identity = 69/98 (70.41%), Postives = 80/98 (81.63%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TI+IH RI GIG K RAPRAI EIKKFA+ QM T DVRVD +LNKF+WSKGI+NVPY+VRVRL+R++NEDEDS  K YTL TYVPCT+F     VNV+
Sbjct:   22 TIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVD 119          
BLAST of 60S ribosomal protein L31 vs. Ensembl Celegans
Match: rpl-31 (60S ribosomal protein L31 [Source:UniProtKB/Swiss-Prot;Acc:Q9U332])

HSP 1 Score: 85.8853 bits (211), Expect = 7.547e-23
Identity = 46/67 (68.66%), Postives = 55/67 (82.09%), Query Frame = 2
Query:  215 MGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            M T DVRVD +LNKF+WSKGI+NVPY+VRVRL+R++NEDEDS  K YTL TYVPCT+F     VNV+
Sbjct:    1 MKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVD 67          
BLAST of 60S ribosomal protein L31 vs. Ensembl Celegans
Match: rpl-31 (60S ribosomal protein L31 [Source:UniProtKB/Swiss-Prot;Acc:Q9U332])

HSP 1 Score: 85.8853 bits (211), Expect = 7.547e-23
Identity = 46/67 (68.66%), Postives = 55/67 (82.09%), Query Frame = 2
Query:  215 MGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            M T DVRVD +LNKF+WSKGI+NVPY+VRVRL+R++NEDEDS  K YTL TYVPCT+F     VNV+
Sbjct:    1 MKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVD 67          
BLAST of 60S ribosomal protein L31 vs. Ensembl Celegans
Match: rpl-31 (60S ribosomal protein L31 [Source:UniProtKB/Swiss-Prot;Acc:Q9U332])

HSP 1 Score: 85.8853 bits (211), Expect = 7.547e-23
Identity = 46/67 (68.66%), Postives = 55/67 (82.09%), Query Frame = 2
Query:  215 MGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            M T DVRVD +LNKF+WSKGI+NVPY+VRVRL+R++NEDEDS  K YTL TYVPCT+F     VNV+
Sbjct:    1 MKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVD 67          
BLAST of 60S ribosomal protein L31 vs. Ensembl Celegans
Match: rpl-31 (60S ribosomal protein L31 [Source:UniProtKB/Swiss-Prot;Acc:Q9U332])

HSP 1 Score: 85.8853 bits (211), Expect = 7.547e-23
Identity = 46/67 (68.66%), Postives = 55/67 (82.09%), Query Frame = 2
Query:  215 MGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            M T DVRVD +LNKF+WSKGI+NVPY+VRVRL+R++NEDEDS  K YTL TYVPCT+F     VNV+
Sbjct:    1 MKTNDVRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVD 67          
BLAST of 60S ribosomal protein L31 vs. Ensembl Fly
Match: RpL31 (gene:FBgn0285949 transcript:FBtr0088526)

HSP 1 Score: 131.724 bits (330), Expect = 3.149e-40
Identity = 66/99 (66.67%), Postives = 85/99 (85.86%), Query Frame = 2
Query:  119 CTINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            CTI++ KR+H IGFK RAPRAIKEI+KFA+++MGT DVR+D RLNK +WSKGIR+ P+++RVRLAR++N+DEDSP+K YT VTYVP + FK+  T NVE
Sbjct:   22 CTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVE 120          
BLAST of 60S ribosomal protein L31 vs. Ensembl Fly
Match: RpL31 (gene:FBgn0285949 transcript:FBtr0088527)

HSP 1 Score: 131.724 bits (330), Expect = 3.149e-40
Identity = 66/99 (66.67%), Postives = 85/99 (85.86%), Query Frame = 2
Query:  119 CTINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            CTI++ KR+H IGFK RAPRAIKEI+KFA+++MGT DVR+D RLNK +WSKGIR+ P+++RVRLAR++N+DEDSP+K YT VTYVP + FK+  T NVE
Sbjct:   22 CTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVE 120          
BLAST of 60S ribosomal protein L31 vs. Ensembl Fly
Match: RpL31 (gene:FBgn0285949 transcript:FBtr0088525)

