Mitogen-activated protein kinase

Overview
NameMitogen-activated protein kinase
Smed IDSMED30024187
Length (bp)1324
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitogen-activated protein kinase (SMED30024187) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitogen-activated protein kinase (SMED30024187) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitogen-activated protein kinase (SMED30024187) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitogen-activated protein kinase (SMED30024187) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK14 (mitogen-activated protein kinase 14 [Source:HGNC Symbol;Acc:HGNC:6876])

HSP 1 Score: 333.183 bits (853), Expect = 2.941e-111
Identity = 166/347 (47.84%), Postives = 232/347 (66.86%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  RY+NL  +G G+ GSVC+AFD++  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ I+++  T       +I +E  +NY ++++  +P ++F   F     +  A+DLL KMLVLD ++RI+A  AL H Y   YHD  DE V  PY  + ES  D+ I+ WK   +D + +FVP
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNY-IQSLTQMPKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK14 (mitogen-activated protein kinase 14 [Source:HGNC Symbol;Acc:HGNC:6876])

HSP 1 Score: 332.413 bits (851), Expect = 6.711e-111
Identity = 166/347 (47.84%), Postives = 233/347 (67.15%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  RY+NL  +G G+ GSVC+AFD++  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E +NY ++++  +P ++F   F     +  A+DLL KMLVLD ++RI+A  AL H Y   YHD  DE V  PY  + ES  D+ I+ WK   +D + +FVP
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRMPSHEARNY-IQSLTQMPKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK11 (mitogen-activated protein kinase 11 [Source:HGNC Symbol;Acc:HGNC:6873])

HSP 1 Score: 325.479 bits (833), Expect = 3.258e-108
Identity = 154/336 (45.83%), Postives = 228/336 (67.86%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKD 1134
            F   +++ + W V  R + L+ +G G+ GSVCSA+D+  +  VA+KKL+ PFQS   A+RTYRE+++L H+ HENVI L+D+F+ + +  +F++VY VT L+  DL+ I+  + + +E++ F +YQ+LRGLKYIHS G+IHRDL P N+AVNED ELRILDFGL+R+ D+ MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  + LF G+D  DQL++IM++  T       +I +E  + Y ++++  +P  D    FR    +  AIDLL +MLVLD +QR+SA +AL H Y   YHD  DE    PY +++E+  +  +E WK+
Sbjct:    8 FYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTY-IQSLPPMPQKDLSSIFR--GANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAK-ERTLEEWKE 339          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK11 (mitogen-activated protein kinase 11 [Source:HGNC Symbol;Acc:HGNC:6873])

HSP 1 Score: 325.479 bits (833), Expect = 3.258e-108
Identity = 154/336 (45.83%), Postives = 228/336 (67.86%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKD 1134
            F   +++ + W V  R + L+ +G G+ GSVCSA+D+  +  VA+KKL+ PFQS   A+RTYRE+++L H+ HENVI L+D+F+ + +  +F++VY VT L+  DL+ I+  + + +E++ F +YQ+LRGLKYIHS G+IHRDL P N+AVNED ELRILDFGL+R+ D+ MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  + LF G+D  DQL++IM++  T       +I +E  + Y ++++  +P  D    FR    +  AIDLL +MLVLD +QR+SA +AL H Y   YHD  DE    PY +++E+  +  +E WK+
Sbjct:    8 FYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTY-IQSLPPMPQKDLSSIFR--GANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAK-ERTLEEWKE 339          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK12 (mitogen-activated protein kinase 12 [Source:HGNC Symbol;Acc:HGNC:6874])

HSP 1 Score: 312.768 bits (800), Expect = 3.183e-103
Identity = 156/348 (44.83%), Postives = 222/348 (63.79%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLK-AIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   ++  + W V + Y +L+ +G G+ G+VCSA D      VAIKKL  PFQS+  AKR YRE+++L HM HENVI L+D+F+      +F D Y V P +  DL K++  E + E+ I F +YQ+L+GL+YIH+ G+IHRDL P N+AVNED EL+ILDFGL+R+ D  MTGYVV+R+YRAPE+I     YT  +D+WS GCIMAEM+  + LF+G+D  DQL++IM++  T    F  ++ ++E KNY    ++ LP ++   F    T     A++LL KMLVLD  QR++A +AL HPY E  HD  DE     Y D+ + + D  ++ WK   +  + +F P
Sbjct:   11 FYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNY----MKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFD-DVDRTLDEWKRVTYKEVLSFKP 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: pmk-1 (Mitogen-activated protein kinase pmk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17446])

HSP 1 Score: 309.301 bits (791), Expect = 4.447e-102
Identity = 163/344 (47.38%), Postives = 227/344 (65.99%), Query Frame = 1
Query:  139 KIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIET---WKDGIWDCMNTF 1161
            +++ S W V + Y NL  IG G+ G+VC+A  +     VAIKK   PFQS   A+RTYRE+++L  M HEN+I L+D+F+ + N  +  DVYFV+ L+  DLS I+  + + +++I F +YQILRGLKYIHS  +IHRDL P NIAVNED EL+ILDFGL+R+ D  MTGYV +R+YRAPEI+    +YT  +D+WS GCI+AE++  + LF G+D  DQL +IM +  T  E F  +I +EE +NY +  +  +   DF + F Q T   +AIDLL KML LDP++R +A +A+ H YL  YHDETDE    P  + ++ N DV  +T   WK  IW+ ++ F
Sbjct:   23 ELNRSVWVVPNYYINLTPIGTGAYGTVCAAECTRSGTRVAIKKFNRPFQSIIHARRTYRELRLLRCMCHENIIDLLDVFTPNENVNDIEDVYFVSMLMGADLSNILKIQRLNDDHIQFLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDFGLARQTDSEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHIDQLTRIMSVTGTPDEEFLKKISSEEARNY-IRNLPKMTRRDFKRLFAQATP--QAIDLLEKMLHLDPDRRPTAKEAMEHEYLAAYHDETDE----PIAEEMDLNDDVRADTIDEWKKIIWEEISDF 359          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: pmk-2 (Mitogen-activated protein kinase pmk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXI4])

HSP 1 Score: 271.937 bits (694), Expect = 2.515e-87
Identity = 150/345 (43.48%), Postives = 214/345 (62.03%), Query Frame = 1
Query:  139 KIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIET----WKDGIWDCMNTF 1161
            +++ + W +   Y +LK +G G+ G VC+A        VAIKK   PFQS   AKRTYRE+K+L  + H+NV+ +ID+F+   +  + N+VYFV+ L+  DL  I+  + + +E I   IYQ+LRGLKYIHS G+IHRDL P NIAVNE  E++ILDFGL+R +D  MTGYV +R+YRAPEI+    +YT  +D+WS GCI+AE++  R LF G+D  DQL +IM +  T  E FW +I +EE +NY      ++   DF   F   +    A++LL  ML+LDP++RIS + AL H YL  Y    DE V    +DT+  +   +  T    W++ IW+ +  F
Sbjct:   37 ELNKTKWVLPQWYNSLKPLGEGAYGVVCTAEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPDASSLNNVYFVSVLMGSDLQNIMKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSNIAVNERCEVKILDFGLARAQDAEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELVSGRPLFPGDDHIDQLTKIMSVVGTPKEEFWSKIQSEEARNYIKNRSPIIRQ-DFVTLFPMASP--YALELLEMMLILDPDRRISVSSALRHDYLREYSVPNDEPVA---MDTVTIDPAEERATTLSDWRELIWNEIRLF 375          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: pmk-2 (Mitogen-activated protein kinase pmk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXI4])

HSP 1 Score: 271.552 bits (693), Expect = 4.030e-87
Identity = 153/351 (43.59%), Postives = 216/351 (61.54%), Query Frame = 1
Query:  139 KIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIET----------WKDGIWDCMNTF 1161
            +++ + W +   Y +LK +G G+ G VC+A        VAIKK   PFQS   AKRTYRE+K+L  + H+NV+ +ID+F+   +  + N+VYFV+ L+  DL  I+  + + +E I   IYQ+LRGLKYIHS G+IHRDL P NIAVNE  E++ILDFGL+R +D  MTGYV +R+YRAPEI+    +YT  +D+WS GCI+AE++  R LF G+D  DQL +IM +  T  E FW +I +EE +NY      ++   DF   F   +    A++LL  ML+LDP++RIS + AL H YL  Y    DE V    +DT+  NS V I+           W++ IW+ +  F
Sbjct:   37 ELNKTKWVLPQWYNSLKPLGEGAYGVVCTAEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPDASSLNNVYFVSVLMGSDLQNIMKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSNIAVNERCEVKILDFGLARAQDAEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELVSGRPLFPGDDHIDQLTKIMSVVGTPKEEFWSKIQSEEARNYIKNRSPIIRQ-DFVTLFPMASP--YALELLEMMLILDPDRRISVSSALRHDYLREYSVPNDEPVA---MDTV-INSIVTIDPAEERATTLSDWRELIWNEIRLF 380          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: jnk-1 (Stress-activated protein kinase jnk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQG9])

HSP 1 Score: 245.743 bits (626), Expect = 1.862e-77
Identity = 139/362 (38.40%), Postives = 213/362 (58.84%), Query Frame = 1
Query:  109 IKVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDD--FMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDL-------------KAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVD--IETWKDGIW 1143
            I V   + +  I  +   V+ RY+NL++IG G+QG VCSAFD+     VAIKKL+ PFQ+   AKR YRE+K++  ++H+N+I +++ F+       FND+Y V  L+  +L ++I  + +  E + + +YQ+L G++++HS G+IHRDL P NI V  D  L+ILDFGL+R   +   MT YVV+RYYRAPE+I     Y   +D+WS GCI  E++  R+LF G D  DQ  +I++   T    F  ++     +NY    VE  P      F   +++++             +A DLLS+MLV+DP +RIS  DAL HPY+  + DE +  V AP     + N DV+  +++W++ I+
Sbjct:    6 IHVPENYYSVTIGEAQMVVLKRYQNLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIGILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMD-LDHERLSYLLYQMLCGIRHLHSAGIIHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVIL-GMGYKENVDVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERL-QPTVRNY----VENRPRYQATPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDEIE--VYAPPPLPYDHNMDVEQNVDSWREHIF 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: jnk-1 (Stress-activated protein kinase jnk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQG9])

HSP 1 Score: 245.743 bits (626), Expect = 1.862e-77
Identity = 139/362 (38.40%), Postives = 213/362 (58.84%), Query Frame = 1
Query:  109 IKVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDD--FMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDL-------------KAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVD--IETWKDGIW 1143
            I V   + +  I  +   V+ RY+NL++IG G+QG VCSAFD+     VAIKKL+ PFQ+   AKR YRE+K++  ++H+N+I +++ F+       FND+Y V  L+  +L ++I  + +  E + + +YQ+L G++++HS G+IHRDL P NI V  D  L+ILDFGL+R   +   MT YVV+RYYRAPE+I     Y   +D+WS GCI  E++  R+LF G D  DQ  +I++   T    F  ++     +NY    VE  P      F   +++++             +A DLLS+MLV+DP +RIS  DAL HPY+  + DE +  V AP     + N DV+  +++W++ I+
Sbjct:    6 IHVPENYYSVTIGEAQMVVLKRYQNLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIGILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMD-LDHERLSYLLYQMLCGIRHLHSAGIIHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVIL-GMGYKENVDVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERL-QPTVRNY----VENRPRYQATPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDEIE--VYAPPPLPYDHNMDVEQNVDSWREHIF 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: p38b (gene:FBgn0024846 transcript:FBtr0080534)

