Venom allergen 5

Overview
NameVenom allergen 5
Smed IDSMED30024188
Length (bp)507
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Venom allergen 5 (SMED30024188) t-SNE clustered cells

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30024188) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Venom allergen 5 (SMED30024188) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30024188) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024188

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30024188SMESG000003513.1 SmedASXL_018196SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30024188SMESG000003513.1 dd_Smed_v4_4314_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024188SMESG000003513.1 dd_Smed_v4_4314_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30024188SMESG000003513.1 dd_Smed_v6_4314_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30024188SMESG000003513.1 dd_Smed_v6_4314_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 100.523 bits (249), Expect = 8.053e-25
Identity = 54/159 (33.96%), Postives = 88/159 (55.35%), Query Frame = 3
Query:   48 GDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFS--GKNIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKCV----ISKENVNLLFCNYGPGGN 503
            G L++++K  ++  HN YR  V        PTA++M +M W +E A+ A+ YA +C++ H+ +  R+       G+N+   +  G ++   +E W++E   +  S  TCS  + CGHYTQ+VWA +  +GCG   C     + + N+ LL CNY P GN
Sbjct:   26 GALTDEEKRLMVELHNLYRAQV-------SPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGN 170          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 100.523 bits (249), Expect = 8.053e-25
Identity = 54/159 (33.96%), Postives = 88/159 (55.35%), Query Frame = 3
Query:   48 GDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFS--GKNIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKCV----ISKENVNLLFCNYGPGGN 503
            G L++++K  ++  HN YR  V        PTA++M +M W +E A+ A+ YA +C++ H+ +  R+       G+N+   +  G ++   +E W++E   +  S  TCS  + CGHYTQ+VWA +  +GCG   C     + + N+ LL CNY P GN
Sbjct:   26 GALTDEEKRLMVELHNLYRAQV-------SPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGN 170          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 100.523 bits (249), Expect = 8.053e-25
Identity = 54/159 (33.96%), Postives = 88/159 (55.35%), Query Frame = 3
Query:   48 GDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFS--GKNIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKCV----ISKENVNLLFCNYGPGGN 503
            G L++++K  ++  HN YR  V        PTA++M +M W +E A+ A+ YA +C++ H+ +  R+       G+N+   +  G ++   +E W++E   +  S  TCS  + CGHYTQ+VWA +  +GCG   C     + + N+ LL CNY P GN
Sbjct:   26 GALTDEEKRLMVELHNLYRAQV-------SPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGN 170          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 96.2857 bits (238), Expect = 1.891e-24
Identity = 55/151 (36.42%), Postives = 81/151 (53.64%), Query Frame = 3
Query:   72 DALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKY---GDFESVGQNVAMFSGKNIF--RGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCV-ISKENVNLLFCNYGPGGNY 506
            D  +  HN +R  V        P A +MK M+W K  A  A+ +A++C F H+   D+ Y     FE VG+N+ +   K+      +  WYNE   + F + +CS + CGHYTQLVWA+S  +GC +A C  +   +  +  CNYGP GN+
Sbjct:   35 DNCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCS-RVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNF 177          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 96.2857 bits (238), Expect = 2.155e-24
Identity = 55/151 (36.42%), Postives = 81/151 (53.64%), Query Frame = 3
Query:   72 DALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKY---GDFESVGQNVAMFSGKNIF--RGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCV-ISKENVNLLFCNYGPGGNY 506
            D  +  HN +R  V        P A +MK M+W K  A  A+ +A++C F H+   D+ Y     FE VG+N+ +   K+      +  WYNE   + F + +CS + CGHYTQLVWA+S  +GC +A C  +   +  +  CNYGP GN+
Sbjct:   35 DNCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCS-RVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNF 177          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.156e-17
Identity = 47/150 (31.33%), Postives = 69/150 (46.00%), Query Frame = 3
Query:   69 KDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKC-----VISKENVNLLFCNYGPGGN 503
            K  +   HN YRR V          A++M  + WS E A+ AQ +AD C F H            +VG+N+      N    + +W+NE        N      CGHY Q+VWA ++ +GCG ++C     V  + + N+  C+Y P GN
Sbjct:   81 KKWITHEHNRYRRMV---------PASDMNMLYWSDELAASAQRHADTCDFRHSRGRI-------NVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGN 214          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.166e-17
Identity = 47/150 (31.33%), Postives = 69/150 (46.00%), Query Frame = 3
Query:   69 KDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKC-----VISKENVNLLFCNYGPGGN 503
            K  +   HN YRR V          A++M  + WS E A+ AQ +AD C F H            +VG+N+      N    + +W+NE        N      CGHY Q+VWA ++ +GCG ++C     V  + + N+  C+Y P GN
Sbjct:   81 KKWITHEHNRYRRMV---------PASDMNMLYWSDELAASAQRHADTCDFRHSRGRI-------NVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGN 214          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5478005:1 gene:WBGene00003055.1 transcript:F48E8.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.166e-17
Identity = 47/150 (31.33%), Postives = 69/150 (46.00%), Query Frame = 3
Query:   69 KDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKC-----VISKENVNLLFCNYGPGGN 503
            K  +   HN YRR V          A++M  + WS E A+ AQ +AD C F H            +VG+N+      N    + +W+NE        N      CGHY Q+VWA ++ +GCG ++C     V  + + N+  C+Y P GN
Sbjct:   81 KKWITHEHNRYRRMV---------PASDMNMLYWSDELAASAQRHADTCDFRHSRGRI-------NVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGN 214          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.317e-17
Identity = 46/149 (30.87%), Postives = 68/149 (45.64%), Query Frame = 3
Query:   69 KDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKC-----VISKENVNLLFCNYGPGG 500
            K  +   HN YRR V          A++M  + WS E A+ AQ +AD C F H            +VG+N+      N    + +W+NE        N      CGHY Q+VWA ++ +GCG ++C     V  + + N+  C+Y P G
Sbjct:   81 KKWITHEHNRYRRMV---------PASDMNMLYWSDELAASAQRHADTCDFRHSRGRI-------NVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQG 213          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93444])

HSP 1 Score: 72.0182 bits (175), Expect = 6.099e-16
Identity = 47/184 (25.54%), Postives = 85/184 (46.20%), Query Frame = 3
Query:   18 FVLVVLEFCSG---DLSNDDKDALLRFHNNYRRAVVYGSVTGQPT----ATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVE--------LWYNEAFGFTFSNNTCSLKT----CGHYTQLVWADSSELGCGLAKCVISKENVN--LLFCNYGPGGNY 506
            F+L++   C+G     + + + A+L  HN  R  +  G+   + T    A++M  M W +  A+ +QIYA++C   H         +   VG+N+  +        ++         W  E   + +S+NT ++       GH TQ+ WA ++ +GCG+  C +    +N   + C+Y P GNY
Sbjct:    4 FILLLTVLCAGAYTQFTANGQAAILNVHNTLRSRIAKGTYVARGTVKHAASDMLKMKWLRSLATSSQIYANRCPTGHS--------NMIGVGENLYWYWTSGTITNIDQFGAMASAAWEKEFQDYGWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNY 179          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 103.99 bits (258), Expect = 1.420e-26
Identity = 58/158 (36.71%), Postives = 88/158 (55.70%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRG--------VELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
            ++ +++  +L+ HN  R+ V  G   GQP A NM+ +VW  E A++AQ +AD C F HD    R    F ++GQN+A+                 ++ W+NE   ++F  +  S KT GHY+QLVW ++S +GCG A+   + +   L  CNYGPGGN
Sbjct:   32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHD--PHRTINRF-TMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF-GDAWSPKT-GHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGN 184          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077754)

