Programmed cell death 6-interacting protein

Overview
NameProgrammed cell death 6-interacting protein
Smed IDSMED30024174
Length (bp)2765
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Programmed cell death 6-interacting protein (SMED30024174) t-SNE clustered cells

Violin plots show distribution of expression levels for Programmed cell death 6-interacting protein (SMED30024174) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Programmed cell death 6-interacting protein (SMED30024174) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Programmed cell death 6-interacting protein (SMED30024174) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024174

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30024174SMESG000051593.1 Contig4912GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30024174SMESG000051593.1 Contig4912GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024174SMESG000051593.1 Contig4912GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30024174SMESG000019014.1 Contig4912GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30024174SMESG000019014.1 Contig4912GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024174SMESG000019014.1 Contig4912GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neuronSMED30024174SMESG000019014.1 dd_Smed_v4_1373_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024174SMESG000019014.1 dd_Smed_v4_1373_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024174SMESG000019014.1 dd_Smed_v4_1373_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Human
Match: PDCD6IP (programmed cell death 6 interacting protein [Source:HGNC Symbol;Acc:HGNC:8766])

HSP 1 Score: 516.924 bits (1330), Expect = 2.106e-169
Identity = 281/740 (37.97%), Postives = 440/740 (59.46%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATSGG 2216
            M+  ISV  KK  E+   + +  ++++ Y  G E+Q+    A  E + +R   + +  DKHE  L  L RY DQ  ++E K P +EN + + F W DAF K SLFG    L +AS GYE+ CVLFN AA+ SQ+A   NL +D GLK AAK++Q A+G F +++ +V + + REPT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD + D  K  Q    K   PK+  P++A K     A AEY+Q+      + FGE+I+R + + +L+KT ++R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  PI++ F D+FEK+VP+S+  ++     ++A + N  I +++EA+   +GV+ASLNLP A+++  GD VP ++L+K+  V + GG++ +D L+  LP++  RN EIL E+++LLD EE +D  L+ +FK+RW RTPS +L +  R E   ++ +LD+A  +D  V+  Y+     I LL + E  L  +IP +N + T + S+ +  VL++L +  +++K  R GL  DL ++        L+ AL+ D  +N++     +L+++   +  KV  S+  QE L   +    QE  KM  S++ +   R  VL  L  A+D F EL +NL+EG KFY +LT+IL++FQNK  D  FARKTE++EL+KDLQ +I RE S A  I     Q++  G
Sbjct:    1 MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQY---KDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVN-VLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLT-ALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANL-REEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPS-APSIPTPAYQSSPAG 733          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Human
Match: PDCD6IP (programmed cell death 6 interacting protein [Source:HGNC Symbol;Acc:HGNC:8766])

HSP 1 Score: 512.686 bits (1319), Expect = 1.148e-167
Identity = 279/742 (37.60%), Postives = 440/742 (59.30%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSV--KAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATSGG 2216
            M+  ISV  KK  E+   + +  ++++ Y  G E+Q+    A  E + +R   + +  DKHE  L  L RY DQ  ++E K P +EN + + F W DAF K SLFG    L +AS GYE+ CVLFN AA+ SQ+A   NL +D GLK AAK++Q A+G F +++ +V + + REPT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD + D  K  Q      K  + ++  P++A K     A AEY+Q+      + FGE+I+R + + +L+KT ++R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  PI++ F D+FEK+VP+S+  ++     ++A + N  I +++EA+   +GV+ASLNLP A+++  GD VP ++L+K+  V + GG++ +D L+  LP++  RN EIL E+++LLD EE +D  L+ +FK+RW RTPS +L +  R E   ++ +LD+A  +D  V+  Y+     I LL + E  L  +IP +N + T + S+ +  VL++L +  +++K  R GL  DL ++        L+ AL+ D  +N++     +L+++   +  KV  S+  QE L   +    QE  KM  S++ +   R  VL  L  A+D F EL +NL+EG KFY +LT+IL++FQNK  D  FARKTE++EL+KDLQ +I RE S A  I     Q++  G
Sbjct:    1 MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKYFYFQEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVN-VLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLT-ALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANL-REEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPS-APSIPTPAYQSSPAG 738          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Human
Match: PDCD6IP (programmed cell death 6 interacting protein [Source:HGNC Symbol;Acc:HGNC:8766])

HSP 1 Score: 198.364 bits (503), Expect = 2.186e-56
Identity = 100/232 (43.10%), Postives = 142/232 (61.21%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQ 704
            M+  ISV  KK  E+   + +  ++++ Y  G E+Q+    A  E + +R   + +  DKHE  L  L RY DQ  ++E K P +EN + + F W DAF K SLFG    L +AS GYE+ CVLFN AA+ SQ+A   NL +D GLK AAK++Q A+G F +++ +V + + REPT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD + D  K  Q
Sbjct:    1 MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQ 232          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Human
Match: PTPN23 (protein tyrosine phosphatase non-receptor type 23 [Source:HGNC Symbol;Acc:HGNC:14406])

HSP 1 Score: 157.532 bits (397), Expect = 2.102e-38
Identity = 170/739 (23.00%), Postives = 336/739 (45.47%), Query Frame = 3
Query:   12 PMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENG-VRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNV-IMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIW---PKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRA-GQ----KFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-PGALDNTRG-DEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKD------RWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRA----------SVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELM 2132
            P   +I +  K+  +  F   +  +V + YGE  ++ N     +   +R   + ++    E   + L +YL Q   L+S++P+       +   W + F+  S+  +   +K     YE+ C+L+N+ A++S +        + G+K +  +FQ AAG F+YLR   P       + D++   L+ LNV +ML QAQE +  K++ D+ K   +A+I  QV D Y +  + ++     ++     KDW  +V  K   + A+A  +  K     Q FGE+++ F+ ++D +  A   A GQ    +   R  ++ +  +  + +K+N+ IYH+++P + TL  V    L + + + NP +      DIF K+VP++ H A +L   ++A +    + ++++ +  L   M S+ L P  +DN      +P  L+ K A   VR D  V  L   +  L  V T     ++ ++K + +    D+ L+ +F++        S T   +L E  R E  KY  + ++A  ++  +         ++RLLS   + ++ ++P   + +      ++ + L+ + A+ ++++  R  L Q L  L      + ++ +L +       +  + QL K            +  ++ L AQ +  C +  ++      R           S L  L+ +++ + +L    +EG  FY DL   +     + Q  C AR+  +++L+
Sbjct:    5 PRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEE-LKKLELLRQNAV-RVPRDFEGC-SVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHE--DIK-----YEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAY----SVDMSRQILT-LNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPV-NPTDPAVTGPDIFAKLVPMAAHEASSLYSEEKAKLLREMMAKIEDKNEVLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAALSVRPD-TVRNLVQSMQVLSGVFTD----VEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRR-EWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAALP---TPALSPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQK---DDITASLVTTDHSEMKKLFEEQLKKY-------DQLKVYLEQNLAAQDRVLCALTEANVQYAAVRRVLSDLDQKWNSTLQTLVASYEAYEDLMKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQQLL 708          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Human
Match: PDCD6IP (programmed cell death 6 interacting protein [Source:HGNC Symbol;Acc:HGNC:8766])