HSP 1 Score: 328.561 bits (841), Expect = 9.504e-110
Identity = 168/355 (47.32%), Postives = 228/355 (64.23%), Query Frame = 1
Query:  112 KVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLF--SSSANRIN-FNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            + M KF    I+ ++W +   Y+NL+ +G G+ G VC A        VAIKKLA PFQS   AKRTYRE+++L HMDHENVI L+D+F     A+ ++ F  VY VT L+  DL+ II  + + ++++ F +YQILRGLKYIHS GVIHRDL P NIAVNED ELRILDFGL+R  +  MTGYV +R+YRAPEI+    +Y    D+WS GCIMAE+L  R LF G D   QL  IM++  T  + F  +I +E  +NY + ++ ++P  +F   FR    +  AIDLL KML LD ++RI+A  AL HPY+E YHD TDE   A Y  + E N ++ +E W++ ++  +  F P
Sbjct:    3 RKMAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQKLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNY-IRSLPVMPRRNFRDIFR--GANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDEQTAALYDQSFEEN-ELPVEKWREMVFSEVTAFKP 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: p38a (gene:FBgn0015765 transcript:FBtr0084580)

HSP 1 Score: 313.153 bits (801), Expect = 1.202e-103
Identity = 161/357 (45.10%), Postives = 227/357 (63.59%), Query Frame = 1
Query:  109 IKVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLF---SSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQY-TEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            + + +KF    I+ ++W +   Y++L+ +G G+ G V  A      ++VAIKKLA PFQS   AKRTYRE+++L HMDHENVI L+D+F    ++ +  NF  VY VT L+  DL+ II  + + ++++ F +YQILRGLKYIHS GVIHRDL P NIAVNED ELRILDFGL+R  ++ MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE++  R LF G D   QL  IM++  T    F  +I +E  ++Y    ++ LPP+    F   +   +  AIDLL KML LD  +RI+A +AL HPYLE Y + + E    PY  + E + D+ ++ WK+ I+  +  F P
Sbjct:    3 VSITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSY----IQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFE-DMDLPVDKWKELIYKEVTNFKP 354          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: p38a (gene:FBgn0015765 transcript:FBtr0300572)

HSP 1 Score: 313.153 bits (801), Expect = 1.202e-103
Identity = 161/357 (45.10%), Postives = 227/357 (63.59%), Query Frame = 1
Query:  109 IKVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLF---SSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQY-TEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            + + +KF    I+ ++W +   Y++L+ +G G+ G V  A      ++VAIKKLA PFQS   AKRTYRE+++L HMDHENVI L+D+F    ++ +  NF  VY VT L+  DL+ II  + + ++++ F +YQILRGLKYIHS GVIHRDL P NIAVNED ELRILDFGL+R  ++ MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE++  R LF G D   QL  IM++  T    F  +I +E  ++Y    ++ LPP+    F   +   +  AIDLL KML LD  +RI+A +AL HPYLE Y + + E    PY  + E + D+ ++ WK+ I+  +  F P
Sbjct:    3 VSITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSY----IQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFE-DMDLPVDKWKELIYKEVTNFKP 354          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: p38a (gene:FBgn0015765 transcript:FBtr0084581)

HSP 1 Score: 313.153 bits (801), Expect = 1.202e-103
Identity = 161/357 (45.10%), Postives = 227/357 (63.59%), Query Frame = 1
Query:  109 IKVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLF---SSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQY-TEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            + + +KF    I+ ++W +   Y++L+ +G G+ G V  A      ++VAIKKLA PFQS   AKRTYRE+++L HMDHENVI L+D+F    ++ +  NF  VY VT L+  DL+ II  + + ++++ F +YQILRGLKYIHS GVIHRDL P NIAVNED ELRILDFGL+R  ++ MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE++  R LF G D   QL  IM++  T    F  +I +E  ++Y    ++ LPP+    F   +   +  AIDLL KML LD  +RI+A +AL HPYLE Y + + E    PY  + E + D+ ++ WK+ I+  +  F P
Sbjct:    3 VSITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSY----IQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFE-DMDLPVDKWKELIYKEVTNFKP 354          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: p38c (gene:FBgn0267339 transcript:FBtr0084582)

HSP 1 Score: 270.011 bits (689), Expect = 5.816e-87
Identity = 152/355 (42.82%), Postives = 209/355 (58.87%), Query Frame = 1
Query:  118 MRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSA-NRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYL----EFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            M +F    I+ S W     YE ++ +G GS G V        + Y A+K+L  PF+ ++ AK TYRE+++L HM+H NVI L+++F   A N + F  VY VT L+  DL +    + M ++ I   +YQILRGLKYIHS GV+HRDL P NIAVN ++E+RILDFGLSR   D MT +V + +Y APEIIF    YT  ID+WS GCI+AE++  R+LFRG +   Q+R ++ I  T    F   I  E  +NY LE   L    DFH  F  Y  D++AIDL+ KML + P +RI+A +A+LHPYL    E +H   D    AP  D    N  + ++ WK+ +   +  F P
Sbjct:    1 MPEFVRVAINESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLNVFHPPAHNMMEFQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADKMTDHVGTMWYLAPEIIFLRGQYTKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNY-LEGYPLRQRCDFHHLFMGY--DVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDT---APVYDQNFENMVLPVKCWKELVSHEIRNFRP 349          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk11 (mitogen-activated protein kinase 11 [Source:ZFIN;Acc:ZDB-GENE-040625-75])

HSP 1 Score: 337.035 bits (863), Expect = 5.865e-113
Identity = 165/345 (47.83%), Postives = 234/345 (67.83%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTF 1161
            F   +++ + W V  RY+NL  +G G+ GSVCSA+D   +  VA+KKL+ PFQS   ++RTYRE+++L HM HENVI L+D+F+ +A+   FN+VY VT L+  DL+ I+  + + +E++ F IYQ+LRGLKYIHS G+IHRDL P N+AVNED ELRILDFGL+R+ DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIM E+L  ++LF GND  DQL++IM++  T       +I +E  + Y ++++  +P  D  + FR    +  A+DLL KMLVLD + RISA++AL HPY   YHD  DE    PY  T ES  D  +E WK+ +++ ++ F
Sbjct:    7 FYRQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDVRLRQKVAVKKLSRPFQSLIHSRRTYRELRLLKHMKHENVIGLLDVFTPAASLEEFNEVYLVTNLMGADLNNIVKFQRLSDEHVQFLIYQLLRGLKYIHSAGLIHRDLKPSNVAVNEDCELRILDFGLARQTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMGELLKGKVLFPGNDYIDQLKRIMEVVGTPTPDVLKKISSEHAQKY-IQSLPHMPQQDLGKIFR--GANPLAVDLLKKMLVLDCDGRISASEALCHPYFSQYHDPEDEPEAPPYDQTPESK-DRTMEEWKELVFEEVSNF 347          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 332.798 bits (852), Expect = 2.707e-111
Identity = 166/349 (47.56%), Postives = 231/349 (66.19%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKI 1173
            F   +++ + W V  +Y+NL  +G G+ GSVCSAFD++    VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ IM +  T   G   +I +E  + Y + ++  +P  +F   F     + +A+DLL KMLVLD ++RI+A +AL HPY   YHD  DE    P+  + ES  ++DIE WK   ++ M +F P +
Sbjct:    9 FYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPFQSIIHAKRTYRELRLLKHMRHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMLLVGTPGPGLLMKISSESARTY-ISSLPQMPKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEAEPFDQSFESR-ELDIEEWKRQTYEEMISFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 332.798 bits (852), Expect = 2.707e-111
Identity = 166/349 (47.56%), Postives = 231/349 (66.19%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKI 1173
            F   +++ + W V  +Y+NL  +G G+ GSVCSAFD++    VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ IM +  T   G   +I +E  + Y + ++  +P  +F   F     + +A+DLL KMLVLD ++RI+A +AL HPY   YHD  DE    P+  + ES  ++DIE WK   ++ M +F P +
Sbjct:    9 FYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPFQSIIHAKRTYRELRLLKHMRHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMLLVGTPGPGLLMKISSESARTY-ISSLPQMPKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEAEPFDQSFESR-ELDIEEWKRQTYEEMISFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk14b (mitogen-activated protein kinase 14b [Source:NCBI gene;Acc:266756])

HSP 1 Score: 332.028 bits (850), Expect = 5.364e-111
Identity = 167/354 (47.18%), Postives = 232/354 (65.54%), Query Frame = 1
Query:  112 KVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKI 1173
            K    F   +++ + W V  RY+NL  +G G+ GSVCSAFD +  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+FS + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILR LKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E +NY + ++  +P  +F   F     +  A+DLL KMLVLD ++RI+A+ AL HPY   YHD  DE    PY  + ES  D++IE WK   ++ + +F P +
Sbjct:    4 KARPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCSAFDGKAGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFSPATSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRALKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASLISRMPSHEARNY-ISSLPHMPKRNFADVF--IGANPLAVDLLEKMLVLDTDKRITASQALAHPYFAQYHDPDDEPEADPYDQSFESR-DLEIEEWKSLTYEEVMSFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 331.643 bits (849), Expect = 8.741e-111
Identity = 164/349 (46.99%), Postives = 232/349 (66.48%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKI 1173
            F   +++ + W V  +Y+NL  +G G+ GSVCSAFD++    VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E + Y + ++  +P  +F   F     + +A+DLL KMLVLD ++RI+A +AL HPY   YHD  DE    P+  + ES  ++DIE WK   ++ M +F P +
Sbjct:    9 FYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPFQSIIHAKRTYRELRLLKHMRHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPSSLISRMPSHEARTY-ISSLPQMPKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEAEPFDQSFESR-ELDIEEWKRQTYEEMISFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: pde6a (phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-988755])

HSP 1 Score: 342.043 bits (876), Expect = 1.039e-114
Identity = 166/337 (49.26%), Postives = 231/337 (68.55%), Query Frame = 1
Query:  157 WHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            W V  RY+NL  +G G+ GSVCSAFD+  ++ VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS G+IHRDL P N+AVNED EL+ILDFGL+R  D+ MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ I+++  T       +I +E  +NY ++++  +P ++F   F     + +A+DLL KMLVLD ++RI+A +AL HPY   YHD  DE +  PY  + ES  ++DIE WK   ++ +  FVP
Sbjct:   19 WEVPDRYQNLTPVGSGAYGSVCSAFDTRTELRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSFEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHTDEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPEPELLQKISSEAARNY-IQSLPYMPKMNFEDVF--LGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPIAEPYDQSFESR-ELDIEEWKRLTYEEVICFVP 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: pde6a (phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-988755])

HSP 1 Score: 341.658 bits (875), Expect = 1.320e-114
Identity = 166/337 (49.26%), Postives = 232/337 (68.84%), Query Frame = 1
Query:  157 WHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            W V  RY+NL  +G G+ GSVCSAFD+  ++ VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS G+IHRDL P N+AVNED EL+ILDFGL+R  D+ MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E +NY ++++  +P ++F   F     + +A+DLL KMLVLD ++RI+A +AL HPY   YHD  DE +  PY  + ES  ++DIE WK   ++ +  FVP
Sbjct:   19 WEVPDRYQNLTPVGSGAYGSVCSAFDTRTELRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSFEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHTDEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPSYLINRMPSHEARNY-IQSLPYMPKMNFEDVF--LGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPIAEPYDQSFESR-ELDIEEWKRLTYEEVICFVP 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: mapk11 (mitogen-activated protein kinase 11 [Source:NCBI gene;Acc:100101766])