HSP 1 Score: 56.225 bits (134), Expect = 3.789e-10
Identity = 41/131 (31.30%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  117 YGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIF--RGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
            Y ++ G P  T   N   +K +   A    D+   AH  + + KYG      +N+ +  G ++     VE+WY E   + F N    + T GH+TQL+W  S E+G G+A+    K +   + CNY P GN
Sbjct:   42 YRAMHGCPAVT--INAALNKLAQEWANHLRDQNTMAH--RPNPKYG------ENIFLSGGMDVTGDLPVEMWYREINSYDF-NKAQFVPTAGHFTQLIWKSSVEMGSGVAR----KADRTWVVCNYNPPGN 157          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 56.6102 bits (135), Expect = 6.902e-10
Identity = 44/163 (26.99%), Postives = 70/163 (42.94%), Query Frame = 3
Query:   42 CSGDLSNDDK--DALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVEL------WYNEAFGFTFSN----NTCSLKTCGHYTQLVWADSSELGCGLAKCVISKE-NVNLLFCNYG 491
            CSG+    D     +L+ HN  R  +  G V+G P+A  M  M W    A  A   A +C  AHD  + R    +   GQN+++   +++   V L      W++E    T  +            GH+T +V   ++ +GC +A+   +      LL CNY 
Sbjct:   50 CSGEFVQVDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHD--ECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYA 210          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0333658)

HSP 1 Score: 53.5286 bits (127), Expect = 1.006e-8
Identity = 47/163 (28.83%), Postives = 71/163 (43.56%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFR-------GVELWYNEAF--------GFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVN--LLFCNYG 491
            LS+ +KDAL+   N YR  +  G       A  M  + W+ E A  A +    C   HD   +     F+  GQN+A     N          GV++WY+EA          +  + N  ++   GH+T LV   ++E+GC  A   +S ++    LL CNY 
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAI---GHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYA 211          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0073937)

HSP 1 Score: 53.5286 bits (127), Expect = 1.006e-8
Identity = 47/163 (28.83%), Postives = 71/163 (43.56%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFR-------GVELWYNEAF--------GFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVN--LLFCNYG 491
            LS+ +KDAL+   N YR  +  G       A  M  + W+ E A  A +    C   HD   +     F+  GQN+A     N          GV++WY+EA          +  + N  ++   GH+T LV   ++E+GC  A   +S ++    LL CNY 
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAI---GHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYA 211          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 97.4413 bits (241), Expect = 6.445e-25
Identity = 57/159 (35.85%), Postives = 84/159 (52.83%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSG--KNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKC----VISK--ENVNLLFCNYGPGGNY 506
            +S  D  ALL +HN  R  V        P A NM+ MVW +  A  A+ +A +CI+ H       +   + +GQN+++ SG  K+I   V+ WY+E   F++ +  CS   C HYTQ+VWA S+++GC + KC    V     +   LL CNY   GN+
Sbjct:   61 ISGKDMTALLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHGP-----HHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPSR-CSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNW 206          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 97.4413 bits (241), Expect = 6.445e-25
Identity = 57/159 (35.85%), Postives = 84/159 (52.83%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSG--KNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKC----VISK--ENVNLLFCNYGPGGNY 506
            +S  D  ALL +HN  R  V        P A NM+ MVW +  A  A+ +A +CI+ H       +   + +GQN+++ SG  K+I   V+ WY+E   F++ +  CS   C HYTQ+VWA S+++GC + KC    V     +   LL CNY   GN+
Sbjct:   61 ISGKDMTALLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHGP-----HHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPSR-CSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNW 206          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 87.4261 bits (215), Expect = 4.431e-21
Identity = 55/172 (31.98%), Postives = 89/172 (51.74%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK--NIFRGVELWYNEAFGFTFS-----NNTCSLK----TCGHYTQLVWADSSELGCGLAKCVISKENVNL----------LFCNYGPGGNY 506
            +S +D  A+L +HN  R  V        P A+NM+ MVW    A  A+ +A  CI+ H  ++  ++     +GQN+++ +G+  +I + V+ W++E   ++F      N  C LK     C HYTQ+VWA S+++GC +  C     N+N+          L CNY P GN+
Sbjct:   64 ISQNDMLAILDYHNKVRGKVF-------PPASNMEYMVWDDTLAKTAEQWASTCIWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTC----HNMNVWGSVWKRATYLVCNYSPKGNW 219          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 86.6557 bits (213), Expect = 7.173e-21
Identity = 55/159 (34.59%), Postives = 80/159 (50.31%), Query Frame = 3
Query:   72 DALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDT---KDDRKYGDFESVGQNV---AMFSGKNIFRGVELWYNEAFGFTFSNNTCS-LKTCGHYTQLVWADSSELGC-------GLAKCVISKENVNLLFCNYGPGGNY 506
            D  +R HN  R +V        PTA NM+ M W    A  A+ +A  C+F H+    +  R +  F +VG+N+   A +S   +   V  W NE   + ++NN C+  K CGHYTQ+VWADS ++GC       G+A+   S     +  CNY   GN+
Sbjct:   33 DECVREHNQNRSSV-------SPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNF 184          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 87.0409 bits (214), Expect = 8.934e-21
Identity = 54/159 (33.96%), Postives = 78/159 (49.06%), Query Frame = 3
Query:   72 DALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDT---KDDRKYGDFESVGQNV---AMFSGKNIFRGVELWYNEAFGFTFSNNTCS-LKTCGHYTQLVWADSSELGCGLAKCV-------ISKENVNLLFCNYGPGGNY 506
            D  +R HN  R +V        PTA NM+ M W    A  A+ +A  C+F H+    +  R +  F +VG+N+   A +S   +   V  W NE   + ++NN C+  K CGHYTQ+VWADS ++GC +  C         S     +  CNY   GN+
Sbjct:   41 DECVREHNQNRSSV-------SPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNF 192          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 1.028e-21
Identity = 52/158 (32.91%), Postives = 85/158 (53.80%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK--NIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKCV----ISKENVNLLFCNYGPGGNY 506
            L+ ++K  +L  HN YR          +P+A++M  + W     + A+ YA+KCI+ H+   DR +     +G+N+ + SG   ++  G++ W+ E   + F+   C   + CGHYTQ+VWA +  +GCG   C     +  EN+ LL CNY P GN+
Sbjct:   30 LNYEEKRIILDKHNFYRSQT-------EPSASDMIKLTWDSALEAMAKSYAEKCIWEHN--KDRGF-----IGENLFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNF 173          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: pi15 (peptidase inhibitor 15 [Source:NCBI gene;Acc:100489915])