HSP 1 Score: 88.9669 bits (219), Expect = 6.313e-20
Identity = 59/203 (29.06%), Postives = 95/203 (46.80%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKA 617
            M+  ISV  KK  E+   + +  ++++ Y  G E+Q+    A  E + +R   + +  DKHE  L  L RY                                              Y++IC   +I   +   +E  NL +D GLK AAK++Q A+G F +++ +V + + REPT D++ DT+  L++IMLAQAQE+ + KA
Sbjct:    1 MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRY----------------------------------------------YDQIC---SIEPKFP-FSENQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKA 153          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 508.449 bits (1308), Expect = 7.546e-167
Identity = 284/790 (35.95%), Postives = 456/790 (57.72%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFR------SELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDN-TRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSD---SSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATS---GGTELS---------------AQQPVQSEVPARPPPTYQTQNSGQP 2303
             +S P K   E+  ++ +++Y+  +Y   +  +S  A A  E N +RSK  C+  DKH+S L+ LTRY DQ VA+E+KI I+     + FKW DAF K SLF  + SL ++ G +ER  VLFNI ++ SQ+        D  +K +AK FQQ+AG+F+ LR  V  ++Q+EPT DL  DTL+AL+ +M AQAQE IY K  +D  K  ++ KI  QVA+ Y++  K+M  + V+ +W KDW  IV+GK   Y A+A+Y+Q++ CG ++  GEQ+SR  +S+ L  TA     QK+  R           + +     +K+N+ IYH+ + D  TL  + K +LA+   ++ P+   FRD+F  +VP+ +H+AM     ++A + N E  R++EA+  ++GV+ASLNLP ALD+ T  + +P++L  K+A ++++GG  ++  L + LP +  RN +IL E  ++L+ E+ SD  ++ Q   +W+R  S +LT     EI KY+ +L  A ++D +V+  ++   + I LLS+NE  L+ SIP   + +TGE +D++++ LR   ++  ++ + R  L ++L N     I N    A++ +  +N++     ++ ++   ++ +V +S+++QE L  Q+Q        +   SS+G +R  +L  L  A D + ELK+NLEEG KFY DLT IL++ Q KV DF FAR+TEKE+LM+ LQ +IV  ++    +   N   +S   GGT  +               A   V+S +   PPP  Q    GQP
Sbjct:    6 FLSAPLKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTA-----QKYLPRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLPKAVLAKPTPMQTPMTPSFRDMFAVLVPVQVHNAMQSYDARKAELVNMETVRMREATQLMNGVLASLNLPAALDDVTSTETLPESLKLKSAKLKQNGGSSEIMRLFSELPTLYQRNEDILTETSRILNEEKESDDTMRKQLGTKWTRMSSEQLTGPLVTEIGKYRGILHTASNADKMVKEKFESHRQGIELLSKNESELRSSIPGQTAHATGE-TDTVRQ-LRQFMSQWNEVTTDRELLEKELKN-TNCDIANDFLKAMAENQLINEEHISKEKIAQIFGDLKRRVQSSLDTQETLMNQIQAANNTFTGEKTGSSTGAERERILKMLAQASDAYVELKANLEEGTKFYNDLTPILVRLQQKVSDFAFARQTEKEDLMRQLQLSIVSGQAAKAVVDGVNSLVSSYLTGGTNAAQSPANAPPRPPPPRPAAPSVESPI---PPPRTQQSMQGQP 784          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 506.523 bits (1303), Expect = 5.882e-166
Identity = 269/723 (37.21%), Postives = 434/723 (60.03%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFR------SELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDN-TRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSD---SSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIV 2156
             +S P K   E+  ++ +++Y+  +Y   +  +S  A A  E N +RSK  C+  DKH+S L+ LTRY DQ VA+E+KI I+     + FKW DAF K SLF  + SL ++ G +ER  VLFNI ++ SQ+        D  +K +AK FQQ+AG+F+ LR  V  ++Q+EPT DL  DTL+AL+ +M AQAQE IY K  +D  K  ++ KI  QVA+ Y++  K+M  + V+ +W KDW  IV+GK   Y A+A+Y+Q++ CG ++  GEQ+SR  +S+ L  TA     QK+  R           + +     +K+N+ IYH+ + D  TL  + K +LA+   ++ P+   FRD+F  +VP+ +H+AM     ++A + N E  R++EA+  ++GV+ASLNLP ALD+ T  + +P++L  K+A ++++GG  ++  L + LP +  RN +IL E  ++L+ E+ SD  ++ Q   +W+R  S +LT     EI KY+ +L  A ++D +V+  ++   + I LLS+NE  L+ SIP   + +TGE +D++++ LR   ++  ++ + R  L ++L N     I N    A++ +  +N++     ++ ++   ++ +V +S+++QE L  Q+Q        +   SS+G +R  +L  L  A D + ELK+NLEEG KFY DLT IL++ Q KV DF FAR+TEKE+LM+ LQ +IV
Sbjct:    6 FLSAPLKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTA-----QKYLPRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLPKAVLAKPTPMQTPMTPSFRDMFAVLVPVQVHNAMQSYDARKAELVNMETVRMREATQLMNGVLASLNLPAALDDVTSTETLPESLKLKSAKLKQNGGSSEIMRLFSELPTLYQRNEDILTETSRILNEEKESDDTMRKQLGTKWTRMSSEQLTGPLVTEIGKYRGILHTASNADKMVKEKFESHRQGIELLSKNESELRSSIPGQTAHATGE-TDTVRQ-LRQFMSQWNEVTTDRELLEKELKN-TNCDIANDFLKAMAENQLINEEHISKEKIAQIFGDLKRRVQSSLDTQETLMNQIQAANNTFTGEKTGSSTGAERERILKMLAQASDAYVELKANLEEGTKFYNDLTPILVRLQQKVSDFAFARQTEKEDLMRQLQLSIV 720          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 505.753 bits (1301), Expect = 2.400e-165
Identity = 269/723 (37.21%), Postives = 434/723 (60.03%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFR------SELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDN-TRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSD---SSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIV 2156
             +S P K   E+  ++ +++Y+  +Y   +  +S  A A  E N +RSK  C+  DKH+S L+ LTRY DQ VA+E+KI I+     + FKW DAF K SLF  + SL ++ G +ER  VLFNI ++ SQ+        D  +K +AK FQQ+AG+F+ LR  V  ++Q+EPT DL  DTL+AL+ +M AQAQE IY K  +D  K  ++ KI  QVA+ Y++  K+M  + V+ +W KDW  IV+GK   Y A+A+Y+Q++ CG ++  GEQ+SR  +S+ L  TA     QK+  R           + +     +K+N+ IYH+ + D  TL  + K +LA+   ++ P+   FRD+F  +VP+ +H+AM     ++A + N E  R++EA+  ++GV+ASLNLP ALD+ T  + +P++L  K+A ++++GG  ++  L + LP +  RN +IL E  ++L+ E+ SD  ++ Q   +W+R  S +LT     EI KY+ +L  A ++D +V+  ++   + I LLS+NE  L+ SIP   + +TGE +D++++ LR   ++  ++ + R  L ++L N     I N    A++ +  +N++     ++ ++   ++ +V +S+++QE L  Q+Q        +   SS+G +R  +L  L  A D + ELK+NLEEG KFY DLT IL++ Q KV DF FAR+TEKE+LM+ LQ +IV
Sbjct:    6 FLSAPLKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTA-----QKYLPRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLPKAVLAKPTPMQTPMTPSFRDMFAVLVPVQVHNAMQSYDARKAELVNMETVRMREATQLMNGVLASLNLPAALDDVTSTETLPESLKLKSAKLKQNGGSSEIMRLFSELPTLYQRNEDILTETSRILNEEKESDDTMRKQLGTKWTRMSSEQLTGPLVTEIGKYRGILHTASNADKMVKEKFESHRQGIELLSKNESELRSSIPGQTAHATGE-TDTVRQ-LRQFMSQWNEVTTDRELLEKELKN-TNCDIANDFLKAMAENQLINEEHISKEKIAQIFGDLKRRVQSSLDTQETLMNQIQAANNTFTGEKTGSSTGAERERILKMLAQASDAYVELKANLEEGTKFYNDLTPILVRLQQKVSDFAFARQTEKEDLMRQLQLSIV 720          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 505.753 bits (1301), Expect = 2.400e-165
Identity = 269/723 (37.21%), Postives = 434/723 (60.03%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFR------SELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDN-TRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSD---SSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIV 2156
             +S P K   E+  ++ +++Y+  +Y   +  +S  A A  E N +RSK  C+  DKH+S L+ LTRY DQ VA+E+KI I+     + FKW DAF K SLF  + SL ++ G +ER  VLFNI ++ SQ+        D  +K +AK FQQ+AG+F+ LR  V  ++Q+EPT DL  DTL+AL+ +M AQAQE IY K  +D  K  ++ KI  QVA+ Y++  K+M  + V+ +W KDW  IV+GK   Y A+A+Y+Q++ CG ++  GEQ+SR  +S+ L  TA     QK+  R           + +     +K+N+ IYH+ + D  TL  + K +LA+   ++ P+   FRD+F  +VP+ +H+AM     ++A + N E  R++EA+  ++GV+ASLNLP ALD+ T  + +P++L  K+A ++++GG  ++  L + LP +  RN +IL E  ++L+ E+ SD  ++ Q   +W+R  S +LT     EI KY+ +L  A ++D +V+  ++   + I LLS+NE  L+ SIP   + +TGE +D++++ LR   ++  ++ + R  L ++L N     I N    A++ +  +N++     ++ ++   ++ +V +S+++QE L  Q+Q        +   SS+G +R  +L  L  A D + ELK+NLEEG KFY DLT IL++ Q KV DF FAR+TEKE+LM+ LQ +IV
Sbjct:    6 FLSAPLKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTA-----QKYLPRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLPKAVLAKPTPMQTPMTPSFRDMFAVLVPVQVHNAMQSYDARKAELVNMETVRMREATQLMNGVLASLNLPAALDDVTSTETLPESLKLKSAKLKQNGGSSEIMRLFSELPTLYQRNEDILTETSRILNEEKESDDTMRKQLGTKWTRMSSEQLTGPLVTEIGKYRGILHTASNADKMVKEKFESHRQGIELLSKNESELRSSIPGQTAHATGE-TDTVRQ-LRQFMSQWNEVTTDRELLEKELKN-TNCDIANDFLKAMAENQLINEEHISKEKIAQIFGDLKRRVQSSLDTQETLMNQIQAANNTFTGEKTGSSTGAERERILKMLAQASDAYVELKANLEEGTKFYNDLTPILVRLQQKVSDFAFARQTEKEDLMRQLQLSIV 720          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Celegans
Match: alx-1 (Apoptosis-linked gene 2-interacting protein X 1 [Source:UniProtKB/Swiss-Prot;Acc:P34552])