HSP 1 Score: 337.421 bits (864), Expect = 6.800e-113
Identity = 170/355 (47.89%), Postives = 243/355 (68.45%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP---KIENL 1182
            F   +++ + W V  RY+ L  +G G+ GSVCSA+D++ +  VA+KKL+ PFQS   A+RTYRE+++L HM HENVI L+D+F+ S +  NFN+VY VT L+  DL+ I+  + + +++I F IYQ+LRGLKYIHS G+IHRDL P N+AVNED ELRILDFGL+R+ DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  + LF GND  DQL++IM++  T +  F  +I +E  + Y +E++  +P  D  + F  +  +  AIDLL KML+LD ++RI+AT+AL HPY   YHD  DE    PY ++ E N +  I+ WK+  ++ + +F     KI+NL
Sbjct:    7 FYKQELNKTVWEVPDRYQRLTPVGSGAFGSVCSAYDTKTRQKVAVKKLSRPFQSLVHARRTYRELRLLKHMKHENVIGLLDVFTPSTSGENFNEVYLVTNLMGADLNNIVKCQKLTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGTPNSEFLLKISSEHARRY-IESLPYMPQQDLKEVF--HGANPLAIDLLEKMLILDSDKRITATEALAHPYFVQYHDPDDEPEAEPYDESTE-NKERTIDEWKEITYEEVISFKSQDVKIDNL 357          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: mapk12 (mitogen-activated protein kinase 12 [Source:NCBI gene;Acc:549834])

HSP 1 Score: 333.569 bits (854), Expect = 1.825e-111
Identity = 167/344 (48.55%), Postives = 226/344 (65.70%), Query Frame = 1
Query:  157 WHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPI---DFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIEN 1179
            W V  RY +L  +G G+ G+VCS+ D+     VAIKKL  PFQS+  AKR YRE+++L HM HENVI L+D+F+  +   NFND Y V P +  DL KI+  E + E+ I F +YQILRGLKYIHS G+IHRDL P N+AVNED EL+ILDFGL+R  D  MTGYVV+R+YRAPE+I    +YT  +D+WS GCIMAEM   R LF+GND  DQL +IM+I  T  + F  ++ + + KNY    ++ LP +   DF    R Y   L A+++L KMLVLD  +RI+AT+AL HPY E +HD  DE+   PY D+ + N ++ +E W+      + ++ P + +
Sbjct:   21 WEVKERYRDLVAVGSGAYGTVCSSLDTRTGTKVAIKKLYRPFQSELFAKRAYRELRLLKHMQHENVIGLLDVFTPDSTLENFNDFYLVMPFMGTDLGKIMKHEKLSEDRIQFLVYQILRGLKYIHSAGIIHRDLKPGNLAVNEDCELKILDFGLARHTDSEMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMYTGRPLFKGNDHLDQLTEIMKITGTPTQDFVQKLQSPDAKNY----IKSLPKVQKKDFGSLLR-YANPL-AVNILEKMLVLDAEKRITATEALAHPYFEQFHDIDDETEAEPYDDSFD-NVNLPLEEWRRLTHKELTSYKPLVAD 357          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: mapk11 (mitogen-activated protein kinase 11 [Source:NCBI gene;Acc:100101766])

HSP 1 Score: 325.094 bits (832), Expect = 5.655e-108
Identity = 164/339 (48.38%), Postives = 225/339 (66.37%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNY-FLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGI 1140
            F   +++ + W V  RY+ L  +G G+ GSVCSA+D++ +  VA+KKL+ PFQS   A+RTYRE+++L HM HENVI L+D+F+ S +  NFN+VY VT L+  DL+ I+  + + +++I F IYQ+LRGLKYIHS G+IHRDL P N+AVNED ELRILDFGL+R+ DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  + LF GND  DQL++IM++  T +  F  +I +E    + FL                     LKAIDLL KML+LD ++RI+AT+AL HPY   YHD  DE    PY ++ E N +  I+ WK  +
Sbjct:    7 FYKQELNKTVWEVPDRYQRLTPVGSGAFGSVCSAYDTKTRQKVAVKKLSRPFQSLVHARRTYRELRLLKHMKHENVIGLLDVFTPSTSGENFNEVYLVTNLMGADLNNIVKCQKLTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGTPNSEFLLKISSEHVSRFSFL---------------------LKAIDLLEKMLILDSDKRITATEALAHPYFVQYHDPDDEPEAEPYDESTE-NKERTIDEWKGKV 323          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk14 (mitogen-activated protein kinase 14 [Source:MGI Symbol;Acc:MGI:1346865])

HSP 1 Score: 330.872 bits (847), Expect = 1.623e-110
Identity = 166/347 (47.84%), Postives = 231/347 (66.57%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  RY+NL  +G G+ GSVC+AFD++    VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ I+++  T       +I +E  +NY ++++  +P ++F   F     +  A+DLL KMLVLD ++RI+A  AL H Y   YHD  DE V  PY  + ES  D+ I+ WK   +D + +FVP
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNY-IQSLAQMPKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk14 (mitogen-activated protein kinase 14 [Source:MGI Symbol;Acc:MGI:1346865])

HSP 1 Score: 330.487 bits (846), Expect = 2.560e-110
Identity = 166/347 (47.84%), Postives = 232/347 (66.86%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  RY+NL  +G G+ GSVC+AFD++    VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E +NY ++++  +P ++F   F     +  A+DLL KMLVLD ++RI+A  AL H Y   YHD  DE V  PY  + ES  D+ I+ WK   +D + +FVP
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRMPSHEARNY-IQSLAQMPKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk11 (mitogen-activated protein kinase 11 [Source:MGI Symbol;Acc:MGI:1338024])

HSP 1 Score: 327.02 bits (837), Expect = 5.228e-109
Identity = 156/347 (44.96%), Postives = 232/347 (66.86%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  R + L+ +G G+ GSVCSA+D+  +  VA+KKL+ PFQS   A+RTYRE+++L H+ HENVI L+D+F+ + +  +F++VY VT L+  DL+ I+  + + +E++ F +YQ+LRGLKYIHS G+IHRDL P N+AVNED ELRILDFGL+R+ D+ MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  + LF GND  DQL++IM++  T       +I +E  + Y ++++  +P  D    F  +  +  AIDLL +MLVLD +QR+SA +AL H Y   YHD  DE    PY +++E+     +E WK+  +  + +F P
Sbjct:    8 FYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEHARTY-IQSLPPMPQKDLSSVF--HGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERT-LEEWKELTYQEVLSFKP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk12 (mitogen-activated protein kinase 12 [Source:MGI Symbol;Acc:MGI:1353438])

HSP 1 Score: 323.939 bits (829), Expect = 1.201e-107
Identity = 162/350 (46.29%), Postives = 226/350 (64.57%), Query Frame = 1
Query:  121 RKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTE-DLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            + F   ++  + W V + Y++L+ +G G+ G+VCSA DS     VAIKKL  PFQS+  AKR YRE+++L HM HENVI L+D+F+   +  +F D Y V P +  DL K++  E + E+ I F +YQ+L+GLKYIH+ GVIHRDL P N+AVNED EL+ILDFGL+R+ D  MTGYVV+R+YRAPE+I     YT  +D+WS GCIMAEM+  +ILF+GND  DQL++IM+I  T    F  ++ + E KNY    +E LP ++   F    T    +A++LL +MLVLD  QR++A +AL HPY E   D  DE     Y D+ + + D  +E WK   +  + +F P
Sbjct:    9 KGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLMKHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMKITGTPPPEFVQKLQSAEAKNY----MEGLPELEKKDFASVLTNASPQAVNLLERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFD-DVDRTLEEWKRVTYKEVLSFKP 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk13 (mitogen-activated protein kinase 13 [Source:MGI Symbol;Acc:MGI:1346864])

HSP 1 Score: 301.212 bits (770), Expect = 7.456e-99
Identity = 153/350 (43.71%), Postives = 222/350 (63.43%), Query Frame = 1
Query:  121 RKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDES-VGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            R F    I+ + W +   Y     +G G+ G+VCSA D      VAIKKL+ PFQS+  AKR YRE+ +L HM HENVI L+D+F+ +++  +F+D Y V P +  DL KI+  EF  E+ + + +YQ+L+GLKYIHS G++HRDL P N+AVNED EL+ILDFGL+R  D  MTGYVV+R+YRAPE+I    +Y   +D+WS GCIMAEML  + LF+G D  DQL QI+++       F  ++  +  K+Y ++++   P  DF Q F + +   +A DLL KML LD ++R++A  AL HP+ E + D  +E+    P+ D LE +  + ++ WK  I+  ++ F P
Sbjct:    7 RGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMHHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGMEF-SEDKVQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDTEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGAEFVQKLKDKAAKSY-IQSLPQSPKKDFTQLFPRASP--QAADLLDKMLELDVDKRLTAAQALAHPFFEPFRDPEEETEAQQPFDDALE-HEKLSVDEWKQHIYKEISNFSP 351          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|P47812|MK14_XENLA (Mitogen-activated protein kinase 14 OS=Xenopus laevis OX=8355 GN=mapk14 PE=2 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.544e-112
Identity = 164/337 (48.66%), Postives = 229/337 (67.95%), Query Frame = 1
Query:  157 WHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            W V  RY+NL  +G G+ GSVCS+FD+   + +A+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+FS + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS G+IHRDL P N+AVNED EL+ILDFGL+R  D+ MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ I+++  T       +I +E  +NY ++++  +P ++F   F     + +A+DLL KMLVLD ++RI+A +AL H Y   YHD  DE +  PY  + ES  ++DIE WK   ++ +  FVP
Sbjct:   19 WEVPDRYQNLTPVGSGAYGSVCSSFDTRTALRIAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFSPAKSFEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHTDEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPEPELLQKISSEAARNY-IQSLPYMPKMNFEDVF--LGANPQAVDLLEKMLVLDTDKRITAAEALAHSYFAQYHDPDDEPIAEPYDQSFESR-ELDIEEWKRLTYEEVTCFVP 351          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q9I958|MK14B_CYPCA (Mitogen-activated protein kinase 14B OS=Cyprinus carpio OX=7962 GN=mapk14b PE=1 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 9.769e-111
Identity = 167/349 (47.85%), Postives = 230/349 (65.90%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKI 1173
            F   +++ + W V  RY+NL  +G G+ GSVCSA D++  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D FS +     FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E +NY + ++  +P  +F   F     +  A+DLL KMLVLD ++RI+A+ AL HPY   YHD  DE    PY  + ES  D+DIE WK   ++ + +F P +
Sbjct:    9 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCSALDTKSGLRVAVKKLSRPFQSMIHAKRTYRELRLLKHMKHENVIGLLDAFSPATCLAGFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASLISRMPSHEARNY-INSLSYMPKRNFADVF--VGANPMAVDLLEKMLVLDTDKRITASQALAHPYFAQYHDPDDEPEADPYDQSFESR-DLDIEEWKRLTYEEVISFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|O02812|MK14_CANLF (Mitogen-activated protein kinase 14 OS=Canis lupus familiaris OX=9615 GN=MAPK14 PE=2 SV=3)

HSP 1 Score: 333.569 bits (854), Expect = 1.162e-110
Identity = 166/347 (47.84%), Postives = 232/347 (66.86%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  RY+NL  +G G+ GSVC+AFD++  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ I+++  T       +I +E  +NY ++++  +P ++F   F     +  A+DLL KMLVLD ++RI+A  AL H Y   YHD  DE V  PY  + ES  D+ I+ WK   +D + +FVP
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGADLLKKISSESARNY-IQSLTQMPKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVVSFVP 350          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q16539|MK14_HUMAN (Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14 PE=1 SV=3)