HSP 1 Score: 131.724 bits (330), Expect = 3.149e-40
Identity = 66/99 (66.67%), Postives = 85/99 (85.86%), Query Frame = 2
Query:  119 CTINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            CTI++ KR+H IGFK RAPRAIKEI+KFA+++MGT DVR+D RLNK +WSKGIR+ P+++RVRLAR++N+DEDSP+K YT VTYVP + FK+  T NVE
Sbjct:   22 CTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVE 120          
BLAST of 60S ribosomal protein L31 vs. Ensembl Zebrafish
Match: rpl31 (ribosomal protein L31 [Source:ZFIN;Acc:ZDB-GENE-060331-121])

HSP 1 Score: 157.918 bits (398), Expect = 2.198e-50
Identity = 73/98 (74.49%), Postives = 86/98 (87.76%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHGI FK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KG+RNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T +K   TVNV+
Sbjct:   24 TINIHKRIHGISFKRRAPRALKEIRKFAVKEMGTPDVRIDTRLNKAVWAKGVRNVPYRMRVRLSRKRNEDEDSPNKLYTLVTYVPVTTYKGLQTVNVD 121          
BLAST of 60S ribosomal protein L31 vs. Ensembl Zebrafish
Match: rpl31 (ribosomal protein L31 [Source:ZFIN;Acc:ZDB-GENE-060331-121])

HSP 1 Score: 157.918 bits (398), Expect = 2.198e-50
Identity = 73/98 (74.49%), Postives = 86/98 (87.76%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHGI FK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KG+RNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T +K   TVNV+
Sbjct:   24 TINIHKRIHGISFKRRAPRALKEIRKFAVKEMGTPDVRIDTRLNKAVWAKGVRNVPYRMRVRLSRKRNEDEDSPNKLYTLVTYVPVTTYKGLQTVNVD 121          
BLAST of 60S ribosomal protein L31 vs. Ensembl Xenopus
Match: ankle1 (ankyrin repeat and LEM domain containing 1 [Source:Xenbase;Acc:XB-GENE-6045314])

HSP 1 Score: 158.688 bits (400), Expect = 1.602e-50
Identity = 74/98 (75.51%), Postives = 87/98 (88.78%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHGIGFK RAPRA+KEI+KFA K+M T DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T++K   TVNV+
Sbjct:   26 TINIHKRIHGIGFKKRAPRALKEIRKFAVKEMRTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTNYKGLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. Ensembl Xenopus
Match: ankle1 (ankyrin repeat and LEM domain containing 1 [Source:Xenbase;Acc:XB-GENE-6045314])

HSP 1 Score: 152.91 bits (385), Expect = 4.075e-48
Identity = 70/90 (77.78%), Postives = 82/90 (91.11%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFK 391
            TINIHKRIHGIGFK RAPRA+KEI+KFA K+M T DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T++K
Sbjct:   26 TINIHKRIHGIGFKKRAPRALKEIRKFAVKEMRTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTNYK 115          
BLAST of 60S ribosomal protein L31 vs. Ensembl Xenopus
Match: ankle1 (ankyrin repeat and LEM domain containing 1 [Source:Xenbase;Acc:XB-GENE-6045314])

HSP 1 Score: 152.525 bits (384), Expect = 4.635e-48
Identity = 70/90 (77.78%), Postives = 82/90 (91.11%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFK 391
            TINIHKRIHGIGFK RAPRA+KEI+KFA K+M T DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T++K
Sbjct:   26 TINIHKRIHGIGFKKRAPRALKEIRKFAVKEMRTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTNYK 115          
BLAST of 60S ribosomal protein L31 vs. Ensembl Mouse
Match: Rpl31 (ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2149632])

HSP 1 Score: 164.081 bits (414), Expect = 9.509e-53
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. Ensembl Mouse
Match: Rpl31 (ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2149632])

HSP 1 Score: 164.081 bits (414), Expect = 9.509e-53
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. Ensembl Mouse
Match: Rpl31 (ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2149632])

HSP 1 Score: 164.081 bits (414), Expect = 9.509e-53
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. Ensembl Mouse
Match: Rpl31 (ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2149632])