HSP 1 Score: 275.018 bits (702), Expect = 1.964e-82
Identity = 139/358 (38.83%), Postives = 211/358 (58.94%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFR------SELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFR 1073
             +S P K   E+  ++ +++Y+  +Y   +  +S  A A  E N +RSK  C+  DKH+S L+ LTRY DQ VA+E+KI I+     + FKW DAF K SLF  + SL ++ G +ER  VLFNI ++ SQ+        D  +K +AK FQQ+AG+F+ LR  V  ++Q+EPT DL  DTL+AL+ +M AQAQE IY K  +D  K  ++ KI  QVA+ Y++  K+M  + V+ +W KDW  IV+GK   Y A+A+Y+Q++ CG ++  GEQ+SR  +S+ L  TA     QK+  R           + +     +K+N+ IYH+ + D  TL  + K +LA+   ++ P+   FR
Sbjct:    6 FLSAPLKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTA-----QKYLPRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLPKAVLAKPTPMQTPMTPSFR 358          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Fly
Match: ALiX (gene:FBgn0086346 transcript:FBtr0085241)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 303/775 (39.10%), Postives = 464/775 (59.87%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY---GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDE-VPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSS-GTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATSG-GTELSAQQPVQSEVPARPPPT------YQTQNSGQP 2303
            MS+ + VP KK  E+  I+ ++  ++  Y    EE++     A  EF+  R+  + K F+K+E++L  +  Y DQ  ALE+KI ++E  ++I FKW DAF K S+FG K SL   S  YE++CVLFNIAA+ S +A   +L  D GLK   K  QQ+AGIF YL+ + P  +  EPT DL+ DTL+ L  +M+AQAQE+   KA++D+ KD  IAK+  Q  + YAD L+ MQ  SV+++W K+WIP +AGKQAG+HA+ + YQ+  C  ++  GE+I+R R +IDL K A TR+G +        R KR L    K+N  IY++ IP+++TL+   K  LA+ + +  P+ ++F+DIF  +VP+ +H A+T    +R  + N EI +L+EA+ TL+ V+ASLNLP A++   G+  +P +L  KA  VR+ GG+E +  +L  LP++  RN EIL E  +LLD E +SD QL+ QFKDRW+R  S KLTE +R   +KY+ ++  A  +D +VR  ++   + I+LLS   + ++QS+P S S S      S++  L+ L  + E +K+ R  +  +L    T ++ +    AL  D  +++      ++ ++L P++++V  S+  Q+ L +++Q       S++ S G+ R ++   L  AFD + EL  NL+EG KFY DLT +L+ FQNK+ DF FARKTEKEEL+KDL +   R+   A P   S+  +TSG G+++          P+ PP        Y  Q  G P
Sbjct:    1 MSKFLGVPLKKPSEVDVIKPLNNLIQSTYNGASEEEKGKYGEAVNEFSKQRNTAIWKFFEKYEASLEIVYAYYDQICALETKISVSE--LQIPFKWKDAFDKGSIFGGKISLTHTSLLYEKVCVLFNIAALQSNIAANQSLDSDDGLKLTIKLLQQSAGIFQYLKGATPAAVPSEPTPDLSQDTLTVLQALMVAQAQEVFILKAIKDNLKDQIIAKLCCQAEESYADVLRAMQKESVRSLWEKEWIPTIAGKQAGFHALTQLYQSLVCRAAKKIGEEIARLRNAIDLFKAAQTRSGNETYLDEYFSRAKRNLTESTKDNEFIYNEIIPELSTLTSPGKAQLAKPLPIAVPLAENFKDIFSSLVPVELHRALTASDMRRNEIVNVEIMKLREATQTLNAVLASLNLPAAVETADGNSGLPPSLKEKANEVRQKGGIENVQTMLKDLPELLNRNREILDETERLLDEERDSDNQLRAQFKDRWTRISSDKLTEMFRTNAKKYREVITNAIEADKVVRQKFEANQKGIQLLSLPPDQIQQSLP-SASGSVDPNCSSVQR-LKKLMDDVETIKAEREAIESELKG-ATFNMKDEFLIALQKDGAIDEPALSLARIGQVLNPLQQQVRESVERQQSLVSEIQSAHGAFVSETGSCGSSRDTLYQELATAFDSYIELSGNLQEGTKFYNDLTQLLVVFQNKISDFVFARKTEKEELLKDLTTESSRQACPATPALPSHYASTSGSGSDIPP-----GSAPSVPPAASTANIPYPAQVQGMP 765          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Fly
Match: mop (gene:FBgn0036448 transcript:FBtr0075700)

HSP 1 Score: 138.272 bits (347), Expect = 9.214e-33
Identity = 165/727 (22.70%), Postives = 320/727 (44.02%), Query Frame = 3
Query:   84 YVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIP-IAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIM-----LAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQL------------NSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRA---------GQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLE-NPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGA-LDNTRGDEVPDNLLSKAAIVRKD-GGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPK-SNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNL--ETSSIGNTLSNALSSDPELNQDQFVD--GQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFY----GDLTDILLKFQNKVQDFCFARKTEKEELMKDLQS 2147
            Y+ E Y E+ ++ +         +R++ +    D        + RY  Q  AL+++ P +A+ G+   FKW D +   S   +   L+     +ER  VLFNIAA+++Q   +    D  G+K A  +FQ AA  +  LR    N+       +  GD ++   ++       AQAQE I  K++ D+ K   +AK+  Q+   Y   L  +              +SV  +W K     V  K      +   YQ +     +  GE+++ ++ S D ++ A   +          +   F +++   KR  +  + EN  IYH+++P+++T++ V    L   I  + +       DIF ++VP+  H A +L   ++A +       L+E    L   M+SL L    ++  + +++P  ++ + A +  +   +  L + +++L ++T      L E   +L+ E  ++++   Q      RTP+  +TE  R E QKY     +A  S++ +R        ++++L++    ++Q +PK S+  +T E    +K +L     +  ++K+ R     DL     E    G  +++      E  Q  F    G+ +K+   + + + A  N  + LT    +   +L +       R    S+L  ++D + +L +   +GL+FY    G++  +L +F++       AR  + EE  + +QS
Sbjct:   29 YIAEFYHEDPEAYSKEVHA-LETLRNQAMHTTKDGAP----VMKRYYCQLHALQNRFPQLADRGI-FTFKWKDLY--HSAVHEVTDLR-----FERAAVLFNIAALHTQSGASVTRGDVDGMKMACTHFQAAAWAYGELRERYANV-------NGGGDFMTPELLVFQQQVCFAQAQECILEKSLIDNRKPHIVAKVTAQIVVYYGAALAALLTGGDDGPVAQVIDSSVYKLWKK----YVRFKINYLTCILYLYQGQHSEEKRQMGERVTLYQASWDKLEEARKESKGLPDQREINESLSFTADVVEAKR--KNAKNENEFIYHEAVPELSTIAAVQGANLVNGIGFQVSDEEHAGPDIFARLVPMKAHEASSLYSEEKAKLLRKYGALLEEKDTQLESYMSSLTLDNLNINEEQANKLPQGIVDRCAALNANKTAISDLVEAMSQLAEITADVETNLGEISSMLEAEAKAEREF--QSATGVQRTPNAHITELSR-EFQKYSEAHARAGESNNTLRKAMSLHVNNLKILARPLPEIQQLMPKLSSELNTTEIFRDVKLILN----KVNEMKAQRAQFHADLRIAINEDDITGKVIAHG---GQEGLQALFATELGKHDKITELLDQNMVAQGNILQALTENYAKAAPVLKTLQDVKQKREHFYSSLAASYDVYEDLLAKSAKGLEFYKKLAGNVQKLLTRFRS-------ARDVQSEERQQRMQS 712          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Fly
Match: Rhp (gene:FBgn0026374 transcript:FBtr0074095)

HSP 1 Score: 90.5077 bits (223), Expect = 2.982e-18
Identity = 69/268 (25.75%), Postives = 120/268 (44.78%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTK-------AVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKS 806
            +I +  K+  EI F+E  S ++ E Y EE  S   +A  +  + R     K   +    +  L RY +    +E +    +  + + F+W      DSL G     +  +  +E+ C LFN+  +Y+Q+    + + + GL  A   F +AAG+F ++  +  N     P+ DL    L  L  +ML+QA+E ++ K          D     ++A    Q++  Y +  K +Q N      P+ W  +V  K   Y A A +Y+A+S
Sbjct:  122 MIPLGLKETKEINFMEPFSDFILEHYSEEP-SMYIDAIADMTDTRQA--SKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEW-----YDSLTGVPSCQRTIA--FEKACTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNA----PSMDLKPQVLDVLVSLMLSQARECLFEKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYLPECWAGLVPVKAELYKAFAHFYKARS 375          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Fly
Match: Rhp (gene:FBgn0026374 transcript:FBtr0074096)

HSP 1 Score: 90.5077 bits (223), Expect = 2.982e-18
Identity = 69/268 (25.75%), Postives = 120/268 (44.78%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTK-------AVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKS 806
            +I +  K+  EI F+E  S ++ E Y EE  S   +A  +  + R     K   +    +  L RY +    +E +    +  + + F+W      DSL G     +  +  +E+ C LFN+  +Y+Q+    + + + GL  A   F +AAG+F ++  +  N     P+ DL    L  L  +ML+QA+E ++ K          D     ++A    Q++  Y +  K +Q N      P+ W  +V  K   Y A A +Y+A+S
Sbjct:  122 MIPLGLKETKEINFMEPFSDFILEHYSEEP-SMYIDAIADMTDTRQA--SKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEW-----YDSLTGVPSCQRTIA--FEKACTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNA----PSMDLKPQVLDVLVSLMLSQARECLFEKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYLPECWAGLVPVKAELYKAFAHFYKARS 375          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Zebrafish
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:ZFIN;Acc:ZDB-GENE-040426-2678])

HSP 1 Score: 518.85 bits (1335), Expect = 2.574e-170
Identity = 280/741 (37.79%), Postives = 441/741 (59.51%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGE-EQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQ---EKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAH---PIRNSNIQATSGG 2216
            M+  ISVP KK  E+  ++ +S +V   Y   E+Q+    A  E N +R   L +  DKHES+L  L RY DQ  A+E K P  E  + + F W DAF K SLFG    L +AS GYE+ CVLFN+ A+ SQ+A   NL +D GLKTAAK++Q A+G F++++ +V + + REPT D++ +T+  L+ IML+QAQE+   KA  D  KD  +AK+  Q AD Y D  K  Q    K   PKD +P++A K     A AE +Q+      + FGE+I+R + + +L+KTA++R  +    +   +++ R L   +K+N+ IYHD +P+V  L  + K  L +  +++ P+++ F D+FEK+VP+++  +++   +++A   N  I  ++EA+N  +GV+ASLNLP AL++  GD VP ++L K+  + + GG++ ++ L+  LP++  RN EIL E++K+LD+EE +D +L+ +F  RW+RTPSG L +  R E   ++ +LD+A  +D +VR  Y      I LL + E  L  +IP +N + T + S+ +  VLR+  A+ +++K  R  L  ++ ++ T  +      AL+ D  +N++     +L+       ++V  ++  QE+L +Q+Q   ++   L   +S    R  VL  L  A D + E+ SN++EG KFY DLT+ILLKFQNK  D  FARKTE++EL+K+LQ +I RE S      P   SN  A +GG
Sbjct:    1 MATFISVPLKKSSEVDLVKPLSKFVTATYPPGEEQAEYLRAVDELNKLRKSALGRPLDKHESSLEILLRYYDQLCAIEPKFPFPE--LCLTFTWKDAFDKGSLFGGSVKLALASLGYEKTCVLFNVGALASQIASEQNLDNDEGLKTAAKFYQLASGAFAHIKDTVLSALNREPTMDISPETVGTLSQIMLSQAQEVFVLKATSDKMKDAIVAKLANQAADYYGDAFKQCQ---YKENLPKDVLPVLAAKHCMMQATAEMHQSALANQKKKFGEEIARLQHAQELVKTAASRYDEYVNVKDLSDKINRALTAAKKDNDFIYHDRVPEVKDLEHIGKASLVKATAVQTPLSQKFTDLFEKMVPMAVQQSVSAANSRKAETVNRLIGSMREATNLCNGVLASLNLPAALEDLSGDAVPQSILEKSRALIQQGGLQSIEQLIKDLPELLQRNREILDESLKMLDDEEATDNELRGKFNQRWNRTPSGDLYKPLRAEGNNFRNILDKAVQADQVVRERYTAHCEMIALLCKPENELSAAIPSANPAKTLQGSEVVN-VLRSQLAQLDEVKREREVLEGEVKSV-TFDLTAKFLTALAQDGAINEEVMTSSELDARYGSHNQRVQQNLRRQEELLSQIQVSHQEFSALKQSNSEANTREDVLKKLASAHDSYIEISSNIKEGTKFYNDLTEILLKFQNKCSDIVFARKTERDELLKELQQSIAREPSAPSFSVPSYQSNTPAPAGG 734          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Zebrafish
Match: ptpn23b (protein tyrosine phosphatase, non-receptor type 23, b [Source:ZFIN;Acc:ZDB-GENE-060503-179])