HSP 1 Score: 333.183 bits (853), Expect = 1.413e-110
Identity = 166/347 (47.84%), Postives = 232/347 (66.86%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  RY+NL  +G G+ GSVC+AFD++  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ I+++  T       +I +E  +NY ++++  +P ++F   F     +  A+DLL KMLVLD ++RI+A  AL H Y   YHD  DE V  PY  + ES  D+ I+ WK   +D + +FVP
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNY-IQSLTQMPKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q95NE7|MK14_PANTR (Mitogen-activated protein kinase 14 OS=Pan troglodytes OX=9598 GN=MAPK14 PE=2 SV=3)

HSP 1 Score: 332.413 bits (851), Expect = 3.223e-110
Identity = 166/347 (47.84%), Postives = 233/347 (67.15%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  RY+NL  +G G+ GSVC+AFD++  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E +NY ++++  +P ++F   F     +  A+DLL KMLVLD ++RI+A  AL H Y   YHD  DE V  PY  + ES  D+ I+ WK   +D + +FVP
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRMPSHEARNY-IQSLTQMPKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A4E0RTP7 (Mitogen-activated protein kinase OS=Fasciola hepatica OX=6192 GN=D915_005042 PE=4 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 1.037e-118
Identity = 165/352 (46.88%), Postives = 242/352 (68.75%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 1182
            F   +++ S W V  RY++L ++GHG+ G VC+A+D+  +  VAIKKL  PF+ ++ AKRT+RE+KIL H+DHEN++CLID FS   +   F DVY VTPL+  DL  +I  + + + +I F +YQILR LKY+HS G++HRDL P NIAVNED EL+ILDFGL+R+KD+ MTGYV +R+YRAPEI+    +Y   +D+WS  CIMAE+   + LF G +  DQ++ IM++     E    +I ++  ++ F+ ++ +  P D + +F  ++ D  AIDLL K+L LDP++R +AT AL HPY + YHD+ DE VG P++D LE  +DV +E WK  +W+ +  FVPK+++L
Sbjct:   18 FVQTELNLSIWLVPERYQDLTLLGHGAYGVVCTAYDTRLQRRVAIKKLTKPFEDKEYAKRTHRELKILSHVDHENILCLIDAFSPQTSLEQFKDVYLVTPLMGADLEAVIRSQSLSDGHIRFLVYQILRALKYMHSAGLVHRDLKPVNIAVNEDCELKILDFGLARRKDEVMTGYVTTRWYRAPEIMLNWMHYNESVDIWSTACIMAELRTRKPLFTGKNHIDQIKMIMRVLGKPDEECMKKITSQNARD-FVASIAIEEPQDLYTYFAGFSPD--AIDLLQKLLHLDPDRRYTATQALAHPYFQGYHDDQDEPVGEPFIDPLEDRTDVSLEEWKKHVWNALENFVPKLDSL 366          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A4S2L8C7 (Mitogen-activated protein kinase OS=Opisthorchis felineus OX=147828 GN=CRM22_009273 PE=4 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 4.972e-113
Identity = 160/352 (45.45%), Postives = 234/352 (66.48%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 1182
            F T   +++ W V  RY +L +IGHG  G+VCSA+DS+    VAIKKL  PF   + AKRTYRE++IL H+ HEN++CLID FS  ++   F D+Y VTP ++ DLS ++  + + + +I F IYQ+LR LKY+HS G+IHRDL P NI VNED EL++LDFGL+R++DD MTGYV +R+YRAPEI+   ++Y  ++D+WS  CIM+E+   + LF G +  DQLR+I+ +     E +  ++     ++ F++ +E+  P D + +F  + ED   +DLL  +L LDP++R +A+ AL H Y E YHDE DE  G  ++D LE   DV ++ WK+ IW  +  FVPK+ +L
Sbjct:   20 FVTVDFNHTQWTVPERYRDLSLIGHGVYGAVCSAYDSQLHRRVAIKKLTKPFDDSEYAKRTYRELRILAHVSHENILCLIDAFSPQSSLDTFKDLYLVTPFMAADLSAVVRTQDLSDSHIRFLIYQLLRALKYLHSCGLIHRDLKPGNIGVNEDCELKLLDFGLARQRDDEMTGYVATRWYRAPEIMLNWTHYNEQVDIWSVACIMSELRTRKPLFPGRNHIDQLRRIICLLGKPDELYMEKVTGAGARS-FIDNLEVTDPSDLNVYFSDFPED--GVDLLRHLLQLDPDRRYTASQALAHRYFELYHDEQDEPTGDRFVDALEEAKDVSVQEWKEHIWKTLENFVPKLNSL 368          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A2U9K5Z7 (Mitogen-activated protein kinase OS=Bugula neritina OX=10212 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 1.166e-112
Identity = 164/342 (47.95%), Postives = 234/342 (68.42%), Query Frame = 1
Query:  157 WHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 1182
            W V  RY+ L  +G G+ G VCSA D+E  + VAIKKL  PFQS   A+RT+RE+K+L HM+HEN+I L+ +F+ + +   F+DVY VT L+  DL+ I+  + + +E++ F IYQILRGLKY+HS G+IHRDL P NIAVNED EL+ILDFGL+R+ DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE++  + LF GNDQ DQL +IM++  T    F  +I ++E + Y + +++++P  DF ++F     D  A+DLL +ML LD ++RI+A +AL HPYL  YHDE+DE    P+ D+ E + +  +  W+  +W   N F+P+ E L
Sbjct:   25 WEVPKRYQMLSPVGTGAYGQVCSALDTEKNMKVAIKKLTRPFQSPIHARRTFREIKMLKHMNHENIIGLLAIFTPATSIEKFSDVYLVTNLMGADLNNIVRTQKLTDEHVQFLIYQILRGLKYVHSAGIIHRDLKPSNIAVNEDCELKILDFGLARQADDSMTGYVATRWYRAPEIMLNWMHYNRTVDIWSVGCIMAELMTGKTLFPGNDQIDQLHKIMKLVGTPGPEFLKRITSDEARRY-IASLQVMPKRDFREYFLGSNPD--ALDLLERMLDLDADRRITAPEALRHPYLAQYHDESDEPEAEPFDDSFE-HVEKTVADWRLAVWGETNNFIPREEQL 362          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: G7YQ71 (Mitogen-activated protein kinase OS=Clonorchis sinensis OX=79923 GN=CLF_106854 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 2.924e-112
Identity = 160/352 (45.45%), Postives = 233/352 (66.19%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 1182
            F T   +++ W V  RY +L +IGHG  G+VCSA+DS+    VAIKKL  PF   + AKRTYRE++IL H+ HEN++CLID FS  ++   F D+Y VTP ++ DLS ++  + + + +I F IYQ+LR LKY+HS G+IHRDL P NI VNED EL++LDFGL+R++DD MTGYV +R+YRAPEI+   ++Y  ++D+WS  CIM+E+   + LF G +  DQLR+I+ +     E +  ++     ++ F++ +E+  P D   +F  + ED   +DLL  +L LDP++R +A+ AL H Y E YHDE DE  G  ++D LE   DV ++ WK+ IW  +  FVPK+ +L
Sbjct:   32 FVTVDFNHTQWTVPERYRDLSLIGHGVYGAVCSAYDSQLHRRVAIKKLTKPFDDSEYAKRTYRELRILAHVSHENILCLIDAFSPQSSLDTFKDLYLVTPFMAADLSAVVRTQDLSDSHIRFLIYQLLRALKYLHSCGLIHRDLKPGNIGVNEDCELKLLDFGLARQRDDEMTGYVATRWYRAPEIMLNWTHYNEQVDIWSVACIMSELRTRKPLFPGRNHIDQLRRIICLLGKPDELYMEKVTGAGARS-FIDNLEVTNPPDLSVYFSDFPED--GVDLLRHLLQLDPDRRYTASQALAHRYFELYHDEQDEPTGDRFVDALEEAKDVSVQEWKEHIWKTLEDFVPKLNSL 380          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A2I4CR37 (Mitogen-activated protein kinase OS=Austrofundulus limnaeus OX=52670 GN=LOC106531214 PE=4 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 5.509e-112
Identity = 164/345 (47.54%), Postives = 237/345 (68.70%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTF 1161
            F   +++ + W V  RY+NL  +G G+ GSVCSA+D   +  VA+KKL+ PFQS   ++R+YRE+++L HM HENVI L+D+F+ +A+  +FN++Y VT L+  DL+ I+  + + +E++ F IYQ+LRGLKYIHS G+IHRDL P N+AVNED ELRILDFGL+R+ DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIM E+L  ++LF G D  DQL++IM++  T       +IC+E  + Y ++++  +PP D  + FR    +  A+DLL +MLVLD ++RISA +AL HPY   YHD  DE    PY  TLES  D  +E WK+ +++ + +F
Sbjct:    7 FYRQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDVVLRQKVAVKKLSRPFQSLIHSRRSYRELRLLKHMKHENVIGLLDVFTPAASLEDFNELYLVTNLMGADLNNIVKFQRLSDEHVQFLIYQLLRGLKYIHSAGLIHRDLKPSNVAVNEDCELRILDFGLARQTDDEMTGYVATRWYRAPEIMLNWMHYNQNVDIWSVGCIMGELLKGKVLFPGTDYIDQLKRIMEVVGTPTPEMLKKICSEHAQKY-IQSLPFMPPQDLEKIFR--GANPLAVDLLKRMLVLDCDERISAGEALSHPYFSQYHDPEDEPEAPPYDQTLESK-DRTLEEWKELVFEEVKSF 347          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk11 (mitogen-activated protein kinase 11 [Source:NCBI gene;Acc:103035641])

HSP 1 Score: 340.502 bits (872), Expect = 2.086e-114
Identity = 165/345 (47.83%), Postives = 235/345 (68.12%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTF 1161
            F   +++ + W V  RY+NL  +G G+ GSVCSA+D   +  VA+KKL+ PFQS   ++R+YRE+++L HM HENVI L+D+FS +A+   FN+VY VT L+  DL+ I+  + + +E++ F IYQ+LRGLKYIHS G+IHRDL P N+AVNED ELRILDFGL+R+ DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIM E+L  ++LF GND  DQL++IM++  T       +I +E  + Y ++++  +P  D  + FR    +  A+DLL KMLVLD ++RISA++AL HPY   YHD  DE   AP  D    + D  +E WKD +++ +N+F
Sbjct:    7 FYRQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDVRLRQKVAVKKLSRPFQSLIHSRRSYRELRLLKHMKHENVIGLLDVFSPAASLEEFNEVYLVTNLMGADLNNIVKFQRLSDEHVQFLIYQLLRGLKYIHSAGLIHRDLKPSNVAVNEDCELRILDFGLARQTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMGELLKGKVLFPGNDYIDQLKRIMEVVGTPTPDLLKKISSEHAQKY-IQSLPYMPQQDLGKIFR--GANPMAVDLLKKMLVLDCDRRISASEALCHPYFSQYHDPEDEP-EAPLYDQTPESKDCTLEEWKDLVFEEVNSF 347          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk14b (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:103028137])