HSP 1 Score: 158.688 bits (400), Expect = 1.192e-50
Identity = 72/92 (78.26%), Postives = 83/92 (90.22%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDK 397
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK K
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKSK 117          
BLAST of 60S ribosomal protein L31 vs. Ensembl Mouse
Match: Rpl31 (ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2149632])

HSP 1 Score: 93.2041 bits (230), Expect = 2.275e-25
Identity = 42/53 (79.25%), Postives = 48/53 (90.57%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIR 280
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIR
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIR 78          
BLAST of 60S ribosomal protein L31 vs. UniProt/SwissProt
Match: sp|P62902|RL31_RAT (60S ribosomal protein L31 OS=Rattus norvegicus OX=10116 GN=Rpl31 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 6.651e-52
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. UniProt/SwissProt
Match: sp|P62901|RL31_PIG (60S ribosomal protein L31 OS=Sus scrofa OX=9823 GN=RPL31 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 6.651e-52
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. UniProt/SwissProt
Match: sp|P62900|RL31_MOUSE (60S ribosomal protein L31 OS=Mus musculus OX=10090 GN=Rpl31 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 6.651e-52
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. UniProt/SwissProt
Match: sp|Q1KSC7|RL31_MARMO (60S ribosomal protein L31 OS=Marmota monax OX=9995 GN=RPL31 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 6.651e-52
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. UniProt/SwissProt
Match: sp|P62899|RL31_HUMAN (60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 6.651e-52
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRA+KEI+KFA K+MGT DVR+D RLNK VW+KGIRNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T FK+  TVNV+
Sbjct:   26 TINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. TrEMBL
Match: A0A183A0L3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS498 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.681e-53
Identity = 81/98 (82.65%), Postives = 90/98 (91.84%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TI++HKRIHGIGFK RAPRAIKEIKKFA+K MGTEDVR+ VRLN+F+WSKG+RNVPY+VRVRLARK NEDEDSPHK YTLVTYVPCTDFK K  +NVE
Sbjct:   22 TIHLHKRIHGIGFKKRAPRAIKEIKKFAKKMMGTEDVRIGVRLNEFIWSKGVRNVPYRVRVRLARKTNEDEDSPHKFYTLVTYVPCTDFKGKQIINVE 119          
BLAST of 60S ribosomal protein L31 vs. TrEMBL
Match: W6US36 (60S ribosomal protein L31 OS=Echinococcus granulosus OX=6210 GN=EGR_01538 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.284e-53
Identity = 77/98 (78.57%), Postives = 92/98 (93.88%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TIN+HKRIHG+GFK RAPRA+KEI+KFAQK MGT+DVRV+VRLN+F+WSKG+RNVPY+VRV+LARK+NEDEDSPHK YTLV+YVPC+DFK K  +NVE
Sbjct:   21 TINLHKRIHGVGFKKRAPRALKEIRKFAQKMMGTDDVRVNVRLNEFLWSKGVRNVPYRVRVKLARKRNEDEDSPHKFYTLVSYVPCSDFKGKQNINVE 118          
BLAST of 60S ribosomal protein L31 vs. TrEMBL
Match: A0A0R3U492 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1454 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 9.490e-53
Identity = 76/98 (77.55%), Postives = 92/98 (93.88%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TIN+H+RIHG+GFK RAPRAIKE++KFA+K MGTEDVRV+VRLN+F+WSKG+RNVPY+VRV+L+RK+NEDEDSPHK YTLV+YVPCTDFK K  +NVE
Sbjct:   22 TINLHRRIHGVGFKRRAPRAIKEVRKFAKKMMGTEDVRVNVRLNEFLWSKGVRNVPYRVRVKLSRKRNEDEDSPHKFYTLVSYVPCTDFKGKQNINVE 119          
BLAST of 60S ribosomal protein L31 vs. TrEMBL
Match: A0A068YF97 (Ribosomal protein L31 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000850700 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.710e-52
Identity = 77/98 (78.57%), Postives = 92/98 (93.88%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TIN+HKRIHG+GFK RAPRA+KEI+KFAQK MGT+DVRV+VRLN+F+WSKG+RNVPY+VRV+LARK+NEDEDSPHK YTLV+YVPC+DFK K  +NVE
Sbjct:   44 TINLHKRIHGVGFKKRAPRALKEIRKFAQKMMGTDDVRVNVRLNEFLWSKGVRNVPYRVRVKLARKRNEDEDSPHKFYTLVSYVPCSDFKGKQNINVE 141          
BLAST of 60S ribosomal protein L31 vs. TrEMBL
Match: T1FM36 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20209885 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 1.789e-52
Identity = 80/98 (81.63%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRAIKEIKKFAQKQMGT DVR++ RLNK +WSKGIRNVPY+VRVRLARK+NEDEDSPHK YTLV+YVP  +FK   TVNVE
Sbjct:   23 TINIHKRIHGMGFKKRAPRAIKEIKKFAQKQMGTMDVRIETRLNKHMWSKGIRNVPYRVRVRLARKRNEDEDSPHKLYTLVSYVPMVNFKGSQTVNVE 120          
BLAST of 60S ribosomal protein L31 vs. Ensembl Cavefish
Match: rpl31 (ribosomal protein L31 [Source:NCBI gene;Acc:103040992])