HSP 1 Score: 166.392 bits (420), Expect = 1.762e-41
Identity = 175/726 (24.10%), Postives = 334/726 (46.01%), Query Frame = 3
Query:   12 PMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENG-VRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNS--VKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETV-------EKENNLIYHDSIPDVATLSIV--AKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDR-WSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNK---LLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMK 2135
            P   +I +  K+  + +F   +  Y++  YGE  ++  + A      +R  ++     +     N L +Y  Q   L+S++P+A      +   W D F   ++  +  +       YE  CVL+N+ A++S +    N   + G+K +  +FQ +AG F+YLR           + D++   LS    +MLAQAQE +  K + D+ K   IAKI  QV D Y D L++++ NS  V     K+W  ++  K + + A+   +  K     Q +GE ++ F+ S+D +  A  ++  K Q  +  E +K  ++ +       +K+N+ IYH+S+P + TL  V  A ++    +SL +  +    D+F K+VP++ H A +L   ++A +    + ++++ +  L   M SL+            +PD LL K A   VR D  V+ L   +  L +V T     L E    L+ +E  +K L +    +     PS  + +  + +++KY+     A +S+  +     Q   ++RLL  + E L++S+P+   S   E + S+++ ++ +  + ++++  R  L   L +L      + ++  L +    +       QL K   L   I + + A  N  + LT    +   +  + + +     + + AL+ +F+ + EL    EEG  FY DL        ++ + +C  R+ E+  L++
Sbjct:    5 PRMPMIWLELKEAGDFEFSPTVRQYIEINYGENPENY-SEALKRLEQLRQSVVN--IPRDFEGCNTLRKYCGQLHFLQSRVPMATGQEAALPVTWTDIFTGRNITHEDIN-------YEHACVLYNLGALHSLLGAVDNRLSEEGMKVSCTHFQCSAGAFAYLRDHY----SHSYSSDMSSQALSINISLMLAQAQECLLEKTLLDNRKSHLIAKICAQVCDYYKDCLRVLE-NSECVPGRIQKEWRKLINMKISYFSAITHLHMGKQSEEQQKYGEAVAYFQFSLDKLNEAIKQS--KGQPETIQEALKFTMDVIGGKYNSAKKDNDFIYHESVPSLDTLGAVKGASLVKPLPVSLTD-QSVTGPDLFSKLVPMATHEASSLYSEEKAKLLRDIVSKIEDKNQILEKFMESLSSDSLYKIDMFKSLPDALLEKCAFLSVRPD-TVKNLVQAMQALSNVYTDVGSSLDEVRSALEEDEAGEKGLIELVGQKGLPAKPS--VFQDIQKDLKKYEAAHQTASNSNTELHRAMNQHIPNLRLLQGSVEELRKSLPQPELSQ--EETVSLQK-MKTILGKVDEMRKQRMSLESQLRDLIHK---DDITGVLVTTDRADFKTLFAEQLKKYDQLKGYIEQNLVAQDNILKALTEANVQYAPVRKTLTLTEQQWNTTVQALIASFEAYEELMKKAEEGRDFYQDLDKKTSGLLDQTKSYCQTREAERVALLE 703          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Zebrafish
Match: ptpn23a (protein tyrosine phosphatase, non-receptor type 23, a [Source:ZFIN;Acc:ZDB-GENE-100921-24])

HSP 1 Score: 164.466 bits (415), Expect = 9.838e-41
Identity = 170/739 (23.00%), Postives = 345/739 (46.68%), Query Frame = 3
Query:   42 KKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIA---ENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNV-IMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIW---PKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRA-GQ----KFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-PGALDNTRG-DEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRA----SVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELM-KDLQSAIVREKSEAHPIRN 2189
            K+  E +F   +  ++ + YGE+  + N     +   +R   +    D      + L +Y  Q   L+S++P+    E  V I   W + F+  ++  +          YE+ C+L+N+ A++S +    N   + G+K +  +FQ +AG F+YLR    +      + D++   L+ LN+ +ML QAQE +  K++ D+ K   +A+I  QV D Y +  + ++ +   ++     KDW  +V  K   + A+A  +  K     Q +GE+++  + S+D +  A   A GQ    +   R  ++ +  +  + +K+N+ IYH+S+P + TL+ V    L + + + NP +      DIF K+VP++ H A +L   ++A +    + ++   + TL   M SL L P ++DN    + +P  L+ K A   VR D  V+ L   +  L  V T     L+E   +LD +E  ++ L++    +        L E  R +++KY    ++A  ++  +         ++RLL    +TL++++P+   S   E   +  + ++ +  + ++++  R+ L + L +L      + ++ AL +    +  +  + QL K    ++  +  ++ +QE +   + E      +     T+      S +  L+ +++ + +L    +EG +FY DL     +   K +  C ARK E++ +  ++L+    +  +   P +N
Sbjct:   15 KEAGEFQFSPTVKQFILKNYGEDPDNYNEQ-LKKLEQLRQSAVNVTRDF--EGCSTLRKYFGQLHYLQSRVPLGLGQEAAVPIS--WTEIFSGKTVTHEDIC-------YEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFAYLRDHFSHSY----SVDMSHQILN-LNINLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENSETASMLGKIQKDWKKLVQMKIYYFAAIAHLHMGKQAEEQQKYGERVAYLQSSLDKLGEAIKLAKGQPDSVQEALRFTMDVIGGKFNSAKKDNDFIYHESVPSLETLTSVKGAPLVKALPV-NPTDPSVTGPDIFAKLVPMAAHEASSLYSEEKAKLLRDVMAKVDNKNETLEQFMDSLGLDPESVDNMEMYNTLPTVLMEKCAALSVRPD-TVKNLIQSMQVLSGVFTDVEASLREIRDVLDEDETEEQSLEEAVGKQAVPERPSTLAE-LRRDLEKYLEAHEKASFTNTELHRAMNLHISNLRLLGGPLDTLREALPRPQLS---EDEMAGLQTMKRILGKVQEMRDQRSSLEKQLRDLIQQ---DDITTALVTTERADMKKLFEEQLKKYEQ-VKVYIDQNLAAQENILKALTEANVQYATVRKGLTETEHKWNSTVQMLVASYEAYEDLMKKSQEGKEFYEDLETKASRLLEKSKTVCKARKEERQAITERELKKKAPQRPTAPKPAQN 726          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Zebrafish
Match: ptpn23b (protein tyrosine phosphatase, non-receptor type 23, b [Source:ZFIN;Acc:ZDB-GENE-060503-179])

HSP 1 Score: 157.147 bits (396), Expect = 1.299e-38
Identity = 180/757 (23.78%), Postives = 339/757 (44.78%), Query Frame = 3
Query:   12 PMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENG-VRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNS--VKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQIS--------------RFRKSIDLMKTASTRAGQKFQFRSELERMKRELETV-------EKENNLIYHDSIPDVATLSIV--AKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDR-WSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNK---LLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIR 2186
            P   +I +  K+  + +F   +  Y++  YGE  ++  + A      +R  ++     +     N L +Y  Q   L+S++P+A      +   W D F   ++  +  +       YE  CVL+N+ A++S +    N   + G+K +  +FQ +AG F+YLR           + D++   LS    +MLAQAQE +  K + D+ K   IAKI  QV D Y D L++++ NS  V     K+W  ++  K + + A+   +  K     Q +GE +S               F+ S+D +  A  ++  K Q  +  E +K  ++ +       +K+N+ IYH+S+P + TL  V  A ++    +SL +  +    D+F K+VP++ H A +L   ++A +    + ++++ +  L   M SL+            +PD LL K A   VR D  V+ L   +  L +V T     L E    L+ +E  +K L +    +     PS  + +  + +++KY+     A +S+  +     Q   ++RLL  + E L++S+P+   S   E + S+++ ++ +  + ++++  R  L   L +L      + ++  L +    +       QL K   L   I + + A  N  + LT    +   +  + + +     + + AL+ +F+ + EL    EEG  FY DL        ++ + +C  R+ E+  L++       RE  +  P R
Sbjct:    5 PRMPMIWLELKEAGDFEFSPTVRQYIEINYGENPENY-SEALKRLEQLRQSVVN--IPRDFEGCNTLRKYCGQLHFLQSRVPMATGQEAALPVTWTDIFTGRNITHEDIN-------YEHACVLYNLGALHSLLGAVDNRLSEEGMKVSCTHFQCSAGAFAYLRDHY----SHSYSSDMSSQALSINISLMLAQAQECLLEKTLLDNRKSHLIAKICAQVCDYYKDCLRVLE-NSECVPGRIQKEWRKLINMKISYFSAITHLHMGKQSEEQQKYGEAVSVCLCAFSALFDLVAYFQFSLDKLNEAIKQS--KGQPETIQEALKFTMDVIGGKYNSAKKDNDFIYHESVPSLDTLGAVKGASLVKPLPVSLTD-QSVTGPDLFSKLVPMATHEASSLYSEEKAKLLRDIVSKIEDKNQILEKFMESLSSDSLYKIDMFKSLPDALLEKCAFLSVRPD-TVKNLVQAMQALSNVYTDVGSSLDEVRSALEEDEAGEKGLIELVGQKGLPAKPS--VFQDIQKDLKKYEAAHQTASNSNTELHRAMNQHIPNLRLLQGSVEELRKSLPQPELSQ--EETVSLQK-MKTILGKVDEMRKQRMSLESQLRDLIHK---DDITGVLVTTDRADFKTLFAEQLKKYDQLKGYIEQNLVAQDNILKALTEANVQYAPVRKTLTLTEQQWNTTVQALIASFEAYEELMKKAEEGRDFYQDLDKKTSGLLDQTKSYCQTREAERVALLE-------REIGKGSPSR 727          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Zebrafish
Match: ptpn23a (protein tyrosine phosphatase, non-receptor type 23, a [Source:ZFIN;Acc:ZDB-GENE-100921-24])