HSP 1 Score: 331.643 bits (849), Expect = 6.646e-111
Identity = 165/349 (47.28%), Postives = 233/349 (66.76%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKI 1173
            F   +++ + W V  RY+NL  +G G+ GSVCSA+D +  + +A+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + N   FNDVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E +NY + ++  +P  +F   F     +  A+DLL KMLVLD ++RI+A++AL HPY   YHD  DE    PY  + ES  ++DIE WK   ++ + +F P +
Sbjct:    9 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCSAYDIQSGLKIAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATNLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASLISRMPSHEARNY-INSLPHMPKRNFADVF--IGANPLAVDLLEKMLVLDTDKRITASEALAHPYFAQYHDPDDEPEADPYDQSFESR-ELDIEEWKRLTYEEVLSFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk14a (mitogen-activated protein kinase 14A-like [Source:NCBI gene;Acc:103046996])

HSP 1 Score: 330.487 bits (846), Expect = 1.904e-110
Identity = 166/350 (47.43%), Postives = 231/350 (66.00%), Query Frame = 1
Query:  124 KFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKI 1173
            KF   +++ + W V  RY+NL  +G G+ GSVCSA D +  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQI+RGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E +NY + ++  +P  +F   F     + +A+DLL KMLVLD ++RI+A +AL HPY   YHD  DE    PY  + ES  ++DIE WK   ++ +  F P I
Sbjct:    8 KFYRQEVNKTIWEVPLRYQNLSPVGSGAYGSVCSAVDEKMGLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDAFTPATSLEGFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQIIRGLKYIHSADIIHRDLKPGNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRALFPGTDHINQLQQIMRLTGTPPSSLISRMPSHEARNY-IHSLPNMPKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEADPYDQSFESR-ELDIEEWKRLTYEEVINFEPPI 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk14a (mitogen-activated protein kinase 14A-like [Source:NCBI gene;Acc:103046996])

HSP 1 Score: 328.176 bits (840), Expect = 1.372e-109
Identity = 166/350 (47.43%), Postives = 229/350 (65.43%), Query Frame = 1
Query:  124 KFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKI 1173
            KF   +++ + W V  RY+NL  +G G+ GSVCSA D +  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D F+ + +   FNDVY VT L+  DL+ I+  + + ++++ F IYQI+RGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ IM +  T       +I ++  +NY + ++  +P  +F   F     + +A+DLL KMLVLD ++RI+A +AL HPY   YHD  DE    PY  + ES  ++DIE WK   ++ +  F P I
Sbjct:    8 KFYRQEVNKTIWEVPLRYQNLSPVGSGAYGSVCSAVDEKMGLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDAFTPATSLEGFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQIIRGLKYIHSADIIHRDLKPGNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRALFPGTDHIDQLKLIMMLVGTPGPELLKKISSDSARNY-IHSLPNMPKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEADPYDQSFESR-ELDIEEWKRLTYEEVINFEPPI 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk12b (mitogen-activated protein kinase 12-like [Source:NCBI gene;Acc:103035956])

HSP 1 Score: 309.301 bits (791), Expect = 4.477e-102
Identity = 156/359 (43.45%), Postives = 236/359 (65.74%), Query Frame = 1
Query:  109 IKVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQ-FFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 1182
            +++   F   +++ + W V  RY +L  +G G+ G+V SA D +  + VAIKKL  PFQS+  AKR YRE+++L HM HENVI L+D+F+S  +   F D Y V P +  DL K++  E + E+ + F +YQ+LRGLKYIHS G+IHRDL P N+AVN++ EL+ILDFGL+R+ D  MTGYVV+R+YRAPE+I    +Y+  +D+WS GCIMAEML+ R LF+GND  DQLR+IM+I  T  + F  ++ +++ KNY + ++  +P  D H  FF+  +E + A++   +ML+LDP+ R+SA  AL  P    + +  +E+   PY  +++ N+D+ +E WK   +  + +F P +  L
Sbjct:    3 LRIRAGFYRQEVNKTVWDVPERYRDLIQVGTGAYGTVSSAIDRKAGVRVAIKKLHRPFQSRLFAKRAYRELRLLKHMKHENVIGLLDVFTSEISLDRFQDFYLVMPFMGTDLGKLMKMERLCEDRVQFLVYQMLRGLKYIHSAGIIHRDLKPGNLAVNQNCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMHYSQTVDIWSVGCIMAEMLLGRPLFKGNDHLDQLREIMKITGTPGQDFILKLQSQDAKNY-IRSLPKVPKKDLHSIFFKASSEVVSAME---RMLLLDPDSRVSAAVALELPMFSEFREPEEETEALPYDHSMD-NADLSLEQWKRHTFTEILSFQPPLIEL 356          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 312.383 bits (799), Expect = 5.985e-104
Identity = 158/355 (44.51%), Postives = 232/355 (65.35%), Query Frame = 1
Query:  115 VMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQ----FDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            V   F   +++ + W V  RY NL  +G G+ GSVCS+ D++  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ +++   F+D+Y VT L+  DL+ I+  + + ++++ F +YQILRGLKYIHS G+IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D+     +QL +I+Q+  T  +    ++ ++E +NY ++++      DF   F     +   +DLL +MLVLD +QRI+A +AL+H Y   YHD  DE    PY  + E N +  +E W+   ++ + +FVP
Sbjct:    5 VKEGFCRQELNKTVWEVPRRYVNLTSVGSGAYGSVCSSLDTKTGMKVAVKKLSRPFQSVIHAKRTYRELRLLKHMKHENVIGLMDVFTPNSSLEEFDDLYLVTDLMGADLNNIVKCQKLTDDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDRILSDINQLVKILQLTGTPPQYLIDRMQSKEARNY-IQSLPYTQKRDFKDVF--LGANPLVVDLLERMLVLDTDQRITAAEALVHQYFAQYHDPDDEPEAEPYDQSFE-NQEFPVEEWRRLTYEEVISFVP 355          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk12a (mitogen-activated protein kinase 12a [Source:NCBI gene;Acc:30681])

HSP 1 Score: 292.352 bits (747), Expect = 4.219e-96
Identity = 152/340 (44.71%), Postives = 210/340 (61.76%), Query Frame = 1
Query:  121 RKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTE-DLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIET--WK 1131
            + F   +I+   W V  RY  L  +G G+ G+VCS+ D      VA+KKL  PFQS+  AKR YRE+++L HM HENVI L+D+F+ +     F D Y V P +  DLSKI+      ++ + + IYQIL+GLKYIHS+G+IHRDL P N+AVNED EL+ILDFGL+R  D  MTGYVV+R+YRAPE+I    +YT  +D+WS GCIMAEM+  + LF GND  DQL  I+++  T  +    ++   E   Y    ++ LP ++  +    +   +  AIDLL KML LDP QR +A++AL HP+     +  +E+   PY  T E    V++ET  WK
Sbjct:    9 KGFYRIEINKMVWEVPKRYSQLFAVGSGAYGTVCSSMDLVTGSKVAVKKLYRPFQSRVFAKRAYRELRLLKHMKHENVIGLVDVFTPNDTLDQFQDFYLVMPFMGTDLSKIMKHGKQSDDKVQYLIYQILKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHADQEMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGKPLFPGNDHMDQLMLILKLTGTPPQYLVDRMDENEAAKY----IKTLPKMEKRRISTVFPNANPIAIDLLEKMLALDPEQRPTASEALQHPFFSETREPLEETEAEPYDQTFEG---VELETSEWK 341          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000729.1 (pep scaffold:Pmarinus_7.0:GL477416:20288:37329:-1 gene:ENSPMAG00000000656.1 transcript:ENSPMAT00000000729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 258.84 bits (660), Expect = 2.210e-82
Identity = 143/360 (39.72%), Postives = 213/360 (59.17%), Query Frame = 1
Query:  112 KVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDD--FMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDL-------------KAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYL-DTLESNSDVDIETWKDGIW 1143
            K+  +F + ++  S + V+ RY+NLK IG G+QG VC+A+D      VAIKKL+ PFQ+Q  AKR YRE+ ++  ++H+N+ICL ++F+   +   F DVY V  L+  +L ++I  E +  E + + IYQ+L G+K++HS G+IHRDL P NI V  D  L+ILDFGL+R   +   MT YVV+RYYRAPE+I     YT  +D+WS GC++ EM+ HRILF G D  DQ  +I++   T    F  ++     +NY    VE  P    + F + + + L             +A DLLSKMLV+DP +RI+   AL HPY+  ++D ++     P + D      +  I+ WK+ I+
Sbjct:    5 KLETQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDIMQNRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIICLFNVFTPQKSLEEFQDVYLVMELMDANLCQVIQME-LDHERMSYLIYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGNSFMMTPYVVTRYYRAPEVIL-GMGYTENVDIWSVGCVLGEMIRHRILFPGKDYIDQWNKIIEQLGTPMAEFMKKL-QPTVRNY----VENRPKYAGYSFEKLFPDVLFPADSENNRLKASQARDLLSKMLVIDPAKRINVDQALAHPYINIWYDPSEVEAPPPKIYDKQLDEREHSIDEWKELIY 357          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 254.603 bits (649), Expect = 2.102e-81
Identity = 146/349 (41.83%), Postives = 210/349 (60.17%), Query Frame = 1
Query:  163 VVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKD------DFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPP---IDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVG-APYLDTLESNSDVDIETWKDGIWDCMNTFVPKIEN 1179
            V  RY +L  IG G+ G VC+AFD+   + VAIKK+ SPF+ Q   +RT RE+KIL    HEN+I + D+  +S       DVY V  L+  DL K++  + +  ++IC+F+YQILRGLKYIHS  V+HRDL P N+ +N   +L+I DFGL+R  D       F+T YV +R+YRAPEI+  +  YT  ID+WS GCI+AEML +R LF G    DQL  I+ I  +  +     I   + +NY    ++ LPP   + +++ F +   D KA+DLL KML  +P++RI+  +AL HPYLE Y+D +DE V   P+   +E + D+  E  K+ I++    F P  + 
Sbjct:   32 VGPRYTSLSYIGEGAYGMVCAAFDNVKLVRVAIKKI-SPFEHQTYCQRTLREIKILLRFKHENIIGINDILRASTID-QMKDVYIVQDLMETDLYKLLKGQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNHILGILGSPSQEDLDCIINMKARNY----LQSLPPKAKVPWNRLFPK--ADSKALDLLDKMLTFNPHRRITVEEALAHPYLEQYYDPSDEPVAEEPFRFDMELD-DLPKERLKEMIFEETARFQPGFQQ 371          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004133.1 (pep scaffold:Pmarinus_7.0:GL479498:22366:34653:-1 gene:ENSPMAG00000003756.1 transcript:ENSPMAT00000004133.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.779 bits (556), Expect = 1.247e-67
Identity = 118/287 (41.11%), Postives = 175/287 (60.98%), Query Frame = 1
Query:  223 SAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDD--FMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFF----------RQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFY 1047
            +A+D+     VAIKKL+ PFQ+Q  AKR +RE+ ++  ++H+N+I L+++FS   ++ +F DVY V  L+  +L ++I  E +  E I + +YQ+L G+K++HS G+IHRDL P NI V  D  L+ILDFGL+R       MT YVV+RYYRAPE+I     YT  +D+WS GCIM EM+ H+ILF G D  DQ  ++++   T    F  ++     +NY +ET    P   F + F              +  +A DLLS+MLV+DP +RI+  +AL HPY+  +
Sbjct:    1 AAYDTIIDRNVAIKKLSRPFQNQTHAKRAFRELVLMKCVNHKNIIKLLNVFSPQKSQEDFQDVYLVMDLMDANLCQVIRME-LDHERISYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCSLKILDFGLARTAATSFMMTPYVVTRYYRAPEVIL-GMGYTENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPVSEFMKRL-QPTVRNY-VETRPRYPGYSFEKLFPDALFPADSEHSKLKASQARDLLSRMLVIDPLKRITVDEALQHPYIHVW 283          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 285.034 bits (728), Expect = 1.455e-92
Identity = 151/339 (44.54%), Postives = 210/339 (61.95%), Query Frame = 1
Query:  124 KFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLP---PIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWK 1131
            +F   +I  + + + +RY +L  +G G+ G VCSA D+     VAIKK+  PF +   AKRTYRE+K+L H+ HEN+ICL D+F S        D+YFVT L   DL +++    ++++ + +F+YQILRGLKY+HS GVIHRDL P NI +NE+ +L+I DFGL+R +D  MTGYV +RYYRAPEI+     Y  ++D+WSAGCI AEM+  + LF G D   Q   I  +  +  +     IC+E      L+ V  LP   PI F + F+    D  A+DLL KMLV DP +RI+A DAL HPY   YHD TDE V     D   +++D+ ++TW+
Sbjct:    6 EFIRTQIFGTVFEITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSP-----LEDIYFVTELQGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENT----LKFVTSLPHRDPIPFSERFKTVEPD--AVDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDEPVADAKFDWHFNDADLPVDTWR 333          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: FUS3 (Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its; inhibits recruitment of Ste5p, Cdc42p-mediated asymmetry and mating morphogenesis [Source:SGD;Acc:S000000112])