HSP 1 Score: 159.073 bits (401), Expect = 6.639e-51
Identity = 73/98 (74.49%), Postives = 86/98 (87.76%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TIN+HKRIHGI FK RAPRAIKEI+KFA K+MGT DVR+D RLNK VW+KG+RNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T +K   TVNV+
Sbjct:   26 TINVHKRIHGISFKKRAPRAIKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGVRNVPYRMRVRLSRKRNEDEDSPNKLYTLVTYVPVTTYKGLQTVNVD 123          
BLAST of 60S ribosomal protein L31 vs. Ensembl Sea Lamprey
Match: rpl31 (ribosomal protein L31 [Source:ZFIN;Acc:ZDB-GENE-060331-121])

HSP 1 Score: 164.081 bits (414), Expect = 1.420e-53
Identity = 75/98 (76.53%), Postives = 88/98 (89.80%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TIN+HKRIHGIGFK RAPRAIKEI+KFA+K+MGT DVR+D RLNK VWSKG+RNVPY++RVRL+RK+NEDEDSP+K YTLVT+VP T FK   TVNV+
Sbjct:   25 TINVHKRIHGIGFKKRAPRAIKEIRKFAEKEMGTPDVRIDTRLNKAVWSKGVRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTFVPTTSFKGLQTVNVD 122          
BLAST of 60S ribosomal protein L31 vs. Ensembl Yeast
Match: RPL31B (Ribosomal 60S subunit protein L31B; associates with karyopherin Sxm1p; loss of both Rpl31p and Rpl39p confers lethality; homologous to mammalian ribosomal protein L31, no bacterial homolog; RPL31B has a paralog, RPL31A, that arose from the whole genome duplication [Source:SGD;Acc:S000004398])

HSP 1 Score: 109.768 bits (273), Expect = 1.698e-32
Identity = 50/98 (51.02%), Postives = 72/98 (73.47%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TIN+HKR+HG+ FK RAPRA+KEIKKFA+  MGTEDVR+   LN+ +W +G++ V Y++R+R++RK+NE+ED+ +  ++ V  V     K   TV VE
Sbjct:   13 TINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTEDVRLAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGLQTVVVE 110          
BLAST of 60S ribosomal protein L31 vs. Ensembl Yeast
Match: RPL31A (Ribosomal 60S subunit protein L31A; associates with karyopherin Sxm1p; loss of both Rpl31p and Rpl39p confers lethality; homologous to mammalian ribosomal protein L31, no bacterial homolog; RPL31A has a paralog, RPL31B, that arose from the whole genome duplication [Source:SGD;Acc:S000002233])

HSP 1 Score: 108.227 bits (269), Expect = 6.774e-32
Identity = 49/98 (50.00%), Postives = 72/98 (73.47%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TIN+HKR+HG+ FK RAPRA+KEIKKFA+  MGT+DVR+   LN+ +W +G++ V Y++R+R++RK+NE+ED+ +  ++ V  V     K   TV VE
Sbjct:   13 TINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGLQTVVVE 110          
BLAST of 60S ribosomal protein L31 vs. Ensembl Nematostella
Match: EDO40486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S786])