HSP 1 Score: 149.828 bits (377), Expect = 3.948e-36
Identity = 165/736 (22.42%), Postives = 338/736 (45.92%), Query Frame = 3
Query:   42 KKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIA---ENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNV-IMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIW---PKDWIPIVAGKQAGYHAMAE--YYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-PGALDNTRG-DEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRA----SVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELM-KDLQSAIVREKSEAHPIRN 2189
            K+  E +F   +  ++ + YGE+  + N     +   +R   +    D      + L +Y  Q   L+S++P+    E  V I   W + F+  ++  +          YE+ C+L+N+ A++S +    N   + G+K +  +FQ +AG F+YLR    +      + D++   L+ LN+ +ML QAQE +  K++ D+ K   +A+I  QV D Y +  + ++ +   ++     KDW  +V  K   + A+A   Y Q+            + +  ++I L K       +  +F   ++ +  +  + +K+N+ IYH+S+P + TL+ V    L + + + NP +      DIF K+VP++ H A +L   ++A +    + ++   + TL   M SL L P ++DN    + +P  L+ K A   VR D  V+ L   +  L  V T     L+E   +LD +E  ++ L++    +        L E  R +++KY    ++A  ++  +         ++RLL    +TL++++P+   S   E   +  + ++ +  + ++++  R+ L + L +L      + ++ AL +    +  +  + QL K    ++  +  ++ +QE +   + E      +     T+      S +  L+ +++ + +L    +EG +FY DL     +   K +  C ARK E++ +  ++L+    +  +   P +N
Sbjct:   15 KEAGEFQFSPTVKQFILKNYGEDPDNYNEQ-LKKLEQLRQSAVNVTRDF--EGCSTLRKYFGQLHYLQSRVPLGLGQEAAVPIS--WTEIFSGKTVTHEDIC-------YEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFAYLRDHFSHSY----SVDMSHQILN-LNINLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENSETASMLGKIQKDWKKLVQMKIYYFAAIAHVAYLQSS-----------LDKLGEAIKLAKGQPDSVQEALRFT--MDVIGGKFNSAKKDNDFIYHESVPSLETLTSVKGAPLVKALPV-NPTDPSVTGPDIFAKLVPMAAHEASSLYSEEKAKLLRDVMAKVDNKNETLEQFMDSLGLDPESVDNMEMYNTLPTVLMEKCAALSVRPD-TVKNLIQSMQVLSGVFTDVEASLREIRDVLDEDETEEQSLEEAVGKQAVPERPSTLAE-LRRDLEKYLEAHEKASFTNTELHRAMNLHISNLRLLGGPLDTLREALPRPQLS---EDEMAGLQTMKRILGKVQEMRDQRSSLEKQLRDLIQQ---DDITTALVTTERADMKKLFEEQLKKYEQ-VKVYIDQNLAAQENILKALTEANVQYATVRKGLTETEHKWNSTVQMLVASYEAYEDLMKKSQEGKEFYEDLETKASRLLEKSKTVCKARKEERQAITERELKKKAPQRPTAPKPAQN 710          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Xenopus
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:NCBI gene;Acc:496474])

HSP 1 Score: 511.146 bits (1315), Expect = 1.741e-168
Identity = 274/723 (37.90%), Postives = 427/723 (59.06%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGE-EQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKS 2168
            M+  ISVP KK  E+  ++ +S Y+   Y   E Q+    A  E N +R   + +  DKHE++L  + RY DQ  ++E K P  E+ + + F W DAF K S+FG    L + S GYE+ CVLFNI A+ SQ+A   NL +D  LK A+K++Q A+G FS+++ +V + + R+PT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD Y D  K  Q    K    K+  PI+A K     A A Y+Q+      + FGE+I R + + DL+KT S+R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  P+++ + D+FEK+VPL++   +T+   +RA + NA I ++++A+   +GV+ASLNLP A+++  GD VP ++L+K+  + + GG++ +D L+  LP++  RN EIL E+VK LD EE +D  LK +FKDRW RTPS +L +  R E   ++ +LD+A  +D +V+  Y+     I +L + E  L  +IP +N + T + S+ ++ VL++L  + + +K  R  L  D+ ++        L+ AL+ D  +N++     +L+++      KV  ++  QE L   +    QE  KM  S+S +   R  VL  L    D + EL +NL+EG KFY DLT+ILLK+Q K  D  FARKTE++EL+KDLQ +I RE S
Sbjct:    1 MATFISVPLKKTSEVDLVKPLSKYIHNTYPSGEDQTEYCRAVEELNKLRKSAVGRPLDKHETSLETVMRYYDQLCSVEPKFPFTESQLCLTFTWKDAFDKGSIFGGSVKLALPSLGYEKTCVLFNIGALASQIASEQNLDNDEALKAASKFYQLASGAFSHIKDTVLSSLNRDPTIDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDALIAKLANQAADYYGDAFKQCQY---KDTLSKEVFPILAAKHCIMQAHAAYHQSVLAKQQKKFGEEIGRLQHASDLVKTVSSRYDEYVNVKDLADKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKASLVKPTPINVPLSQKYTDLFEKMVPLAIQQCLTVYNQRRAELINATIAQMRDATTFANGVLASLNLPAAIEDVSGDSVPQSILNKSKTIIEQGGIQTIDQLIRDLPELLQRNKEILDESVKFLDEEEATDNDLKAKFKDRWQRTPSTELYKPLRSEGNNFRSVLDKAIGADAVVKERYQCHREAIAILCKPEAELNAAIPSANPAKTMQGSE-VRIVLKSLLNQLDDVKKVREQLETDIKSVNFDMTTKFLT-ALAQDGAVNEEAISVTELDRIYGSYTFKVQENLKKQEDLINNIQTAHQEFSKMKQSNSEANL-REEVLKNLAAGHDNYIELVANLKEGTKFYNDLTEILLKYQCKCSDIVFARKTERDELLKDLQQSIAREPS 717          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Xenopus
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:NCBI gene;Acc:496474])

HSP 1 Score: 511.531 bits (1316), Expect = 2.311e-167
Identity = 273/725 (37.66%), Postives = 427/725 (58.90%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGE-EQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSV--KAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKS 2168
            M+  ISVP KK  E+  ++ +S Y+   Y   E Q+    A  E N +R   + +  DKHE++L  + RY DQ  ++E K P  E+ + + F W DAF K S+FG    L + S GYE+ CVLFNI A+ SQ+A   NL +D  LK A+K++Q A+G FS+++ +V + + R+PT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD Y D  K  Q      K  + ++  PI+A K     A A Y+Q+      + FGE+I R + + DL+KT S+R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  P+++ + D+FEK+VPL++   +T+   +RA + NA I ++++A+   +GV+ASLNLP A+++  GD VP ++L+K+  + + GG++ +D L+  LP++  RN EIL E+VK LD EE +D  LK +FKDRW RTPS +L +  R E   ++ +LD+A  +D +V+  Y+     I +L + E  L  +IP +N + T + S+ +  VL++L  + + +K  R  L  D+ ++        L+ AL+ D  +N++     +L+++      KV  ++  QE L   +    QE  KM  S+S +   R  VL  L    D + EL +NL+EG KFY DLT+ILLK+Q K  D  FARKTE++EL+KDLQ +I RE S
Sbjct:    1 MATFISVPLKKTSEVDLVKPLSKYIHNTYPSGEDQTEYCRAVEELNKLRKSAVGRPLDKHETSLETVMRYYDQLCSVEPKFPFTESQLCLTFTWKDAFDKGSIFGGSVKLALPSLGYEKTCVLFNIGALASQIASEQNLDNDEALKAASKFYQLASGAFSHIKDTVLSSLNRDPTIDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDALIAKLANQAADYYGDAFKQCQYKDTLSKYFYFQEVFPILAAKHCIMQAHAAYHQSVLAKQQKKFGEEIGRLQHASDLVKTVSSRYDEYVNVKDLADKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKASLVKPTPINVPLSQKYTDLFEKMVPLAIQQCLTVYNQRRAELINATIAQMRDATTFANGVLASLNLPAAIEDVSGDSVPQSILNKSKTIIEQGGIQTIDQLIRDLPELLQRNKEILDESVKFLDEEEATDNDLKAKFKDRWQRTPSTELYKPLRSEGNNFRSVLDKAIGADAVVKERYQCHREAIAILCKPEAELNAAIPSANPAKTMQGSEVV-SVLKSLLNQLDDVKKVREQLETDIKSVNFDMTTKFLT-ALAQDGAVNEEAISVTELDRIYGSYTFKVQENLKKQEDLINNIQTAHQEFSKMKQSNSEANL-REEVLKNLAAGHDNYIELVANLKEGTKFYNDLTEILLKYQCKCSDIVFARKTERDELLKDLQQSIAREPS 722          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Xenopus
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:NCBI gene;Acc:496474])