HSP 1 Score: 86.2705 bits (212), Expect = 1.702e-20
Identity = 55/172 (31.98%), Postives = 85/172 (49.42%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSG--KNIFRGVELWYNEAFGFTFS-----NNTCSLK----TCGHYTQLVWADSSELGCGLAKCVISKENVNL----------LFCNYGPGGNY 506
            +S +D  A++ +HN  R  V        P A NM+ MVW +  A  A+ +A  CI+ H      K+     +GQN+++ +G  K+I + V+ WY+E   + F      N  C L+     C HYTQ+VWA ++ +GC +  C     N+N+          L CNY P GN+
Sbjct:   62 ISQNDMIAIVEYHNQVRGKVF-------PPAANMEYMVWDENLAKLAEAWAATCIWDHGPSYLLKF-----LGQNLSVRTGRYKSILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTC----HNMNVWGAVWRRAVYLVCNYSPKGNW 217          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 85.1149 bits (209), Expect = 3.851e-20
Identity = 53/168 (31.55%), Postives = 82/168 (48.81%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK--NIFRGVELWYNEAFGFTFSN---------NTCSLKTCGHYTQLVWADSSELGCGLAKCV------ISKENVNLLFCNYGPGGNY 506
            +S  D  ALL +HN  R  V        P A NM+ MVW +  A  A+ +A++C + H      +Y     +GQN+++ SG+  +I   V+ WY+E   ++F +         N C+   C HYTQ+VWA S+ +GC +  C        +    + L CNY   GN+
Sbjct:   58 ISPRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNW 213          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 84.7297 bits (208), Expect = 4.898e-20
Identity = 53/168 (31.55%), Postives = 82/168 (48.81%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK--NIFRGVELWYNEAFGFTFSN---------NTCSLKTCGHYTQLVWADSSELGCGLAKCV------ISKENVNLLFCNYGPGGNY 506
            +S  D  ALL +HN  R  V        P A NM+ MVW +  A  A+ +A++C + H      +Y     +GQN+++ SG+  +I   V+ WY+E   ++F +         N C+   C HYTQ+VWA S+ +GC +  C        +    + L CNY   GN+
Sbjct:   53 ISPRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNW 208          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 85.5001 bits (210), Expect = 2.209e-19
Identity = 51/164 (31.10%), Postives = 78/164 (47.56%), Query Frame = 3
Query:   66 DKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK--NIFRGVELWYNEAFGFTFS---------NNTCSLKTCGHYTQLVWADSSELGCGLAKCVISK------ENVNLLFCNYGPGGNY 506
            DK+ +++ HN  R  V        P+A+NM+ M W  E    A+ +A++CI+ H            S+GQN+A+  G+       V+ WY+E   +T+             CS   C HYTQ+VWA ++++GC +  C          EN   L CNY P GN+
Sbjct:   56 DKEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNW 207          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 95.5153 bits (236), Expect = 2.424e-24
Identity = 53/157 (33.76%), Postives = 82/157 (52.23%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFS--GKNIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKCV----ISKENVNLLFCNYGPGGN 503
            L+ D+K  ++  HN YR  V        P A++M  M W  E A+ A+ YA KC++ H+ +  R+       G+N+   +  G ++   V  W+ E   + FS  TC   + CGHYTQ+VW+ +  +GCG   C     + + N++LL CNY P GN
Sbjct:   30 LTEDEKQTMVDLHNQYRAQV-------SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGN 172          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Glipr1l1 (GLI pathogenesis-related 1 like 1 [Source:MGI Symbol;Acc:MGI:1916536])