HSP 1 Score: 155.221 bits (391), Expect = 6.697e-50
Identity = 74/98 (75.51%), Postives = 83/98 (84.69%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TIN+HKRIHGIGFK RAPRAIKEI+KFA+K MGT DVR+D RLNK VW++GIRNVPY+VRVRLARK+NEDEDSPHK YTLVT V  + FK   T  VE
Sbjct:   23 TINLHKRIHGIGFKKRAPRAIKEIRKFAEKMMGTPDVRIDTRLNKHVWNQGIRNVPYRVRVRLARKRNEDEDSPHKLYTLVTSVAVSTFKGLQTQKVE 120          
BLAST of 60S ribosomal protein L31 vs. Ensembl Medaka
Match: rpl31 (ribosomal protein L31 [Source:NCBI gene;Acc:101174896])

HSP 1 Score: 158.303 bits (399), Expect = 2.980e-50
Identity = 74/98 (75.51%), Postives = 85/98 (86.73%), Query Frame = 2
Query:  122 TINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            TINIHKRIHG+GFK RAPRAI EI+KFA K+MGT DVR+D RLNK VWSKG+RNVPY++RVRL+RK+NEDEDSP+K YTLVTYVP T  K   TVNV+
Sbjct:   48 TINIHKRIHGVGFKRRAPRAINEIRKFAMKEMGTPDVRIDTRLNKAVWSKGVRNVPYRMRVRLSRKRNEDEDSPNKLYTLVTYVPVTTCKGLQTVNVD 145          
BLAST of 60S ribosomal protein L31 vs. Planmine SMEST
Match: SMESG000017099.1 (SMESG000017099.1)

HSP 1 Score: 218.009 bits (554), Expect = 1.711e-74
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 2
Query:   62 MVNKNIDXXXXXXXXXXXXCTINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 415
            MVNKNIDKKSSKKETATKECTINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE
Sbjct:    1 MVNKNIDKKSSKKETATKECTINIHKRIHGIGFKHRAPRAIKEIKKFAQKQMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTLVTYVPCTDFKDKGTVNVE 118          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L31 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL311.385e-5276.53ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL311.385e-5276.53ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL319.954e-5175.79ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL314.084e-5078.89ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL318.133e-5078.89ribosomal protein L31 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl-313.953e-3970.4160S ribosomal protein L31 [Source:UniProtKB/Swiss... [more]
rpl-317.547e-2368.6660S ribosomal protein L31 [Source:UniProtKB/Swiss... [more]
rpl-317.547e-2368.6660S ribosomal protein L31 [Source:UniProtKB/Swiss... [more]
rpl-317.547e-2368.6660S ribosomal protein L31 [Source:UniProtKB/Swiss... [more]
rpl-317.547e-2368.6660S ribosomal protein L31 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RpL313.149e-4066.67gene:FBgn0285949 transcript:FBtr0088526[more]
RpL313.149e-4066.67gene:FBgn0285949 transcript:FBtr0088527[more]
RpL313.149e-4066.67gene:FBgn0285949 transcript:FBtr0088525[more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl312.198e-5074.49ribosomal protein L31 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
rpl312.198e-5074.49ribosomal protein L31 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ankle11.602e-5075.51ankyrin repeat and LEM domain containing 1 [Source... [more]
ankle14.075e-4877.78ankyrin repeat and LEM domain containing 1 [Source... [more]
ankle14.635e-4877.78ankyrin repeat and LEM domain containing 1 [Source... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpl319.509e-5376.53ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2... [more]
Rpl319.509e-5376.53ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2... [more]
Rpl319.509e-5376.53ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2... [more]
Rpl311.192e-5078.26ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2... [more]
Rpl312.275e-2579.25ribosomal protein L31 [Source:MGI Symbol;Acc:MGI:2... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62902|RL31_RAT6.651e-5276.5360S ribosomal protein L31 OS=Rattus norvegicus OX=... [more]
sp|P62901|RL31_PIG6.651e-5276.5360S ribosomal protein L31 OS=Sus scrofa OX=9823 GN... [more]
sp|P62900|RL31_MOUSE6.651e-5276.5360S ribosomal protein L31 OS=Mus musculus OX=10090... [more]
sp|Q1KSC7|RL31_MARMO6.651e-5276.5360S ribosomal protein L31 OS=Marmota monax OX=9995... [more]
sp|P62899|RL31_HUMAN6.651e-5276.5360S ribosomal protein L31 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183A0L31.681e-5382.65Uncharacterized protein OS=Echinostoma caproni OX=... [more]
W6US363.284e-5378.5760S ribosomal protein L31 OS=Echinococcus granulos... [more]
A0A0R3U4929.490e-5377.55Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068YF971.710e-5278.57Ribosomal protein L31 OS=Echinococcus multilocular... [more]
T1FM361.789e-5281.63Uncharacterized protein OS=Helobdella robusta OX=6... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl316.639e-5174.49ribosomal protein L31 [Source:NCBI gene;Acc:103040... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl311.420e-5376.53ribosomal protein L31 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL31B1.698e-3251.02Ribosomal 60S subunit protein L31B; associates wit... [more]
RPL31A6.774e-3250.00Ribosomal 60S subunit protein L31A; associates wit... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO404866.697e-5075.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl312.980e-5075.51ribosomal protein L31 [Source:NCBI gene;Acc:101174... [more]
back to top
BLAST of 60S ribosomal protein L31 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000017099.11.711e-74100.00SMESG000017099.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024189 ID=SMED30024189|Name=60S ribosomal protein L31|organism=Schmidtea mediterranea sexual|type=transcript|length=443bp
CATTTTTGTTTAAATTTTTAAATTTCATTTAAACTAGACATATTTGAATT
ACTATTCGAAAATGGTTAATAAAAATATAGATAAAAAGTCTAGCAAGAAA
GAGACTGCAACCAAAGAATGCACTATTAACATCCATAAAAGAATTCATGG
TATTGGATTTAAACACCGAGCCCCAAGAGCAATTAAGGAAATTAAGAAAT
TTGCTCAAAAACAAATGGGCACTGAAGATGTCCGTGTCGACGTTAGACTT
AACAAATTTGTTTGGAGCAAGGGTATCAGGAACGTACCTTACAAGGTTCG
TGTGCGATTAGCAAGAAAGAAGAATGAAGATGAAGACAGTCCTCATAAAA
CTTACACTTTGGTCACATACGTTCCATGCACTGATTTCAAAGACAAAGGC
ACTGTCAATGTCGAATAAATAAATATATTTCGATTGGATTTTT
back to top