HSP 1 Score: 227.254 bits (578), Expect = 2.849e-71
Identity = 119/321 (37.07%), Postives = 184/321 (57.32%), Query Frame = 1
Query:  157 WHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDF-------------MTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAP 1080
            +++ S ++   ++G G+ G VCSA        VAIKK+  PF     A RT RE+KIL H  HEN+I + ++    +   NFN+VY +  L+  DL ++I+ + + +++I +FIYQ LR +K +H + VIHRDL P N+ +N + +L++ DFGL+R  D+              MT YV +R+YRAPE++  ++ Y+  +D+WS GCI+AE+ + R +F G D   QL  I  I  T H     +         +++++ + P     + F +     K IDLL +MLV DP +RI+A +AL HPYL+ YHD  DE  G P
Sbjct:    7 YNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKI-EPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPDSFE-NFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNP--KGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEP 323          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 225.328 bits (573), Expect = 4.582e-69
Identity = 130/340 (38.24%), Postives = 199/340 (58.53%), Query Frame = 1
Query:  133 TYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFK--IYVAIKKLASPFQSQDSAKRTYREMKILHHM-DHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKII-AKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSR-------KKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLD-TLESNSDVD 1116
            T+K+   D+ V  R++ +K IGHG+ G VCSA  +E      VAIKK+ + F      KR+ RE+K+L H   H+N+ CL D+        + N +Y    L+  D+ +II + + + + +   F YQIL GLKYIHS  V+HRDL P N+ VN D +L+I DFGL+R       +   F+T YV +R+YRAPEI+     YT  ID+WSAGCI+AE L  + +F+G D  +QL QI+Q+  T  +    +I ++  ++Y +  +  +P + F   +     + +A+DLL +ML  DP +RI+  +AL HPYL  +HD  DE V +   + + ES +D++
Sbjct:    9 TFKVFNQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDY-IHQLGFIPKVPFVNLYP--NANSQALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDME 345          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 220.705 bits (561), Expect = 1.710e-68
Identity = 130/340 (38.24%), Postives = 196/340 (57.65%), Query Frame = 1
Query:  163 VVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHM-DHENVICLID-LFSSSANRINFNDVYFVTPLLSFDLSKIIAKE-----FMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSR----KKDD------FMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWK 1131
            + S+Y+ + +IG G+ G+VCSA      I VAIKK+  PF  +    RT RE+K+L +  +HEN+I ++D +   S +++N   VY V  L+  DL K+I  +      + ++++ +F YQILR LK IHS  VIHRD+ P N+ +N + +L++ DFGL+R      D       FMT YV +R+YRAPEI+     YT  +D+WS GCI+AEM+  + LF G D   QL  I+++  T     + QI ++  K Y +  + + PP+ +   + +   +   IDLL KML  +P++RISA +AL HPYL  YHD +DE    P         ++D E WK
Sbjct:    9 IPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKI-QPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLN--AVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEY-IANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYPPL--------NLDDEFWK 336          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: KDX1 (Protein kinase; implicated in Slt2p mitogen-activated (MAP) kinase signaling pathway; interacts with numerous components in the mating pheromone and CWI MAPK pathways; associates with Rlm1p; KDX1 has a paralog, SLT2, that arose from the whole genome duplication [Source:SGD;Acc:S000001644])

HSP 1 Score: 201.445 bits (511), Expect = 1.819e-60
Identity = 117/302 (38.74%), Postives = 173/302 (57.28%), Query Frame = 1
Query:  193 IGHGSQGSVCSAF--DSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHM-DHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKII-AKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLS-------RKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDE 1065
            IG GS   +CS+   +S  + +VAI+K+ + F ++ S KRT RE+K+L H+  H N++ L D           N VY    L+  DLS+II +++ +++ +   FIYQIL  LKYIHS  V+H DL PKN+ VN D +L+I +FGLS       +  D F+ GY+ S +Y+APEI+      T  +D+WS GCI+AE+L  + +F G D  D L  I+QI  T  E    +I +++  NY  +    +P   F         + +A++LL KML  DP +RI+  DAL HPYL  +HD  +E
Sbjct:   29 IGRGSHSLICSSTYTESNEETHVAIRKIPNAFGNKLSCKRTLRELKLLRHLRGHPNIVWLFDTDIVFYPNGALNGVYLYEELMECDLSQIIRSEQRLEDAHFQSFIYQILCALKYIHSANVLHCDLKPKNLLVNSDCQLKICNFGLSCSYSENHKVNDGFIKGYITSIWYKAPEILLNYQECTKAVDIWSTGCILAELLGRKPMFEGKDYVDHLNHILQILGTPPEETLQEIASQKVYNYIFQFGN-IPGRSFESILP--GANPEALELLKKMLEFDPKKRITVEDALEHPYLSMWHDIDEE 327          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO46881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM4])

HSP 1 Score: 297.745 bits (761), Expect = 7.947e-98
Identity = 156/332 (46.99%), Postives = 213/332 (64.16%), Query Frame = 1
Query:  157 WHVVSRYENLKIIGHGSQGSVCSAFDSEFKIY-------VAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWK 1131
            + V  +Y+ L  IG G+ G VCS+  +E           VAIKKL+ PFQS   AKRTYRE+K+L HM HENVI L+D+F++++   +F DVY VT L+  DL+ I+  + + +E++ F +YQILRGLKYIHS GVIHRDL P NIAVNED EL+ILDFGL+R  D  MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  + LF GND  DQL +IMQ+     + F  +I +E  +NY  +  +      F ++F     +  A+DLL KML LD + RI+A +AL HPYL  Y D  DE   + + D+ +   ++ IE W+
Sbjct:   18 YEVPRKYQELSPIGTGAYGQVCSSTITEPDPTNPDGPNTVAIKKLSRPFQSTMHAKRTYRELKLLRHMRHENVISLLDVFTTASAFEHFQDVYMVTELMGSDLNGILRFQKLSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELKILDFGLARMTDAEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTSKTLFPGNDHIDQLTKIMQLVGKPSDDFLQKIDSESARNYIAQMPDYR-KTPFDEYF--VGANPLAVDLLEKMLNLDTDHRITAVEALSHPYLASYADPNDEPTCSTFDDSFDEK-ELSIEGWR 345          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO40573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6R5])

HSP 1 Score: 267.314 bits (682), Expect = 6.840e-86
Identity = 138/317 (43.53%), Postives = 201/317 (63.41%), Query Frame = 1
Query:  163 VVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKII-AKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSR-------KKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLD 1089
            V +RY+ ++ IG+G+ G VCSA D+     VA+KK++  F    +A+RT+RE+KIL H  H+N+IC+ D+     N   F+DVY V  L+  DL +II   + +  E++ +F+YQILRGLKYIHS  V+HRDL P N+ VNE+ EL+I DFG++R       ++  FMT YV +R+YRAPE++   + Y+  IDMWS GCI+AEM+  R LF G +  +QL+ I+ +  T  + F  ++ AE  K Y L  +    P+ F +FF +   +  AI+LLS+ML LDP +RI+  +AL HP+L+ YH E DE      LD
Sbjct:   19 VDARYKLIETIGNGAYGVVCSAMDTRTGAKVAVKKISRAFDVLTTARRTHRELKILRHFKHDNIICIRDILKPPVNLDEFDDVYVVLDLMESDLHRIIHTDQPLTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNLLVNENAELKIGDFGMARGLCSSPLEQKRFMTEYVATRWYRAPELMLSLNEYSEAIDMWSVGCILAEMIGRRPLFPGANYLNQLQMILSVTGTPSQNFIERMGAERVKTY-LNQLPHKDPVPFEKFFPKAHPE--AINLLSQMLQLDPKERITVENALQHPFLKEYHSEEDEPTCYSPLD 332          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO37435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFQ0])

HSP 1 Score: 248.825 bits (634), Expect = 3.550e-79
Identity = 129/311 (41.48%), Postives = 187/311 (60.13%), Query Frame = 1
Query:  163 VVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKD------DFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEK-NYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVG 1074
            V  RY NL  IG G+ G V +  D+     +AIKK+ SPF+ Q   +RT RE+KIL    HEN+I ++D+  +     +  D+Y V PL+  D+ K++  + +  ++IC+F+YQILRGLKYIHS  V+HRDL P N+ +N   +L+I DFGL+R  D       F+T YV +R+YRAPEI+  +  Y+  ID+WS GCI+AEML +R LF G    DQL  I+ +  +        +C + EK   +L+++   P   F + F     D KA+DL+  +L  +PN+RI+  +AL HPYLE Y+D  DE V 
Sbjct:   17 VAPRYTNLNYIGEGAYGMVVAGVDNTTGERIAIKKI-SPFEHQTYCQRTLREIKILSRFKHENIIGILDIIRAPRAE-DMKDIYIVQPLMETDMYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLANRPLFPGKHYLDQLNLILNVLGSPIAD--DLLCIKNEKARSYLQSLPYKPKTPFIKLFSN--ADAKALDLIENLLAFNPNKRITVEEALAHPYLEQYYDPADEPVA 321          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO45525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSV5])

HSP 1 Score: 204.142 bits (518), Expect = 5.712e-62
Identity = 100/245 (40.82%), Postives = 153/245 (62.45%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDD--FMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQI 855
            F T ++  + + V+ RY+NL+ IG G+QG VC+A D+     VAIKKL+ PFQ+   AKR +RE+ ++  ++H+N+I L+++F+       FND+Y V  L+   L ++I  + +  E + + +YQ+L G+K++H   +IHRDL P NI V  D  L+ILDFGL+R       MT YVV+RYYRAPE+I     Y + +D+WS GCI+AEM+   ++F G D  DQ  ++ +   T  E F  Q+
Sbjct:    2 FYTAQVGDTIFIVLKRYQNLQPIGSGAQGMVCAAIDTVTGEKVAIKKLSRPFQNVTHAKRAFRELVLMRMVNHKNIIGLLNVFTPDRTLEQFNDLYLVMELMDASLCQVIHMD-LDHERLSYLLYQMLCGVKHLHDADIIHRDLKPSNIVVKSDCSLKILDFGLARTAGSAFMMTPYVVTRYYRAPEVIL-GMGYCDNVDVWSIGCILAEMIRGHVMFPGTDHIDQWNKVTEQLGTPSESFLNQL 244          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO30527 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0K0])