HSP 1 Score: 95.5153 bits (236), Expect = 2.449e-24
Identity = 52/150 (34.67%), Postives = 81/150 (54.00%), Query Frame = 3
Query:   72 DALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYG---DFESVGQNVAMFSGKNIFRGVEL-WYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCV-ISKENVNLLFCNYGPGGNY 506
            DA L  HN  RR V       QP A +M  + W ++ A  A+ +  +C  AH+    ++Y    D++ +G+N+ +   +     V + WYNE+  F F  NTCS + CGHYTQ+VWA + ++GC ++ C  +   +  L  CNY P GN+
Sbjct:   43 DAFLNIHNELRRKV-------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVINWYNESKYFNFDFNTCS-EMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCNYSPAGNF 184          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 95.9005 bits (237), Expect = 3.576e-24
Identity = 53/157 (33.76%), Postives = 82/157 (52.23%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFS--GKNIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKCV----ISKENVNLLFCNYGPGGN 503
            L+ D+K  ++  HN YR  V        P A++M  M W  E A+ A+ YA KC++ H+ +  R+       G+N+   +  G ++   V  W+ E   + FS  TC   + CGHYTQ+VW+ +  +GCG   C     + + N++LL CNY P GN
Sbjct:   30 LTEDEKQTMVDLHNQYRAQV-------SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGN 172          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 95.9005 bits (237), Expect = 3.576e-24
Identity = 53/157 (33.76%), Postives = 82/157 (52.23%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFS--GKNIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKCV----ISKENVNLLFCNYGPGGN 503
            L+ D+K  ++  HN YR  V        P A++M  M W  E A+ A+ YA KC++ H+ +  R+       G+N+   +  G ++   V  W+ E   + FS  TC   + CGHYTQ+VW+ +  +GCG   C     + + N++LL CNY P GN
Sbjct:   30 LTEDEKQTMVDLHNQYRAQV-------SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGN 172          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 97.0561 bits (240), Expect = 1.338e-23
Identity = 53/157 (33.76%), Postives = 82/157 (52.23%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFS--GKNIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKCV----ISKENVNLLFCNYGPGGN 503
            L+ D+K  ++  HN YR  V        P A++M  M W  E A+ A+ YA KC++ H+ +  R+       G+N+   +  G ++   V  W+ E   + FS  TC   + CGHYTQ+VW+ +  +GCG   C     + + N++LL CNY P GN
Sbjct:   30 LTEDEKQTMVDLHNQYRAQV-------SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGN 172          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P35786|VA5_VESSQ (Venom allergen 5 OS=Vespula squamosa OX=30214 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.036e-30
Identity = 67/164 (40.85%), Postives = 92/164 (56.10%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVT-----GQPTATNMKNMVWSKESASKAQIYADKCIFAHDT-KDDRKYGDFESVGQNVAMFSG-----KNIFRGVELWYNEA--FGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            ++  +K  +L+ HN++R  V  G  T      QP A NM N+VW+ E A+ AQI+A +C + HDT KD  KY    +VGQN+A+ S      +N+   V+ W NE   F  T S      K  GHYTQ+VWA + E+GCG  K V +    + L CNYGP GN+
Sbjct:   37 VTQAEKQEILKIHNDFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKY----NVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNF 196          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P35787|VA5_VESVI (Venom allergen 5 OS=Vespula vidua OX=30215 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 5.504e-30
Identity = 67/166 (40.36%), Postives = 93/166 (56.02%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVT-----GQPTATNMKNMVWSKESASKAQIYADKCIFAHDT-KDDRKYGDFESVGQNVAMFSGKNIF-----RGVELWYNEAFGFT----FSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            L+  +K  +L+ HN++R+ V  G  T      QP A NM N+VW+ E A+ AQ++A +C + HDT KD  KY     VGQN+A  S          + V++W NE   F     +S N  +LK  GHYTQ+VWA + E+GCG  K V  +   + L CNYGP GN+
Sbjct:   38 LTEAEKQEILKVHNDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKY----PVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKN--NLKKTGHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNF 197          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 9.558e-30
Identity = 61/155 (39.35%), Postives = 85/155 (54.84%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKN-IFRGVELWYNEAFGFT---FSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            L  + K  +L  HN  R+ V  G  +GQP+A NMK + W+ E A+ AQ  A+ C+F H  K  RK   +  +G+N+   S  + I R V  WY+E    T     + +      GHYTQ+VWA++  LGCGL   V + +  + LFC YGPGGNY
Sbjct:   31 LDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALGCGL---VTASDRNSYLFCQYGPGGNY 182          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P35784|VA5_VESGE (Venom allergen 5 OS=Vespula germanica OX=30212 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.904e-29
Identity = 65/166 (39.16%), Postives = 95/166 (57.23%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVT-----GQPTATNMKNMVWSKESASKAQIYADKCIFAHDT-KDDRKYGDFESVGQNVAMFSGK-----NIFRGVELWYNEAFGFT----FSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            L+  +K  +L+ HN++R+ +  G  T      QP A NMKN+VWS E A  AQ++A++C + HDT +D  KY     VGQNVA+         N  + V++W +E   +     FS N  +    GHYTQ+VWA++ E+GCG  K +  K + + L CNYGP GN+
Sbjct:   36 LTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKY----PVGQNVALTGSTAAKYDNPVKLVKMWEDEVKDYNPKKKFSEN--NFLKIGHYTQMVWANTKEVGCGSIKYIQDKWHKHYLVCNYGPSGNF 195          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q2L6Z1|VAL5_VESMC (Venom allergen 5 OS=Vespula maculifrons OX=7453 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.162e-29
Identity = 66/166 (39.76%), Postives = 95/166 (57.23%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVT-----GQPTATNMKNMVWSKESASKAQIYADKCIFAHDT-KDDRKYGDFESVGQNVAMFSG-----KNIFRGVELWYNEAFGFT----FSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            L+  +K  +L+ HN++R+ V  G  T      QP A NMKN+VW+ E A  AQ++A++C + HDT +D  KY     VGQNVA+        +N    V++W NE   +     FS N  +    GHYTQ+VWA++ E+GCG  K   +K + + L CNYGP GN+
Sbjct:   59 LTKQEKQDILKEHNDFRQKVARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKY----QVGQNVALTGSTAAKYENPVNLVKMWENEVKDYNPKKKFSEN--NFIKIGHYTQMVWANTKEIGCGSMKYTENKWHYHYLVCNYGPSGNF 218          
BLAST of Venom allergen 5 vs. TrEMBL
Match: I1ZI85 (GLI pathogenesis related-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 2.287e-60
Identity = 90/128 (70.31%), Postives = 103/128 (80.47%), Query Frame = 3
Query:   18 FVLVVLEFCSGDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQL 401
            FVLVVL+FCSGDLS  +K  LL  HN +R  +  G V+GQP ATNM+ MVW+ ESASKAQI ADKCIFAHDT DDRKYGDFE VGQNVA F+G++I RGV LWYN+  GFTF N+ CSLKTCGHYTQ+
Sbjct:    3 FVLVVLDFCSGDLSEKEKKLLLALHNGFRSNLAQGEVSGQPPATNMQQMVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDISRGVTLWYNQVSGFTFENSACSLKTCGHYTQV 130          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A564YFQ7 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5585 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 6.906e-40
Identity = 70/153 (45.75%), Postives = 99/153 (64.71%), Query Frame = 3
Query:   48 GDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            G LS  DK  LL   N YRR V  G V  QP ++ ++++ W+ E  + AQ +AD+C F HD+ DDRK  +F  VGQN+A  S   I + V++W+ E   + +S+N CS   CGHYTQLVWA+++++GCG++KC  S  N   + CNYGPGGN+
Sbjct:   47 GRLS-KDKQELLDLQNQYRREVAAGRVPNQPASSKIRDLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIAYSSS--IAQNVKMWFEEHKDYNYSHNYCS-GVCGHYTQLVWANTTDVGCGVSKCNFSGFNAVFVVCNYGPGGNF 195          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A0R3SFR1 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3694 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 4.292e-38
Identity = 68/150 (45.33%), Postives = 96/150 (64.00%), Query Frame = 3
Query:   48 GDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPG 497
            G LS  DK  LL   N YRR V  G V  QP ++ ++++ W+ E  + AQ +AD+C F HD+ DDRK  +F  VGQN+A  S   I + V++W+ E   + +S+N CS   CGHYTQLVWA+++++GCG++KC  S  N   + CNYGPG
Sbjct:   47 GRLS-KDKQELLDLQNQYRREVAAGRVPNQPASSKIRDLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIAYSSS--IAQNVKMWFEEHKDYNYSHNYCS-GVCGHYTQLVWANTTDVGCGVSKCNFSGFNAVFVVCNYGPG 192          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A5K3ENG8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 8.141e-38
Identity = 65/147 (44.22%), Postives = 95/147 (64.63%), Query Frame = 3
Query:   66 DKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            +K  LL  HN YRR V  G +  QP+++ + ++ WS E  + AQ +AD C FAHD+ D R+   ++ VGQN+A  S  +I + VE+W++E   + + +N CS   CGHYTQLVWA+++ +GCG++KC     N   + CNYGPGGNY
Sbjct:   56 EKSELLNLHNKYRRLVSDGQIREQPSSSKIHDLKWSTELEASAQRHADTCRFAHDSADARRTPQWDWVGQNIAYSS--SIAKNVEMWFDEYKEYNYQSNYCS-GVCGHYTQLVWANTTHVGCGVSKCNFRGFNAVYVVCNYGPGGNY 199          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A094ZX17 (GLIPR1-like protein 1 (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_07294 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 4.104e-37
Identity = 71/170 (41.76%), Postives = 99/170 (58.24%), Query Frame = 3
Query:   18 FVLVVLEFCS-------GDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            F  VVL  CS         L +  ++ LL  HN  R++V  G + GQP A ++K + W+ E  +KAQI +D+C   HDT  DRK   F+ VGQN A    K+I  G +LW +E   + F   TC +  CGHYTQLVW D++++GCG+  C      ++++ CNYGPGGNY
Sbjct:    7 FSSVVLLVCSLVCCCVHAQLDDAMRNELLALHNKARQSVQNGQLVGQPIAVSIKPLKWNVELETKAQILSDQCRVGHDTNADRKIPAFQYVGQNWA--GAKDINTGFQLWLDEYKNYDFYTRTCRMGQCGHYTQLVWEDTTDVGCGVTNCPNFPYGLSIV-CNYGPGGNY 173          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 98.5969 bits (244), Expect = 1.854e-25
Identity = 55/159 (34.59%), Postives = 86/159 (54.09%), Query Frame = 3
Query:   48 GDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK-NIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKC----VISKENVNLLFCNYGPGGNY 506
            G    +D+  ++  HN++R  V       +P A +M +M WS E A  A+ YA KCI+ H+            +G+N+ + +G  +I + +  W+ E   +++ NNTC+  + CGHYTQ+VWA + E+GCG   C     +  +N  LL CNY P GNY
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQN------IMGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNY 168          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 98.5969 bits (244), Expect = 1.930e-25
Identity = 55/159 (34.59%), Postives = 86/159 (54.09%), Query Frame = 3
Query:   48 GDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK-NIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKC----VISKENVNLLFCNYGPGGNY 506
            G    +D+  ++  HN++R  V       +P A +M +M WS E A  A+ YA KCI+ H+            +G+N+ + +G  +I + +  W+ E   +++ NNTC+  + CGHYTQ+VWA + E+GCG   C     +  +N  LL CNY P GNY
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQN------IMGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNY 168          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 98.5969 bits (244), Expect = 2.820e-25
Identity = 55/159 (34.59%), Postives = 86/159 (54.09%), Query Frame = 3
Query:   48 GDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK-NIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKC----VISKENVNLLFCNYGPGGNY 506
            G    +D+  ++  HN++R  V       +P A +M +M WS E A  A+ YA KCI+ H+            +G+N+ + +G  +I + +  W+ E   +++ NNTC+  + CGHYTQ+VWA + E+GCG   C     +  +N  LL CNY P GNY
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQN------IMGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNY 168          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: r3hdml (R3H domain containing like [Source:NCBI gene;Acc:103046222])