HSP 1 Score: 498.049 bits (1281), Expect = 6.934e-164
Identity = 267/716 (37.29%), Postives = 420/716 (58.66%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGE-EQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSV--KAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDL 2141
            M+  ISVP KK  E+  ++ +S Y+   Y   E Q+    A  E N +R   + +  DKHE++L  + RY DQ  ++E K P  E+ + + F W DAF K S+FG    L + S GYE+ CVLFNI A+ SQ+A   NL +D  LK A+K++Q A+G FS+++ +V + + R+PT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD Y D  K  Q      K  + ++  PI+A K     A A Y+Q+      + FGE+I R + + DL+KT S+R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  P+++ + D+FEK+VPL++   +T+   +RA + NA I ++++A+   +GV+ASLNLP A+++  GD VP ++L+K+  + + GG++ +D L+  LP++  RN EIL E+VK LD EE +D  LK +FKDRW RTPS +L +  R E   ++ +LD+A  +D +V+  Y+     I +L + E  L  +IP +N + T + S+ +  VL++L  + + +K  R  L  D+ ++        L+ AL+ D  +N++     +L+++      KV  ++  QE L   +    QE  KM  S+S +   R  VL  L    D + EL +NL+EG KFY DLT+ILLK+Q K  D  FARKTE++EL+K L
Sbjct:    1 MATFISVPLKKTSEVDLVKPLSKYIHNTYPSGEDQTEYCRAVEELNKLRKSAVGRPLDKHETSLETVMRYYDQLCSVEPKFPFTESQLCLTFTWKDAFDKGSIFGGSVKLALPSLGYEKTCVLFNIGALASQIASEQNLDNDEALKAASKFYQLASGAFSHIKDTVLSSLNRDPTIDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDALIAKLANQAADYYGDAFKQCQYKDTLSKYFYFQEVFPILAAKHCIMQAHAAYHQSVLAKQQKKFGEEIGRLQHASDLVKTVSSRYDEYVNVKDLADKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKASLVKPTPINVPLSQKYTDLFEKMVPLAIQQCLTVYNQRRAELINATIAQMRDATTFANGVLASLNLPAAIEDVSGDSVPQSILNKSKTIIEQGGIQTIDQLIRDLPELLQRNKEILDESVKFLDEEEATDNDLKAKFKDRWQRTPSTELYKPLRSEGNNFRSVLDKAIGADAVVKERYQCHREAIAILCKPEAELNAAIPSANPAKTMQGSEVV-SVLKSLLNQLDDVKKVREQLETDIKSVNFDMTTKFLT-ALAQDGAVNEEAISVTELDRIYGSYTFKVQENLKKQEDLINNIQTAHQEFSKMKQSNSEANL-REEVLKNLAAGHDNYIELVANLKEGTKFYNDLTEILLKYQCKCSDIVFARKTERDELLKTL 713          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Xenopus
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:NCBI gene;Acc:496474])

HSP 1 Score: 431.409 bits (1108), Expect = 3.549e-139
Identity = 246/712 (34.55%), Postives = 391/712 (54.92%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGE-EQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMK 2135
            M+  ISVP KK  E+  ++ +S Y+   Y   E Q+    A  E N +R   + +  DKHE++L  + RY DQ  ++E K P  E+ + + F W DAF K S+FG  GS+K+ +G                                           FS+++ +V + + R+PT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD Y D  K  Q    K    K+  PI+A K     A A Y+Q+      + FGE+I R + + DL+KT S+R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  P+++ + D+FEK+VPL++   +T+   +RA + NA I ++++A+   +GV+ASLNLP A+++  GD VP ++L+K+  + + GG++ +D L+  LP++  RN EIL E+VK LD EE +D  LK +FKDRW RTPS +L +  R E   ++ +LD+A  +D +V+  Y+     I +L + E  L  +IP +N + T + S+ +  VL++L  + + +K  R  L  D+ ++        L+ AL+ D  +N++     +L+++      KV  ++  QE L   +    QE  KM  S+S +   R  VL  L    D + EL +NL+EG KFY DLT+ILLK+Q K  D  FARKTE++EL+K
Sbjct:    1 MATFISVPLKKTSEVDLVKPLSKYIHNTYPSGEDQTEYCRAVEELNKLRKSAVGRPLDKHETSLETVMRYYDQLCSVEPKFPFTESQLCLTFTWKDAFDKGSIFG--GSVKLGNGA------------------------------------------FSHIKDTVLSSLNRDPTIDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDALIAKLANQAADYYGDAFKQCQY---KDTLSKEVFPILAAKHCIMQAHAAYHQSVLAKQQKKFGEEIGRLQHASDLVKTVSSRYDEYVNVKDLADKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKASLVKPTPINVPLSQKYTDLFEKMVPLAIQQCLTVYNQRRAELINATIAQMRDATTFANGVLASLNLPAAIEDVSGDSVPQSILNKSKTIIEQGGIQTIDQLIRDLPELLQRNKEILDESVKFLDEEEATDNDLKAKFKDRWQRTPSTELYKPLRSEGNNFRSVLDKAIGADAVVKERYQCHREAIAILCKPEAELNAAIPSANPAKTMQGSEVV-SVLKSLLNQLDDVKKVREQLETDIKSVNFDMTTKFLT-ALAQDGAVNEEAISVTELDRIYGSYTFKVQENLKKQEDLINNIQTAHQEFSKMKQSNSEANL-REEVLKNLAAGHDNYIELVANLKEGTKFYNDLTEILLKYQCKCSDIVFARKTERDELLK 662          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Xenopus
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:NCBI gene;Acc:496474])

HSP 1 Score: 411.379 bits (1056), Expect = 7.659e-130
Identity = 242/723 (33.47%), Postives = 383/723 (52.97%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGE-EQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKS 2168
            M+  ISVP KK  E+  ++ +S Y+   Y   E Q+    A  E N +R   + +  DKHE++L  + RY DQ  ++E K P  E+                        ++ASG +  I                                          + +V + + R+PT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD Y D  K  Q    K    K+  PI+A K     A A Y+Q+      + FGE+I R + + DL+KT S+R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  P+++ + D+FEK+VPL++   +T+   +RA + NA I ++++A+   +GV+ASLNLP A+++  GD VP ++L+K+  + + GG++ +D L+  LP++  RN EIL E+VK LD EE +D  LK +FKDRW RTPS +L +  R E   ++ +LD+A  +D +V+  Y+     I +L + E  L  +IP +N + T + S+ +  VL++L  + + +K  R  L  D+ ++        L+ AL+ D  +N++     +L+++      KV  ++  QE L   +    QE  KM  S+S +   R  VL  L    D + EL +NL+EG KFY DLT+ILLK+Q K  D  FARKTE++EL+KDLQ +I RE S
Sbjct:    1 MATFISVPLKKTSEVDLVKPLSKYIHNTYPSGEDQTEYCRAVEELNKLRKSAVGRPLDKHETSLETVMRYYDQLCSVEPKFPFTES------------------------QLASGAFSHI------------------------------------------KDTVLSSLNRDPTIDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDALIAKLANQAADYYGDAFKQCQY---KDTLSKEVFPILAAKHCIMQAHAAYHQSVLAKQQKKFGEEIGRLQHASDLVKTVSSRYDEYVNVKDLADKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKASLVKPTPINVPLSQKYTDLFEKMVPLAIQQCLTVYNQRRAELINATIAQMRDATTFANGVLASLNLPAAIEDVSGDSVPQSILNKSKTIIEQGGIQTIDQLIRDLPELLQRNKEILDESVKFLDEEEATDNDLKAKFKDRWQRTPSTELYKPLRSEGNNFRSVLDKAIGADAVVKERYQCHREAIAILCKPEAELNAAIPSANPAKTMQGSEVV-SVLKSLLNQLDDVKKVREQLETDIKSVNFDMTTKFLT-ALAQDGAVNEEAISVTELDRIYGSYTFKVQENLKKQEDLINNIQTAHQEFSKMKQSNSEANL-REEVLKNLAAGHDNYIELVANLKEGTKFYNDLTEILLKYQCKCSDIVFARKTERDELLKDLQQSIAREPS 651          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Mouse
Match: Pdcd6ip (programmed cell death 6 interacting protein [Source:MGI Symbol;Acc:MGI:1333753])

HSP 1 Score: 516.538 bits (1329), Expect = 1.784e-169
Identity = 277/722 (38.37%), Postives = 432/722 (59.83%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVRE 2162
            M+  I V  KK  E+   + +  ++++ Y  G E+Q+    A  E + +R   L +  DKHE  L  L RY DQ  ++E K P +EN + + F W DAF K SLFG    L +AS GYE+ CVLFN AA+ SQ+A   NL +D GLKTAAK +Q A+G F +++ +V + + REPT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD + D  K  Q    K   PK+  P +A KQ    A AEY+Q+      + FGE+I+R + + +L+K  ++R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  P+++ F D+FEK+VP+S+  ++ +   ++A + N  I +++EA+   +GV+ASLNLP A+++  GD VP ++L+K+  V + GG++ +D L+  LP++  RN EIL+E+++LLD EE +D  L+ +FKDRW RTPS  L +  R E  K++ +LD+A  +D  V+  Y+     I LL + E  L  +IP +N + T + S+ +  VL++L +  +++K  R  L  DL ++        L+ AL+ D  +N++     +L+++   +  KV  S+  QE L   +    QE  KM  S++ +   R  VL  L  A+D F EL +NL+EG KFY +LT+IL++FQNK  D  FARKTE++EL+KDLQ +I RE
Sbjct:    1 MASFIWVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRSALGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKTAAKQYQFASGAFLHIKDTVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQY---KDTLPKEVFPTLAAKQCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKNVASRYDEYVNVKDFSDKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKATLVKPTPVNVPVSQKFTDLFEKMVPVSVQQSLAVFSQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSTSVVEQGGIQTVDQLIKELPELLQRNREILEESLRLLDEEEATDNDLRAKFKDRWQRTPSNDLYKPLRAEGAKFRAVLDKAVQADGQVKERYQSHRDTIALLCKPEPELNAAIPSANPAKTMQGSEVV-SVLKSLLSNLDEIKKERESLENDLKSVNFDMTSKFLT-ALAQDGVINEEALSVTELDRIYGGLTSKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANL-REEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIARE 716          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Mouse
Match: Pdcd6ip (programmed cell death 6 interacting protein [Source:MGI Symbol;Acc:MGI:1333753])