protein sequence of SMED30024189-orf-1

>SMED30024189-orf-1 ID=SMED30024189-orf-1|Name=SMED30024189-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MVNKNIDKKSSKKETATKECTINIHKRIHGIGFKHRAPRAIKEIKKFAQK
QMGTEDVRVDVRLNKFVWSKGIRNVPYKVRVRLARKKNEDEDSPHKTYTL
VTYVPCTDFKDKGTVNVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000054Ribosomal_L31e
IPR023621Ribosomal_L31e_dom_sf
IPR020052Ribosomal_L31e_CS
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000054Ribosomal protein L31eSMARTSM01380Ribosomal_L31e_2coord: 13..96
e-value: 1.6E-50
score: 183.8
IPR000054Ribosomal protein L31ePFAMPF01198Ribosomal_L31ecoord: 15..94
e-value: 8.4E-45
score: 150.9
IPR000054Ribosomal protein L31ePANTHERPTHR1095660S RIBOSOMAL PROTEIN L31coord: 9..113
IPR000054Ribosomal protein L31eCDDcd00463Ribosomal_L31ecoord: 12..95
e-value: 1.27158E-31
score: 104.959
IPR023621Ribosomal protein L31e domain superfamilyGENE3DG3DSA:3.10.440.10coord: 1..117
e-value: 2.4E-51
score: 174.5
IPR023621Ribosomal protein L31e domain superfamilySUPERFAMILYSSF54575Ribosomal protein L31ecoord: 15..96
NoneNo IPR availablePANTHERPTHR10956:SF32coord: 9..113
NoneNo IPR availablePRODOMPD006030coord: 21..67
e-value: 4.0E-16
score: 201.0
IPR020052Ribosomal protein L31e, conserved sitePROSITEPS01144RIBOSOMAL_L31Ecoord: 57..71