HSP 1 Score: 94.3597 bits (233), Expect = 7.693e-24
Identity = 53/159 (33.33%), Postives = 83/159 (52.20%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK--NIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCV------ISKENVNLLFCNYGPGGNY 506
            +S+ D  ALL +HN  R  V        P A NM+ MVW +  A  A+ +A +CI+ H      KY     +GQN+++ SG+  ++   V  W++E   F++ N  C+   C HYTQ+VWA ++ +GC + +C        + +   LL CNY   GN+
Sbjct:   62 VSSRDMTALLEYHNRVRSQVF-------PPAANMEYMVWDERLAKSAESWASQCIWDHGPSHVMKY-----MGQNLSISSGRYRSVIELVRSWHDEKNSFSYPNR-CTGSVCSHYTQMVWASTNRIGCAINRCSNMYVFGSTWKQATLLVCNYSIKGNW 207          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 91.2781 bits (225), Expect = 1.138e-22
Identity = 55/172 (31.98%), Postives = 91/172 (52.91%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK--NIFRGVELWYNEAFGFTFS-----NNTCSLK----TCGHYTQLVWADSSELGCGLAKCVISKENVNL----------LFCNYGPGGNY 506
            +S +D  A+L++HN  R  V        P A+NM+ MVW    A +A+ +A  C++ H  ++  ++     +GQN+++ +G+  +I + V+ WY+E   ++F      N  C LK     C HYTQ+VWA S+++GC +  C     N+N+          L CNY P GN+
Sbjct:   63 ISQEDMLAILQYHNKVRGKVF-------PPASNMEYMVWDDSLAKRAEEWASTCLWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKIGCAIHTCY----NMNVWGSVWKRATYLVCNYSPKGNW 218          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 8.454e-22
Identity = 51/168 (30.36%), Postives = 85/168 (50.60%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSG--KNIFRGVELWYNEAFGFTFSN---------NTCSLKTCGHYTQLVWADSSELGCGLAKCV-ISKENVNL-----LFCNYGPGGNY 506
            +++D++ AL  +HN  R +V        P A +M++M W  E A  A+ +A +C + H   D       +++GQN+A++ G  + +   V+ W++E   + +           +TC    C HYTQLVWA+S  +GC +  C+ IS  +        L CNY P GN+
Sbjct:    1 IADDERRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSDQ-----LDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNW 156          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 78.1814 bits (191), Expect = 1.894e-18
Identity = 49/146 (33.56%), Postives = 72/146 (49.32%), Query Frame = 3
Query:   78 LLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFR-GVELWYNEAF--GFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLF-CNYGPGGN 503
            ++  HN+ RR V        P+A NM  M+W KE+   A  +A+ C F H     RK   + + G+N+ M S    +   +  WYNE    GF +   + +    GHYTQLVW +S +LGC +  C  +      L+ C+Y P GN
Sbjct:   47 IVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQW-TCGENIFMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGN 184          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 8.246e-12
Identity = 43/155 (27.74%), Postives = 64/155 (41.29%), Query Frame = 3
Query:   87 FHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFS-----NNTCSLK----TCGHYTQLVWADSSELGCGLAKCVISK------ENVNLLFCNYGPGGNY 506
             HN  R  V        P ++NM+ M W K+   +A  Y  +C+     +  +       +GQ   +      F  V+ WY+EA  + +      N  C  +     C HYTQLVWA ++ +GC +  C          E    L CNY P GN+
Sbjct:    2 LHNKLRGEV-------HPPSSNMEYMAWVKKLIKEAARYPGRCL-----RLMQPMAMIHFLGQPHWLSHRPPSFH-VQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNW 143          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 51.6026 bits (122), Expect = 1.272e-8
Identity = 46/184 (25.00%), Postives = 64/184 (34.78%), Query Frame = 3
Query:   36 EFCSGDLSNDDKDA----------LLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYA------DKCIFAHDTKDDRKYG-------------DFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPG 497
            E   G L   D DA          L   HN  R  V       QP+A NM+ M W    A  A  +A       +       +   K G                 V  + A     +    +  W++E   + ++   C+  +TC HYTQ+VWA +S +GC    C      V    C Y PG
Sbjct:   29 EMLPGSLIETDPDAAGSVSKEAFALESLHNKLRATV-------QPSAANMEKMEWDDSLAQVAHEWAAVACENPRAAEGTSAEIPEKPGIQGTGAGGRGGGQRRLGVNLHRAPHGATSFASVLASWFSEGQNYDYARPGCAHNRTCRHYTQMVWASASRVGCAKRWCRDPGSRVEAFACVYLPG 205          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 44.669 bits (104), Expect = 1.097e-6
Identity = 28/82 (34.15%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  267 VGQNVAMFSGKNIFRGVEL-WYNEA--FGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
             G+N+ + +    ++   L WYNEA   GF F     +    GHYTQ+VW  S +LGC +  C  +     +  C+Y P GN
Sbjct:    1 CGENIFLATAPLSWQDAVLDWYNEAEVPGFIFGKGPAAPGDIGHYTQVVWYSSFQLGCAVNYCPEAIYKY-VYVCHYCPAGN 81          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 61.6178 bits (148), Expect = 3.592e-12
Identity = 40/115 (34.78%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  162 MVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            + WS   A+ AQ YAD+    +D      + D    G+N+A+  G      V+ WY E   + +SN   S  T GH+TQ+VW  ++E+GCG   C  +    N + C+Y P GNY
Sbjct:   46 LTWSDTLATYAQNYADQ----YDCSGVLTHSD-GPYGENLAL--GYTDTGAVDAWYGEISKYNYSNPGFSEST-GHFTQVVWKSTAEIGCGYKYCGTTWN--NYIVCSYNPPGNY 150          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 58.151 bits (139), Expect = 3.544e-11
Identity = 41/117 (35.04%), Postives = 61/117 (52.14%), Query Frame = 3
Query:  162 MVWSKESASKAQIYADKCIFAHDTKDDRKY--GDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            + WS   AS AQ YAD     +D      +  G +   G+N+A+  G +    V+ WYNE   + FSN   S  T GH+TQ+VW  ++++GCG+  C       + + C+Y P GNY
Sbjct:  183 LSWSDTLASYAQDYADN----YDCSGTLTHSGGPY---GENLAL--GYDGPAAVDAWYNEISNYDFSNPGFSSNT-GHFTQVVWKSTTQVGCGIKTC--GGAWGDYVICSYDPAGNY 287          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 57.3806 bits (137), Expect = 8.160e-11
Identity = 40/117 (34.19%), Postives = 63/117 (53.85%), Query Frame = 3
Query:  159 NMVWSKESASKAQIYADKCIFAHDTKDDRKY--GDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
            ++ WS   A+ AQ YAD    ++D   +  +  G +   G+N+A+  G      V+ WYNE   + +SN   S ++ GH+TQ+VW  +SE+GCGL  C    E  + + C+Y   GN
Sbjct:  212 SLTWSDTLATYAQNYAD----SYDCSGNLVHSGGPY---GENLAL--GYGTTGSVDAWYNEITSYDYSNPGFS-ESAGHFTQVVWKGTSEVGCGLKSC--GGEWGDYIICSYKAAGN 316          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI98])