HSP 1 Score: 513.072 bits (1320), Expect = 5.237e-168
Identity = 275/724 (37.98%), Postives = 432/724 (59.67%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSV--KAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVRE 2162
            M+  I V  KK  E+   + +  ++++ Y  G E+Q+    A  E + +R   L +  DKHE  L  L RY DQ  ++E K P +EN + + F W DAF K SLFG    L +AS GYE+ CVLFN AA+ SQ+A   NL +D GLKTAAK +Q A+G F +++ +V + + REPT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD + D  K  Q      K  + ++  P +A KQ    A AEY+Q+      + FGE+I+R + + +L+K  ++R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  P+++ F D+FEK+VP+S+  ++ +   ++A + N  I +++EA+   +GV+ASLNLP A+++  GD VP ++L+K+  V + GG++ +D L+  LP++  RN EIL+E+++LLD EE +D  L+ +FKDRW RTPS  L +  R E  K++ +LD+A  +D  V+  Y+     I LL + E  L  +IP +N + T + S+ +  VL++L +  +++K  R  L  DL ++        L+ AL+ D  +N++     +L+++   +  KV  S+  QE L   +    QE  KM  S++ +   R  VL  L  A+D F EL +NL+EG KFY +LT+IL++FQNK  D  FARKTE++EL+KDLQ +I RE
Sbjct:    1 MASFIWVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRSALGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKTAAKQYQFASGAFLHIKDTVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKYFYFQEVFPTLAAKQCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKNVASRYDEYVNVKDFSDKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKATLVKPTPVNVPVSQKFTDLFEKMVPVSVQQSLAVFSQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSTSVVEQGGIQTVDQLIKELPELLQRNREILEESLRLLDEEEATDNDLRAKFKDRWQRTPSNDLYKPLRAEGAKFRAVLDKAVQADGQVKERYQSHRDTIALLCKPEPELNAAIPSANPAKTMQGSEVV-SVLKSLLSNLDEIKKERESLENDLKSVNFDMTSKFLT-ALAQDGVINEEALSVTELDRIYGGLTSKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANL-REEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIARE 721          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Mouse
Match: Ptpn23 (protein tyrosine phosphatase, non-receptor type 23 [Source:MGI Symbol;Acc:MGI:2144837])

HSP 1 Score: 164.851 bits (416), Expect = 6.926e-41
Identity = 173/731 (23.67%), Postives = 337/731 (46.10%), Query Frame = 3
Query:   12 PMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENG-VRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNV-IMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIW---PKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRA-GQ----KFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-PGALDNTRG-DEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRT-PS---GKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNL-ETSSIGNTLSNALSSDPELNQDQFVDGQLNK---LLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELM 2132
            P   +I +  K+  +  F   +  +V + YGE  ++ N     +   +R   + ++    E   + L +YL Q   L+S++P+       +   W + F+  S+      +K     YE+ C+L+N+ A++S +        + G+K +  +FQ AAG F+YLR   P       + D++   L+ LNV +ML QAQE +  K++ D+ K   +A+I  QV D Y +  + ++     ++     KDW  +V  K   + A+A  +  K     Q FGE+++ F+ ++D +  A   A GQ    +   R  ++ +  +  + +K+N+ IYH+++P + TL  V    L + + + NP +      DIF K+VP++ H A +L   ++A +    + ++++ +  L   M S+ L P  +DN    + +P  L+ K A   VR D  V+ L   +  L  V T     L++   LL+ +E  +++L++      +   PS    +L E  R E  KY  + ++A  ++  +         ++RLLS   + ++ ++P   + +      ++ + L+ + A+ ++++  R  L Q L  L +   I  +L     S+      +  + QL K   L   + + ++A  N    LT    +   +    S       S L  L+ +++ + +L    +EG  FY DL   +     + Q  C A++  +++L+
Sbjct:    5 PRMPMIWLDLKEAGDFHFQSAVKKFVLKNYGENPEAYNEE-LKKLELLRQNAI-RVARDFEGC-SVLRKYLGQLHYLQSRVPMGSGQEAAVAVTWTEIFSGKSV--SHEDIK-----YEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAF----SVDMSRQILT-LNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFAMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPV-NPTDPAVTGPDIFAKLVPMAAHEASSLYSEEKAKLLREMLAKIEDKNEVLDQFMDSMQLDPETVDNLDAYNHIPPQLMEKCAALSVRPD-TVKNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELQEQKLQETLGQAGAGPGPSVAKAELAEVRR-EWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAALP---TPALTPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSE----MKKLFEEQLKKYDQLKVYLEQNLAAQDNVLRALTEANVQYAAVRRVLSELDQKWNSTLQTLVASYEAYEDLMKKSQEGKDFYADLESKVATLLERAQSICRAQEAARQQLL 710          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Mouse
Match: Rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:MGI Symbol;Acc:MGI:1289234])

HSP 1 Score: 91.6633 bits (226), Expect = 1.959e-18
Identity = 72/264 (27.27%), Postives = 121/264 (45.83%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDG-----NIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQA 800
            LI +  K+  E+ F  V   ++ E Y E+      +   +  ++R    C+   + E+ +  L  Y  Q   +ES+       + + F W D+F    +  +   L+ AS       VLFNI A+Y+Q+    N    +GL++A   FQ+AAG+ +YL+ +  +     P+YD++   LS L  +MLAQAQE ++ K      ++       +A+   +VA+ Y      M    VK   P  W  +   K   Y A+A Y+ A
Sbjct:  112 LIPLGLKETKEVDFSIVFKDFILEHYSEDSYLYEDD-IADLMDLRQA--CRTPSRDEAGVELLMSYFIQLGFVESRFFPPTRHMGLLFTWYDSFTGVPVSQQTLLLEKAS-------VLFNIGALYTQIGTRCNRQTQAGLESAVDAFQRAAGVLNYLKETFTHT----PSYDMSPAMLSVLVKMMLAQAQESVFEKVCLPGIQNEFFVLVKVAQEAAKVAEAYRQLHAAMSQEPVKENIPYSWASVAYVKAYHYGALAHYFAA 361          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Mouse
Match: Rhpn2 (rhophilin, Rho GTPase binding protein 2 [Source:MGI Symbol;Acc:MGI:1289234])

HSP 1 Score: 91.6633 bits (226), Expect = 1.959e-18
Identity = 72/264 (27.27%), Postives = 121/264 (45.83%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDG-----NIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQA 800
            LI +  K+  E+ F  V   ++ E Y E+      +   +  ++R    C+   + E+ +  L  Y  Q   +ES+       + + F W D+F    +  +   L+ AS       VLFNI A+Y+Q+    N    +GL++A   FQ+AAG+ +YL+ +  +     P+YD++   LS L  +MLAQAQE ++ K      ++       +A+   +VA+ Y      M    VK   P  W  +   K   Y A+A Y+ A
Sbjct:  112 LIPLGLKETKEVDFSIVFKDFILEHYSEDSYLYEDD-IADLMDLRQA--CRTPSRDEAGVELLMSYFIQLGFVESRFFPPTRHMGLLFTWYDSFTGVPVSQQTLLLEKAS-------VLFNIGALYTQIGTRCNRQTQAGLESAVDAFQRAAGVLNYLKETFTHT----PSYDMSPAMLSVLVKMMLAQAQESVFEKVCLPGIQNEFFVLVKVAQEAAKVAEAYRQLHAAMSQEPVKENIPYSWASVAYVKAYHYGALAHYFAA 361          
BLAST of Programmed cell death 6-interacting protein vs. UniProt/SwissProt
Match: sp|Q9QZA2|PDC6I_RAT (Programmed cell death 6-interacting protein OS=Rattus norvegicus OX=10116 GN=Pdcd6ip PE=1 SV=2)

HSP 1 Score: 518.079 bits (1333), Expect = 3.682e-169
Identity = 284/750 (37.87%), Postives = 442/750 (58.93%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSV--KAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATSGGTELSAQQP 2240
            M+  I V  KK  E+   + +  ++++ Y  G E+Q+    A  E + +R   L +  DKHE  L  L RY DQ  ++E K P +EN + + F W DAF K SLFG    L +AS GYE+ CVLFN AA+ SQ+A   NL +D GLKTAAK +Q A+G F +++ +V + + REPT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD + D  K  Q      K  + ++  P +A KQ    A AEY+Q+      + FGE+I+R + + +L+K  ++R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  PI++ F D+FEK+VP+S+  ++ +   ++A + N  I +++EA+   +GV+ASLNLP A+++  GD VP ++L+K+  V + GG++ +D L+  LP++  RN EIL+E+++LLD EE +D  L+ +FKDRW RTPS  L +  R E  K++ +LD+A  +D  V+  Y+     I LL + E  L  +IP +N + T + S+ +  VL++L +  +++K  R GL  DL ++        L+ AL+ D  +N++     +L+++   +  KV  S+  QE L   +    QE  KM  S+S +   R  VL  L  A+D F EL +NL+EG KFY +LT+IL++FQNK  D  FARKTE++EL+KDLQ +I RE S    I     Q++  G   +A  P
Sbjct:    1 MASFIWVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRSALGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKTAAKQYQFASGAFLHIKDTVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDALPKYFYFQEVFPTLAAKQCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKNVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKPTPVNVPISQKFTDLFEKMVPVSVQQSLAVFSQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSTAVVEQGGIQTVDQLIKELPELLQRNREILEESLRLLDEEEATDNDLRAKFKDRWQRTPSNDLYKPLRAEGAKFRAVLDKAVQADGQVKERYQSHRDTIALLCKPEPELNAAIPSANPAKTMQGSEVVN-VLKSLLSNLDEIKKEREGLENDLKSVNFDMTSKFLT-ALAQDGVINEEALSVTELDRIYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNSEASL-REEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPS-IPPPAYQSSPAGGHATAPTP 746          
BLAST of Programmed cell death 6-interacting protein vs. UniProt/SwissProt
Match: sp|Q8WUM4|PDC6I_HUMAN (Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1)