HSP 1 Score: 199.519 bits (506), Expect = 2.902e-59
Identity = 112/292 (38.36%), Postives = 174/292 (59.59%), Query Frame = 1
Query:  187 KIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKII-AKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDD----FMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSH-EGFWGQICAEEEKNYFLETVELLPPI-DFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLE 1041
            + IG+G+ G V S  D      VA+KK+   FQ+  S++R YRE+++L  + H+NVI  ID+       + F+++Y V+ L+  DL KII + + +  +++  F+YQILRGLKY+ S  ++HRD+ P N+ VN +  L+I DFGL+R ++      MT  VV++YYR+PE++  +++YT  +D+WS GCI AE+L  +ILF+      QL QI+ +  T   E       +E    Y L+     P +   +    Q T +  A+ LL +MLV +PN+RIS  DAL HPYL+
Sbjct:   43 RPIGYGAFGVVWSVTDPRNGKRVALKKMPKVFQNITSSRRAYRELRMLCTLKHDNVISAIDIVHPGHIDL-FHEIYVVSELMQSDLHKIIVSPQPLTADHVKVFLYQILRGLKYLDSAKILHRDIKPGNLLVNSNCLLKICDFGLARLEEPDESVIMTQEVVTQYYRSPELLTGSTHYTQAVDIWSVGCIFAELLSRKILFQAQSPVQQLNQIIDLLGTPCLEDLSKAGSSEGATKYILQRPHKPPALASLYNLSNQATHE--AVHLLCRMLVFNPNKRISCIDALSHPYLD 331          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk14b (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:101162042])

HSP 1 Score: 329.717 bits (844), Expect = 4.089e-110
Identity = 163/347 (46.97%), Postives = 234/347 (67.44%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  RY+NL  +G G+ GSVCS++D +  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   F+DVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS G++HRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E +NY + ++  +P  +F   F     +  A+DLL KMLVLD ++RI+A++AL HPY   YHD  DE    PY  + ES  +++IE W+  I+D + +F P
Sbjct:    9 FYLQELNKTVWEVPERYQNLSPVGSGAYGSVCSSYDVKTCLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLDEFSDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIVHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASLISRMPSHEARNY-INSLPHMPKRNFADVF--IGANPLAVDLLEKMLVLDTDKRITASEALAHPYFAQYHDPDDEPEAEPYDQSFESR-ELEIEEWRSLIYDEVLSFEP 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk14b (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:101162042])

HSP 1 Score: 328.946 bits (842), Expect = 8.931e-110
Identity = 164/347 (47.26%), Postives = 232/347 (66.86%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            F   +++ + W V  RY+NL  +G G+ GSVCS++D +  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   F+DVY VT L+  DL+ I+  + + ++++ F IYQILRGLKYIHS G++HRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ IM +  T       +I +E  +NY + ++  +P  +F   F     +  A+DLL KMLVLD ++RI+A++AL HPY   YHD  DE    PY  + ES  +++IE W+  I+D + +F P
Sbjct:    9 FYLQELNKTVWEVPERYQNLSPVGSGAYGSVCSSYDVKTCLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLDEFSDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIVHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMMLVGTPGPELLMKISSEPARNY-INSLPHMPKRNFADVF--IGANPLAVDLLEKMLVLDTDKRITASEALAHPYFAQYHDPDDEPEAEPYDQSFESR-ELEIEEWRSLIYDEVLSFEP 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk14a (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:101160731])

HSP 1 Score: 323.168 bits (827), Expect = 1.312e-107
Identity = 163/352 (46.31%), Postives = 230/352 (65.34%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYT-EDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIEN 1179
            F   +++ + W V  RY+NL  +G G+ GSVCSA+D++  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   F DVYFV  L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  +QL+QIM++  T       ++ + E + Y    +  LP +    F   +   +  A+DLL KMLVLD ++RI+A +AL HPY   YHD  DE    PY  + ES  D++I+ WK   ++ + +F P + N
Sbjct:    9 FYRQEVNKTIWEVPDRYQNLSPVGSGAYGSVCSAYDTKTGLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLKEFTDVYFVNHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAALISRMPSHEARTY----ISSLPHMAKRNFADVFIGANPLAVDLLEKMLVLDTDRRITAAEALEHPYFAQYHDPDDEPEAEPYDQSFESR-DLNIKEWKRLTYEELCSFEPPVFN 355          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk14a (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:101160731])

HSP 1 Score: 322.013 bits (824), Expect = 4.326e-107
Identity = 164/352 (46.59%), Postives = 228/352 (64.77%), Query Frame = 1
Query:  127 FKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYT-EDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIEN 1179
            F   +++ + W V  RY+NL  +G G+ GSVCSA+D++  + VA+KKL+ PFQS   AKRTYRE+++L HM HENVI L+D+F+ + +   F DVYFV  L+  DL+ I+  + + ++++ F IYQILRGLKYIHS  +IHRDL P N+AVNED EL+ILDFGL+R  DD MTGYV +R+YRAPEI+    +Y   +D+WS GCIMAE+L  R LF G D  DQL+ IM +  T       +I +E  + Y    +  LP +    F   +   +  A+DLL KMLVLD ++RI+A +AL HPY   YHD  DE    PY  + ES  D++I+ WK   ++ + +F P + N
Sbjct:    9 FYRQEVNKTIWEVPDRYQNLSPVGSGAYGSVCSAYDTKTGLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLKEFTDVYFVNHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMMLVGTPGPELLMKISSESARTY----ISSLPHMAKRNFADVFIGANPLAVDLLEKMLVLDTDRRITAAEALEHPYFAQYHDPDDEPEAEPYDQSFESR-DLNIKEWKRLTYEELCSFEPPVFN 355          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk12a (mitogen-activated protein kinase 12 [Source:NCBI gene;Acc:101159668])

HSP 1 Score: 318.931 bits (816), Expect = 5.411e-106
Identity = 154/353 (43.63%), Postives = 228/353 (64.59%), Query Frame = 1
Query:  109 IKVMRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP 1167
            ++V   +   +++ + W V  RY +LK +G G+ G+VCSA DS     VAIKKL  PFQS+  AKR YRE+++L HM HENVI L+D+F++  +   F D Y V P +  DL K++    + E+ I + +YQ+L+GLKYIHS G+IHRDL P N+ +N+D EL+ILDFGL+R+ D  MTGYVV+R+YRAPE+I    +YT  +D+WS GCIMAEML  + LF+GND  DQL +IM+I  T    F  ++ +EE K Y L+++      D  + F   + D+ A+ ++ KML+LDP +R++A +AL  PY   + D  +E    PY  +L+ N+++ ++ WK   +  + TF P
Sbjct:    3 LRVRPGYSRQEVNKTSWEVPDRYRDLKQVGSGAYGTVCSATDSRTGAKVAIKKLYRPFQSEIFAKRAYRELRLLKHMKHENVIGLLDVFTADLSLDRFLDFYLVMPFMGTDLGKLMKMHKLSEDKIQYLVYQMLKGLKYIHSAGIIHRDLKPGNLGINQDCELKILDFGLARQTDSEMTGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMAEMLQGKPLFKGNDHLDQLTEIMKITGTPSPEFLSKLVSEEAKKY-LKSLPKQEKKDLQKVFP--SSDVHAVSMMEKMLLLDPEKRVTAAEALTLPYFTEFRDSEEEKEAQPYDHSLD-NAELSVDQWKRHTFTEILTFKP 351          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000075539.1 (SMESG000075539.1)

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 354/355 (99.72%), Postives = 355/355 (100.00%), Query Frame = 1
Query:  118 MRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 1182
            MRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSA+RINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL
Sbjct:    1 MRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSADRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 355          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 424.476 bits (1090), Expect = 2.026e-147
Identity = 193/353 (54.67%), Postives = 262/353 (74.22%), Query Frame = 1
Query:  124 KFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 1182
            +F+ + I +SDW V +RYENL  IGHG+ GSVC+AFD + +  VAIKKLA PF S + AKRTYRE+KI+HHMDHEN++CLID ++  + R +F+DVY +TPL+  DL+ II  + +  E++ F +YQILRGLKY+HS+ +IHRDL P NIAVNED EL+ILDFGL+R+ D+ MTGYV +R+YRAPEI+    +YTN++D+WS GCIMAE+   + LF GND  DQL++IM++A T  + F  +I +E+ + +  E ++  P  DF+ FF QYT+D  AIDLL +MLVLDP++RISA DAL HPYL  YHDE DE     ++D +E  +DVD+ETWKD +WD +  F P+I +L
Sbjct:    4 EFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSL 356          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 423.705 bits (1088), Expect = 8.199e-147
Identity = 193/353 (54.67%), Postives = 262/353 (74.22%), Query Frame = 1
Query:  124 KFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 1182
            +F+ + I +SDW V +RYENL  IGHG+ GSVC+AFD + +  VAIKKLA PF S + AKRTYRE+KI+HHMDHEN++CLID ++  + R +F+DVY +TPL+  DL+ II  + +  E++ F +YQILRGLKY+HS+ +IHRDL P NIAVNED EL+ILDFGL+R+ D+ MTGYV +R+YRAPEI+    +YTN++D+WS GCIMAE+   + LF GND  DQL++IM++A T  + F  +I +E+ + +  E ++  P  DF+ FF QYT+D  AIDLL +MLVLDP++RISA DAL HPYL  YHDE DE     ++D +E  +DVD+ETWKD +WD +  F P+I +L
Sbjct:   28 EFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSL 380          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000012868.1 (SMESG000012868.1)

HSP 1 Score: 242.276 bits (617), Expect = 3.019e-76
Identity = 131/342 (38.30%), Postives = 206/342 (60.23%), Query Frame = 1
Query:  157 WHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDD------FMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFV 1164
            ++V SRY NL+ IG G+ G V SA D+     VAIK++ SPF+ Q   +RTYRE+KIL H  HENVI + +L + ++   +  D+Y V  L+  D+ K+I  + +  E+IC+F+YQILRG+KYIHS  V+HRDL P N+ VN + +L+I DFGL+R  D        +T YV +R+YRAPE++  +  Y+  +DMWS GCI+AEML  + LF G     QL+ I  +  +        I  E+ +N F+E +  +P   + + F     +   +D+L ++L  +P++R++A  AL HPYL+ Y++ TDE       ++     ++ + T K  IW+ ++++V
Sbjct:   15 FYVGSRYTNLRFIGEGAYGIVVSATDNVTHEDVAIKRI-SPFEHQTFCQRTYREIKILLHFKHENVIDIKNLLTPASKIEDIKDIYIVQSLMDTDMYKLIKDQKLSNEHICYFLYQILRGVKYIHSANVLHRDLKPSNLLVNSNCDLKICDFGLARVNDPVQDHNGMLTEYVATRWYRAPEVMLNSKGYSKAMDMWSIGCILAEMLGCKPLFPGKHYVQQLKLIFDVLGSPDYEDKSWIVNEKARN-FVEKLIDIPKRPWEELFP--NSEPFCLDILDQLLAFNPSKRLTADKALQHPYLQQYYEPTDEPESDSPFNSEHELDNLSLNTLKQMIWEQVSSYV 352          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000001435.1 (SMESG000001435.1)