HSP 1 Score: 65.4698 bits (158), Expect = 3.334e-14
Identity = 44/121 (36.36%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  162 MVWSKESASKAQIYADKCI----FAHDTKDDRKYGDFESVGQNVAMFSGKNIFRG---VELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
            + WS E A +AQ YA+K        H +K  R        G+N+AMFSG+    G    E+WY E+  ++F      + T GH+TQ+VW  S ELG G AK   S      +   Y P GN
Sbjct:   23 LKWSDELAREAQYYAEKLAQQRSMQHSSKCSR-----NDAGENLAMFSGRYDTAGDMACEMWYEESKKYSFVRGGSQMGT-GHFTQMVWKGSKELGMGRAK--TSDGRCTYVVARYQPAGN 135          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 66.6254 bits (161), Expect = 1.239e-13
Identity = 45/155 (29.03%), Postives = 69/155 (44.52%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCI----FAHDTKDDRKYGDFESVGQNVAMFSGK-NIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
            +  D +  +L  HNNYR               N   + WS   A  AQ +A K        H +++DR Y      G+N+   S   +I   +++WYNE+  + + N   +L T GH+TQ+VW  + E+G G AK    +  +      Y P GN
Sbjct:  209 VDEDTRSRILDIHNNYR------------AMHNAAPLRWSAALAKDAQAWAGKLAREGRLEHASREDRYYK-----GENICRMSHHFDIGDALQIWYNESESYQYDNPGFAL-TTGHFTQIVWRGTREVGVGFAKSPDGR--LTYAVARYNPPGN 343          

HSP 2 Score: 56.225 bits (134), Expect = 5.674e-10
Identity = 49/148 (33.11%), Postives = 62/148 (41.89%), Query Frame = 3
Query:   81 LRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTK---DDRKYGDFESVGQNVAMFSGKNI----FRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
            L  HN YR               N+  + WS   A +AQ +A+K   A + K   D  + G     G+NV M SG N         E WY E   + F        T GH+TQ+VW  S ELG   AK   SK+    +   Y PGGN
Sbjct:    9 LDAHNRYR------------AMHNVPPLTWSNSIAREAQKWANK--LAKEGKLIHDKSRSGQ----GENVFMSSGANFDDAGEAACESWYQEVERYNFQRGGHQSGT-GHFTQVVWKSSEELGVARAK---SKKGAVFVVARYSPGGN 134          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO37114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM4])

HSP 1 Score: 63.929 bits (154), Expect = 1.421e-13
Identity = 45/146 (30.82%), Postives = 70/146 (47.95%), Query Frame = 3
Query:   81 LRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKN-----IFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
            L  HN YR+   +G+          K M WS   A+ AQ +ADK       K D    + +S G+N+A F+ +      I    + WY+E+  + ++N   S K  GH+TQLVW  + ++G G AK   +K +   +   + P GN
Sbjct:    6 LEAHNEYRK--RHGA----------KEMTWSASLAADAQKWADKLSQTDAFKHDYASINSKSQGENLAYFTPQKPNNTAIMDAFDAWYDESSKYDYANAKFS-KETGHFTQLVWKATQKMGIGTAKN--AKGDKEYVVARFSPAGN 136          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO49309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH91])

HSP 1 Score: 63.1586 bits (152), Expect = 4.842e-13
Identity = 42/121 (34.71%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  153 MKNMVWSKESASKAQIYADKCIFAHDTKDD-RKYGDFESVGQNVAMFSGKNIFRGVE---LWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
            +KN+ WS + A  AQ +A+K       K   R+ G+    G+N+AMF+GK    G E   +WY E+  + F N        GH+TQ+VW  + ELG G AK    +  +  +   Y P GN
Sbjct:   58 VKNLKWSHDLARGAQAWAEKLARERTLKHSTRERGE---DGENLAMFTGKYESAGEEATNMWYEESAYYNF-NRPGYQSNTGHFTQVVWKGTKELGLGRAKTPDGR--LTFVVGRYRPSGN 172          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 59.6918 bits (143), Expect = 4.522e-12
Identity = 41/147 (27.89%), Postives = 71/147 (48.30%), Query Frame = 3
Query:   69 KDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIF--RGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGN 503
            K+ +L+ HN+YR    +G+          K + W+   AS+AQ +A+        ++  ++      G+++A  SG  +   +  ++WY E   + F N   S  + GH+TQ+VWA S+E+G G A    S    + +   Y P GN
Sbjct:    3 KNDILKTHNDYR--AQHGT----------KALKWNARLASEAQSWAENLA----QRNAIQHSSSREYGESIAYMSGAVLTGRKATDMWYGEVDKYRFENPGFST-SSGHFTQVVWAGSTEMGAGKA---TSSSGAHFVVARYTPPGN 129          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 96.6709 bits (239), Expect = 4.945e-24
Identity = 55/157 (35.03%), Postives = 83/157 (52.87%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK-NIFRGVELWYNEAFGFTFSNNTCSL-KTCGHYTQLVWADSSELGCGLAKC----VISKENVNLLFCNYGPGGNY 506
            L++  ++ L+  HN+YR  V        P+A  M  + W       A+ YA KCI+ H+T       + E  G+N+   +GK ++   VE W+ E   +++ NN+C   K CGHYTQ+VWAD+  +GC +  C     +   NV+ L CNY P GNY
Sbjct:   57 LTDQQEEMLVELHNHYRGQV-------SPSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNT-------ELEDTGENLFAGTGKLDLSEAVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNY 199          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 86.6557 bits (213), Expect = 4.973e-21
Identity = 51/161 (31.68%), Postives = 82/161 (50.93%), Query Frame = 3
Query:   27 VVLEFCSGDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGV-ELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            V+ + C  D +   +  ++  HN +RRAV       +P A +M  M +S+E A  AQ + DKC+  H     R    +E +G+N+   +   +++ +   WY E   F F N + + K  GHYTQ+VW  S ++GCG+  C     N+ L  C+Y   GN+
Sbjct:   19 VLADICPEDTAVQAE--IVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLC---SNNIYLYGCHYYRAGNF 166          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 85.1149 bits (209), Expect = 1.571e-20
Identity = 50/156 (32.05%), Postives = 80/156 (51.28%), Query Frame = 3
Query:   51 DLSNDD---KDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGV-ELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            D+  +D   +  ++  HN +RRAV       +P A +M  M +S+E A  AQ + DKC+  H     R    +E +G+N+   +   +++ +   WY E   F F N + + K  GHYTQ+VW  S ++GCG+  C     N+ L  C+Y   GN+
Sbjct:    7 DICPEDTAVQAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLC---SNNIYLYGCHYYRAGNF 151          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 85.5001 bits (210), Expect = 1.795e-20
Identity = 52/168 (30.95%), Postives = 85/168 (50.60%), Query Frame = 3
Query:   54 LSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGK--NIFRGVELWYNEAFGFTFS-----NNTCSLK----TCGHYTQLVWADSSELGCGLAKCVISK------ENVNLLFCNYGPGGNY 506
            +S +D  A+L +HN  R  V        P A+NM+ MVW +  A  A+ +A  C++ H      ++     +GQN+++ +G+  +I + V+ WY+E   ++F      N  C L+     C HYTQ+VWA S+++GC +  C          +    L CNY P GN+
Sbjct:   61 ISQNDMLAILDYHNKVRGKVF-------PPASNMEYMVWDETLAKTAEDWAHACLWEHGPSHLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNW 216          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 84.3445 bits (207), Expect = 2.861e-19
Identity = 53/166 (31.93%), Postives = 80/166 (48.19%), Query Frame = 3
Query:   66 DKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRG----VELWYNEAFGFTFSNNT---------CSLKTCGHYTQLVWADSSELGCGLAKCVISK------ENVNLLFCNYGPGGNY 506
            D++ +L  HN  R +V        P+A NM++MVW  E    A  +A++C + H  +D        S+GQN+A+  G+  +R     V+ WY+E   +T+   +         CS   C HYTQLVWA ++ +GC +  C          E    L CNY P GN+
Sbjct:   75 DREEILLLHNKLRSSVY-------PSAANMEHMVWDDELERSATQWAEECRWEHGPQDL-----LMSIGQNLAVHWGR--YRSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNW 226          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000016022.1 (SMESG000016022.1)

HSP 1 Score: 300.827 bits (769), Expect = 1.305e-105
Identity = 144/168 (85.71%), Postives = 151/168 (89.88%), Query Frame = 3
Query:    3 LIKVGFVLVVLEFCSGDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            LIK+ FVLVVL+FCSGDLS  +K+ LL  HN YR  V  G V+GQP ATNM+ MVW+ ESASKAQI ADKCIFAH TKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY
Sbjct:    4 LIKIAFVLVVLDFCSGDLSEKEKNLLLDVHNKYRGNVAQGVVSGQPPATNMQQMVWNAESASKAQISADKCIFAHGTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 171          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017389.1 (SMESG000017389.1)

HSP 1 Score: 253.447 bits (646), Expect = 7.481e-87
Identity = 118/168 (70.24%), Postives = 140/168 (83.33%), Query Frame = 3
Query:    3 LIKVGFVLVVLEFCSGDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            LIK+ FVLVVL+FCSGDLS  +K+ LL  HN YR  V  G V+GQPTA+NM+ MVW+++SASKAQIYADKCIFAHDTKDDRKYGDFE VGQNVA F+G+ I RG ELW+ +  GFTF N+ CSLKTCGHYTQLVWA+S+E+GCGL+KC I   +++LL CNYGPGGNY
Sbjct:    4 LIKIAFVLVVLDFCSGDLSEKEKNLLLNIHNEYRGDVAIGQVSGQPTASNMQLMVWNEKSASKAQIYADKCIFAHDTKDDRKYGDFEWVGQNVAKFAGEIITRGAELWFIQVSGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNY 171          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017389.1 (SMESG000017389.1)

HSP 1 Score: 253.447 bits (646), Expect = 1.865e-86
Identity = 118/168 (70.24%), Postives = 140/168 (83.33%), Query Frame = 3
Query:    3 LIKVGFVLVVLEFCSGDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            LIK+ FVLVVL+FCSGDLS  +K+ LL  HN YR  V  G V+GQPTA+NM+ MVW+++SASKAQIYADKCIFAHDTKDDRKYGDFE VGQNVA F+G+ I RG ELW+ +  GFTF N+ CSLKTCGHYTQLVWA+S+E+GCGL+KC I   +++LL CNYGPGGNY
Sbjct:   34 LIKIAFVLVVLDFCSGDLSEKEKNLLLNIHNEYRGDVAIGQVSGQPTASNMQLMVWNEKSASKAQIYADKCIFAHDTKDDRKYGDFEWVGQNVAKFAGEIITRGAELWFIQVSGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNY 201          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017386.1 (SMESG000017386.1)

HSP 1 Score: 251.906 bits (642), Expect = 2.842e-86
Identity = 118/168 (70.24%), Postives = 137/168 (81.55%), Query Frame = 3
Query:    3 LIKVGFVLVVLEFCSGDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            LI+V FVLVVL+FCSGDLS  +K+ LL  HN  R AV  G  +GQP+A+NM+ MVW+ ESASKAQI ADKCIFAHDT DDRKYGDFE VGQNVA F+G++I RG ELW+N+  GFTF N+ CSLKTCGHYTQ VWADS+ELGCGL+KC I   ++NLL CNYGPGGNY
Sbjct:    4 LIEVAFVLVVLDFCSGDLSEKEKNLLLDVHNERRLAVSIGYASGQPSASNMQQMVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDIARGAELWFNQVSGFTFENSACSLKTCGHYTQFVWADSTELGCGLSKCSIDGIDLNLLVCNYGPGGNY 171          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017377.1 (SMESG000017377.1)