HSP 1 Score: 240.35 bits (612), Expect = 7.996e-76
Identity = 135/322 (41.93%), Postives = 193/322 (59.94%), Query Frame = 1
Query:  157 WHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRIN-FNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKD------DFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGA-PYLDTLE 1098
            + V  RY +L  IG G+ G V SA+D+  K  VAIKK+ SPF+ Q   +RT RE+KIL    HEN+I + D+ +  AN IN   DVY V  L+  DL K++  + +  ++ C+F+YQILRGLKYIHS  V+HRDL P N+ +N   +L+I DFGL+R  D        +T YV +R+YRAPEI+  +  YT  ID+WS GCI+AEML ++ LF G    DQL  I+ +  + ++     I   + + Y L+ +   P + +   +     D +A+DL+ K+L  +P  RI   DAL HPYL+ Y+D  DE V A P+ + LE
Sbjct:   13 FEVKPRYIDLNYIGEGAYGMVASAYDNIKKEKVAIKKI-SPFEYQTYCQRTLREIKILTRFKHENIIDIRDIIT--ANSINEMKDVYIVQCLMETDLFKLLKTQQLSNDHTCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGLLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLNNKPLFPGKHYIDQLNLILGVLGSPNQEDLDSIVNLKARGY-LQQLPYKPKVSWKSLYP--NADDQALDLIEKLLTFNPVNRIGVEDALAHPYLKQYYDPADEPVAAKPFTNDLE 328          
The following BLAST results are available for this feature:
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAPK142.941e-11147.84mitogen-activated protein kinase 14 [Source:HGNC S... [more]
MAPK146.711e-11147.84mitogen-activated protein kinase 14 [Source:HGNC S... [more]
MAPK113.258e-10845.83mitogen-activated protein kinase 11 [Source:HGNC S... [more]
MAPK113.258e-10845.83mitogen-activated protein kinase 11 [Source:HGNC S... [more]
MAPK123.183e-10344.83mitogen-activated protein kinase 12 [Source:HGNC S... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pmk-14.447e-10247.38Mitogen-activated protein kinase pmk-1 [Source:Un... [more]
pmk-22.515e-8743.48Mitogen-activated protein kinase pmk-2 [Source:Un... [more]
pmk-24.030e-8743.59Mitogen-activated protein kinase pmk-2 [Source:Un... [more]
jnk-11.862e-7738.40Stress-activated protein kinase jnk-1 [Source:Uni... [more]
jnk-11.862e-7738.40Stress-activated protein kinase jnk-1 [Source:Uni... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p38b9.504e-11047.32gene:FBgn0024846 transcript:FBtr0080534[more]
p38a1.202e-10345.10gene:FBgn0015765 transcript:FBtr0084580[more]
p38a1.202e-10345.10gene:FBgn0015765 transcript:FBtr0300572[more]
p38a1.202e-10345.10gene:FBgn0015765 transcript:FBtr0084581[more]
p38c5.816e-8742.82gene:FBgn0267339 transcript:FBtr0084582[more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk115.865e-11347.83mitogen-activated protein kinase 11 [Source:ZFIN;A... [more]
mapk14a2.707e-11147.56mitogen-activated protein kinase 14a [Source:NCBI ... [more]
mapk14a2.707e-11147.56mitogen-activated protein kinase 14a [Source:NCBI ... [more]
mapk14b5.364e-11147.18mitogen-activated protein kinase 14b [Source:NCBI ... [more]
mapk14a8.741e-11146.99mitogen-activated protein kinase 14a [Source:NCBI ... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde6a1.039e-11449.26phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-9... [more]
pde6a1.320e-11449.26phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-9... [more]
mapk116.800e-11347.89mitogen-activated protein kinase 11 [Source:NCBI g... [more]
mapk121.825e-11148.55mitogen-activated protein kinase 12 [Source:NCBI g... [more]
mapk115.655e-10848.38mitogen-activated protein kinase 11 [Source:NCBI g... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapk141.623e-11047.84mitogen-activated protein kinase 14 [Source:MGI Sy... [more]
Mapk142.560e-11047.84mitogen-activated protein kinase 14 [Source:MGI Sy... [more]
Mapk115.228e-10944.96mitogen-activated protein kinase 11 [Source:MGI Sy... [more]
Mapk121.201e-10746.29mitogen-activated protein kinase 12 [Source:MGI Sy... [more]
Mapk137.456e-9943.71mitogen-activated protein kinase 13 [Source:MGI Sy... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P47812|MK14_XENLA1.544e-11248.66Mitogen-activated protein kinase 14 OS=Xenopus lae... [more]
sp|Q9I958|MK14B_CYPCA9.769e-11147.85Mitogen-activated protein kinase 14B OS=Cyprinus c... [more]
sp|O02812|MK14_CANLF1.162e-11047.84Mitogen-activated protein kinase 14 OS=Canis lupus... [more]
sp|Q16539|MK14_HUMAN1.413e-11047.84Mitogen-activated protein kinase 14 OS=Homo sapien... [more]
sp|Q95NE7|MK14_PANTR3.223e-11047.84Mitogen-activated protein kinase 14 OS=Pan troglod... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RTP71.037e-11846.88Mitogen-activated protein kinase OS=Fasciola hepat... [more]
A0A4S2L8C74.972e-11345.45Mitogen-activated protein kinase OS=Opisthorchis f... [more]
A0A2U9K5Z71.166e-11247.95Mitogen-activated protein kinase OS=Bugula neritin... [more]
G7YQ712.924e-11245.45Mitogen-activated protein kinase OS=Clonorchis sin... [more]
A0A2I4CR375.509e-11247.54Mitogen-activated protein kinase OS=Austrofundulus... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk112.086e-11447.83mitogen-activated protein kinase 11 [Source:NCBI g... [more]
mapk14b6.646e-11147.28mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk14a1.904e-11047.43mitogen-activated protein kinase 14A-like [Source:... [more]
mapk14a1.372e-10947.43mitogen-activated protein kinase 14A-like [Source:... [more]
mapk12b4.477e-10243.45mitogen-activated protein kinase 12-like [Source:N... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk14a5.985e-10444.51mitogen-activated protein kinase 14a [Source:NCBI ... [more]
mapk12a4.219e-9644.71mitogen-activated protein kinase 12a [Source:NCBI ... [more]
ENSPMAT00000000729.12.210e-8239.72pep scaffold:Pmarinus_7.0:GL477416:20288:37329:-1 ... [more]
mapk12.102e-8141.83mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
ENSPMAT00000004133.11.247e-6741.11pep scaffold:Pmarinus_7.0:GL479498:22366:34653:-1 ... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HOG11.455e-9244.54Mitogen-activated protein kinase involved in osmor... [more]
FUS32.849e-7137.07Mitogen-activated serine/threonine protein kinase ... [more]
SLT24.582e-6938.24Serine/threonine MAP kinase; coordinates expressio... [more]
KSS11.710e-6838.24Mitogen-activated protein kinase (MAPK); involved ... [more]
KDX11.819e-6038.74Protein kinase; implicated in Slt2p mitogen-activa... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468817.947e-9846.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405736.840e-8643.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374353.550e-7941.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455255.712e-6240.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305272.902e-5938.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk14b4.089e-11046.97mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk14b8.931e-11047.26mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk14a1.312e-10746.31mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk14a4.326e-10746.59mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk12a5.411e-10643.63mitogen-activated protein kinase 12 [Source:NCBI g... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075539.10.000e+099.72SMESG000075539.1[more]
SMESG000075533.12.026e-14754.67SMESG000075533.1[more]
SMESG000075533.18.199e-14754.67SMESG000075533.1[more]
SMESG000012868.13.019e-7638.30SMESG000012868.1[more]
SMESG000001435.17.996e-7641.93SMESG000001435.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024187 ID=SMED30024187|Name=Mitogen-activated protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1324bp
TGATTTATTTGTAAATTATAAACGCTTTAGTCATTTTTTAATATTTTTTG
AAATTCATTAATAATTTAGAAAATTATTTATATATTTCAGTAGTGAAATA
ATATTTAAATTAAAGTTATGAGAAAATTTAAAACTTATAAAATCCATTAT
TCTGATTGGCATGTAGTTTCTCGTTATGAGAATTTAAAAATAATTGGCCA
CGGTAGTCAAGGATCTGTTTGCTCTGCATTCGATTCTGAATTTAAAATTT
ATGTAGCCATTAAAAAGCTTGCTTCTCCATTCCAATCTCAAGATTCTGCT
AAACGAACTTACAGAGAAATGAAAATACTTCATCATATGGATCACGAAAA
TGTAATCTGTCTTATTGATTTATTCAGTTCTAGTGCAAACCGGATTAATT
TCAATGACGTATATTTTGTCACGCCATTACTGAGTTTTGATCTAAGCAAA
ATCATTGCCAAAGAATTTATGAAAGAAGAAAACATTTGTTTTTTCATTTA
CCAGATTTTACGTGGCCTTAAGTACATCCATTCGACTGGCGTCATTCACC
GGGATTTAGCACCGAAAAATATAGCAGTTAATGAAGACAACGAATTACGG
ATTCTCGATTTCGGCCTGTCGAGAAAGAAAGACGATTTCATGACCGGTTA
CGTTGTGTCCCGATATTACAGGGCACCGGAAATAATTTTCAAAAACAGCA
ACTACACAAACAAAATTGACATGTGGTCAGCCGGGTGTATCATGGCGGAA
ATGCTGATCCATAGGATACTGTTTCGAGGCAATGATCAATTCGATCAGCT
GAGACAGATTATGCAGATCGCAGACACGTCTCATGAGGGATTTTGGGGTC
AGATCTGTGCTGAGGAGGAAAAGAACTATTTCCTGGAAACAGTGGAATTG
TTGCCGCCAATTGACTTTCATCAGTTTTTTCGACAATACACTGAAGACCT
TAAAGCGATTGATCTGCTCAGTAAAATGCTGGTTCTTGATCCTAATCAAA
GAATCAGTGCAACGGATGCATTATTACATCCTTATCTTGAGTTTTATCAC
GACGAAACAGATGAAAGTGTTGGAGCACCATATTTGGATACATTAGAATC
AAATTCAGATGTCGATATAGAAACTTGGAAAGATGGAATATGGGATTGCA
TGAATACATTTGTTCCCAAGATTGAGAACTTGTAATCAAAAACACAGAAA
TGTTAGTATTACTCAAAATTACTAATAAATTATAAACGCTAAAAACAATT
AATGGTACAATATTGACTGTTATCCATGTCAATGATCAAATCAATATTTT
CTTGCTATTTTATTATTGTCTCAG
back to top

protein sequence of SMED30024187-orf-1

>SMED30024187-orf-1 ID=SMED30024187-orf-1|Name=SMED30024187-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=356bp
MRKFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKK
LASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSANRINFNDVYF
VTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPK
NIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKI
DMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEE
EKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATD
ALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVP
KIENL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000165MAPK cascade
GO:0006468protein phosphorylation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0010831positive regulation of myotube differentiation
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
GO:0038066p38MAPK cascade
GO:0045663positive regulation of myoblast differentiation
GO:1901741positive regulation of myoblast fusion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR020635Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004713protein tyrosine kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004707MAP kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 20..262
e-value: 8.3E-10
score: -21.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 20..307
e-value: 2.0E-63
score: 214.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 20..307
score: 43.255
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 14..343
e-value: 4.8E-124
score: 415.4
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 107..318
e-value: 4.8E-124
score: 415.4
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 5..242
e-value: 2.2E-18
score: 63.8
NoneNo IPR availablePANTHERPTHR24055:SF110MITOGEN-ACTIVATED PROTEIN KINASE 14coord: 8..350
NoneNo IPR availablePANTHERPTHR24055MITOGEN-ACTIVATED PROTEIN KINASEcoord: 8..350
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 11..313