HSP 1 Score: 250.751 bits (639), Expect = 6.900e-86
Identity = 115/168 (68.45%), Postives = 140/168 (83.33%), Query Frame = 3
Query:    3 LIKVGFVLVVLEFCSGDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATNMKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNY 506
            LI+V FVLVVL+FCSGDLS  +K+ LL  HN +R  +  G V+GQP ATNM+ +VW+ ESASKAQI ADKCIFAHDT DDRKYGDFE VGQNVA F+G++I RGV+LW  + FGFTF++N+CSLKTCGHYTQLVWA+S+E+GCGL+KC I   +++LL CNYGPGGNY
Sbjct:    4 LIEVAFVLVVLDFCSGDLSEKEKNLLLSLHNGFRSDIAQGEVSGQPPATNMQRLVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDIARGVDLWSIQVFGFTFADNSCSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNY 171          
The following BLAST results are available for this feature:
BLAST of Venom allergen 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI168.053e-2533.96peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI168.053e-2533.96peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI168.053e-2533.96peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
GLIPR1L11.891e-2436.42GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L12.155e-2436.42GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lon-11.156e-1731.33pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
lon-11.166e-1731.33pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
lon-11.166e-1731.33pep chromosome:WBcel235:III:5474478:5478005:1 gene... [more]
lon-14.317e-1730.87pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
scl-146.099e-1625.54SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84831.420e-2636.71gene:FBgn0038126 transcript:FBtr0082782[more]
CG42703.789e-1031.30gene:FBgn0031407 transcript:FBtr0077754[more]
CG326796.902e-1026.99gene:FBgn0052679 transcript:FBtr0071469[more]
Ag5r1.006e-828.83gene:FBgn0015010 transcript:FBtr0333658[more]
Ag5r1.006e-828.83gene:FBgn0015010 transcript:FBtr0073937[more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
r3hdml6.445e-2535.85R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml6.445e-2535.85R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
pi15a4.431e-2131.98peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
glipr1a7.173e-2134.59GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
glipr1a8.934e-2133.96GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036788.11.028e-2132.91pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
pi151.702e-2031.98peptidase inhibitor 15 [Source:NCBI gene;Acc:10048... [more]
R3HDML3.851e-2031.55R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML4.898e-2031.55R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
crispld22.209e-1931.10cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi162.424e-2433.76peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Glipr1l12.449e-2434.67GLI pathogenesis-related 1 like 1 [Source:MGI Symb... [more]
Pi163.576e-2433.76peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi163.576e-2433.76peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.338e-2333.76peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35786|VA5_VESSQ2.036e-3040.85Venom allergen 5 OS=Vespula squamosa OX=30214 PE=1... [more]
sp|P35787|VA5_VESVI5.504e-3040.36Venom allergen 5 OS=Vespula vidua OX=30215 PE=1 SV... [more]
sp|P0DPU1|VA576_SCODE9.558e-3039.35Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|P35784|VA5_VESGE1.904e-2939.16Venom allergen 5 OS=Vespula germanica OX=30212 PE=... [more]
sp|Q2L6Z1|VAL5_VESMC3.162e-2939.76Venom allergen 5 OS=Vespula maculifrons OX=7453 PE... [more]
back to top
BLAST of Venom allergen 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI852.287e-6070.31GLI pathogenesis related-1 (Fragment) OS=Schmidtea... [more]
A0A564YFQ76.906e-4045.75SCP domain-containing protein OS=Hymenolepis dimin... [more]
A0A0R3SFR14.292e-3845.33SCP domain-containing protein OS=Hymenolepis dimin... [more]
A0A5K3ENG88.141e-3844.22Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A094ZX174.104e-3741.76GLIPR1-like protein 1 (Fragment) OS=Schistosoma ha... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036030.11.854e-2534.59peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000031557.11.930e-2534.59peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.12.820e-2534.59peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
r3hdml7.693e-2433.33R3H domain containing like [Source:NCBI gene;Acc:1... [more]
pi15a1.138e-2231.98peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.18.454e-2230.36pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP31.894e-1833.56cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
ENSPMAT00000002250.18.246e-1227.74pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CLEC18A1.272e-825.00C-type lectin domain family 18 member A [Source:HG... [more]
CRISP21.097e-634.15cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY33.592e-1234.78Cell wall-associated protein involved in export of... [more]
PRY13.544e-1135.04Sterol binding protein involved in the export of a... [more]
PRY28.160e-1134.19Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO486633.334e-1436.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493101.239e-1329.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371141.421e-1330.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493094.842e-1334.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488814.522e-1227.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.24.945e-2435.03peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000020674.24.973e-2131.68cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000020676.21.571e-2032.05cysteine-rich venom protein pseudecin-like [Source... [more]
pi15a1.795e-2030.95peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
crispld22.861e-1931.93cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Venom allergen 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016022.11.305e-10585.71SMESG000016022.1[more]
SMESG000017389.17.481e-8770.24SMESG000017389.1[more]
SMESG000017389.11.865e-8670.24SMESG000017389.1[more]
SMESG000017386.12.842e-8670.24SMESG000017386.1[more]
SMESG000017377.16.900e-8668.45SMESG000017377.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024188 ID=SMED30024188|Name=Venom allergen 5|organism=Schmidtea mediterranea sexual|type=transcript|length=507bp
TTTTAATTAAAGTCGGATTTGTTTTAGTTGTTCTAGAATTTTGTTCTGGA
GATCTTTCTAATGACGATAAAGACGCACTCTTGAGATTCCACAACAATTA
CCGAAGAGCTGTGGTCTATGGAAGCGTTACAGGGCAACCCACAGCAACGA
ACATGAAAAACATGGTATGGAGTAAAGAATCCGCGTCGAAAGCGCAGATC
TACGCGGATAAATGCATATTTGCTCACGACACAAAAGATGACCGTAAATA
CGGAGATTTTGAATCGGTTGGACAGAATGTTGCCATGTTTTCTGGAAAAA
ATATTTTCAGAGGCGTAGAATTGTGGTATAATGAGGCTTTCGGATTCACA
TTTTCAAATAATACCTGTTCATTAAAAACCTGCGGACATTATACACAACT
TGTATGGGCCGACTCTTCAGAGCTTGGCTGTGGATTGGCGAAATGTGTAA
TTTCAAAAGAAAATGTGAATTTGTTGTTTTGCAATTACGGTCCAGGAGGC
AATTATG
back to top

protein sequence of SMED30024188-orf-1

>SMED30024188-orf-1 ID=SMED30024188-orf-1|Name=SMED30024188-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=168bp
LIKVGFVLVVLEFCSGDLSNDDKDALLRFHNNYRRAVVYGSVTGQPTATN
MKNMVWSKESASKAQIYADKCIFAHDTKDDRKYGDFESVGQNVAMFSGKN
IFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVI
SKENVNLLFCNYGPGGNY
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001283CRISP-related
IPR002413V5_allergen-like
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region