HSP 1 Score: 516.924 bits (1330), Expect = 1.011e-168
Identity = 281/740 (37.97%), Postives = 440/740 (59.46%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATSGG 2216
            M+  ISV  KK  E+   + +  ++++ Y  G E+Q+    A  E + +R   + +  DKHE  L  L RY DQ  ++E K P +EN + + F W DAF K SLFG    L +AS GYE+ CVLFN AA+ SQ+A   NL +D GLK AAK++Q A+G F +++ +V + + REPT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD + D  K  Q    K   PK+  P++A K     A AEY+Q+      + FGE+I+R + + +L+KT ++R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  PI++ F D+FEK+VP+S+  ++     ++A + N  I +++EA+   +GV+ASLNLP A+++  GD VP ++L+K+  V + GG++ +D L+  LP++  RN EIL E+++LLD EE +D  L+ +FK+RW RTPS +L +  R E   ++ +LD+A  +D  V+  Y+     I LL + E  L  +IP +N + T + S+ +  VL++L +  +++K  R GL  DL ++        L+ AL+ D  +N++     +L+++   +  KV  S+  QE L   +    QE  KM  S++ +   R  VL  L  A+D F EL +NL+EG KFY +LT+IL++FQNK  D  FARKTE++EL+KDLQ +I RE S A  I     Q++  G
Sbjct:    1 MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQY---KDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVN-VLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLT-ALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANL-REEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPS-APSIPTPAYQSSPAG 733          
BLAST of Programmed cell death 6-interacting protein vs. UniProt/SwissProt
Match: sp|Q9WU78|PDC6I_MOUSE (Programmed cell death 6-interacting protein OS=Mus musculus OX=10090 GN=Pdcd6ip PE=1 SV=3)

HSP 1 Score: 516.538 bits (1329), Expect = 1.248e-168
Identity = 277/722 (38.37%), Postives = 432/722 (59.83%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQM----QEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVRE 2162
            M+  I V  KK  E+   + +  ++++ Y  G E+Q+    A  E + +R   L +  DKHE  L  L RY DQ  ++E K P +EN + + F W DAF K SLFG    L +AS GYE+ CVLFN AA+ SQ+A   NL +D GLKTAAK +Q A+G F +++ +V + + REPT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD + D  K  Q    K   PK+  P +A KQ    A AEY+Q+      + FGE+I+R + + +L+K  ++R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L +   +  P+++ F D+FEK+VP+S+  ++ +   ++A + N  I +++EA+   +GV+ASLNLP A+++  GD VP ++L+K+  V + GG++ +D L+  LP++  RN EIL+E+++LLD EE +D  L+ +FKDRW RTPS  L +  R E  K++ +LD+A  +D  V+  Y+     I LL + E  L  +IP +N + T + S+ +  VL++L +  +++K  R  L  DL ++        L+ AL+ D  +N++     +L+++   +  KV  S+  QE L   +    QE  KM  S++ +   R  VL  L  A+D F EL +NL+EG KFY +LT+IL++FQNK  D  FARKTE++EL+KDLQ +I RE
Sbjct:    1 MASFIWVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRSALGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKTAAKQYQFASGAFLHIKDTVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQY---KDTLPKEVFPTLAAKQCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKNVASRYDEYVNVKDFSDKINRALTAAKKDNDFIYHDRVPDLKDLDPIGKATLVKPTPVNVPVSQKFTDLFEKMVPVSVQQSLAVFSQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSTSVVEQGGIQTVDQLIKELPELLQRNREILEESLRLLDEEEATDNDLRAKFKDRWQRTPSNDLYKPLRAEGAKFRAVLDKAVQADGQVKERYQSHRDTIALLCKPEPELNAAIPSANPAKTMQGSEVV-SVLKSLLSNLDEIKKERESLENDLKSVNFDMTSKFLT-ALAQDGVINEEALSVTELDRIYGGLTSKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANL-REEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIARE 716          
BLAST of Programmed cell death 6-interacting protein vs. UniProt/SwissProt
Match: sp|Q9W6C5|PDC6I_XENLA (Programmed cell death 6-interacting protein OS=Xenopus laevis OX=8355 GN=pdcd6ip PE=1 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 9.464e-165
Identity = 271/723 (37.48%), Postives = 428/723 (59.20%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGE-EQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKL----TAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKS 2168
            M+  ISVP KK  E+  ++ +S Y+   Y   E Q+    A  E N +R   + +  DKHE++L  + RY DQ  ++E K P  E+ + + F W DAF K S+FG    L + S GYE+ CVLFNI A+ SQ+A   NL +D  LK A+K++Q A+G FS+++ +V + + R+PT D++ DT+  L++IMLAQAQE+ + KA RD  KD  IAK+  Q AD Y D  K  Q    K    K+  PI+A K     A AEY+Q+      + FGE+I R + + DL+KT S+R  +    +   +++ R L   +K+N+ IYHD +PD+  L  V K  L +   +  P+++ + D+FEK+VPL++   +++   +++ + N+ I ++++A+   +GV+ASLNLP A+++  GD +P ++L+K+  V + GG++ +  L+  LP++  RN EIL+E++K LD EE +D  LK +FKDRW RTPS +L +  R E   ++ +LD+A  +D +V+  Y+     I +L + E  L  +IP +N + T + S+ +  VL++L  + + +K  R  L  D+ ++        L+ AL+ D  +N++     +L+++      KV  ++  QE L     +  QE  KM  S+S +   R  VL  L +  D + EL +NL+EG KFY DLTDILLKFQ K  D  FARKTE++EL+KD+Q +I RE S
Sbjct:    1 MATFISVPLKKTSEVDLVKPLSKYIHNTYPSGEDQTEYCRAVDELNKLRKSAVGRPLDKHETSLETVMRYYDQLCSVEPKFPFTESQLCLTFTWKDAFDKGSIFGGSVKLALPSLGYEKTCVLFNIGALASQIASEQNLDNDEALKAASKFYQLASGAFSHIKDTVLSSLNRDPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAVIAKLANQAADYYGDAFKQCQY---KDTLSKEVFPILAAKHCIMQAHAEYHQSVLAKQQKKFGEEIGRLQHASDLVKTVSSRYDEYVNVKDLADKINRALTAAKKDNDFIYHDRVPDLKDLDPVGKASLVKSTPVNVPLSQKYTDLFEKMVPLAVQQCLSVYNQRKSELINSTIAQMRDATIFANGVLASLNLPAAVEDVSGDSIPQSILNKSKTVIEQGGIQTIGQLIRDLPELLQRNKEILEESLKFLDEEEATDNDLKAKFKDRWQRTPSTELYKPLRSEGSNFRNVLDKAIGADAVVKERYQSHREAIVILCKPEAELNAAIPSANPAKTMQGSEVVT-VLKSLLNKLDDMKKEREQLENDIKSVNFDMTTKFLT-ALAQDGAVNEEAISVTELDQIYGSYTYKVQENLKKQEDLLNNIQSAHQEFSKMKQSNSEANL-REEVLKNLAVGHDNYIELVANLKEGTKFYNDLTDILLKFQCKCSDIVFARKTERDELLKDIQQSIAREPS 717          
BLAST of Programmed cell death 6-interacting protein vs. UniProt/SwissProt
Match: sp|P34552|ALXA_CAEEL (Apoptosis-linked gene 2-interacting protein X 1 OS=Caenorhabditis elegans OX=6239 GN=alx-1 PE=2 SV=3)

HSP 1 Score: 505.753 bits (1301), Expect = 3.053e-164
Identity = 269/723 (37.21%), Postives = 434/723 (60.03%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIY--GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFR------SELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDN-TRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSD---SSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIV 2156
             +S P K   E+  ++ +++Y+  +Y   +  +S  A A  E N +RSK  C+  DKH+S L+ LTRY DQ VA+E+KI I+     + FKW DAF K SLF  + SL ++ G +ER  VLFNI ++ SQ+        D  +K +AK FQQ+AG+F+ LR  V  ++Q+EPT DL  DTL+AL+ +M AQAQE IY K  +D  K  ++ KI  QVA+ Y++  K+M  + V+ +W KDW  IV+GK   Y A+A+Y+Q++ CG ++  GEQ+SR  +S+ L  TA     QK+  R           + +     +K+N+ IYH+ + D  TL  + K +LA+   ++ P+   FRD+F  +VP+ +H+AM     ++A + N E  R++EA+  ++GV+ASLNLP ALD+ T  + +P++L  K+A ++++GG  ++  L + LP +  RN +IL E  ++L+ E+ SD  ++ Q   +W+R  S +LT     EI KY+ +L  A ++D +V+  ++   + I LLS+NE  L+ SIP   + +TGE +D++++ LR   ++  ++ + R  L ++L N     I N    A++ +  +N++     ++ ++   ++ +V +S+++QE L  Q+Q        +   SS+G +R  +L  L  A D + ELK+NLEEG KFY DLT IL++ Q KV DF FAR+TEKE+LM+ LQ +IV
Sbjct:    6 FLSAPLKSTNEVDLVKPLTSYIDNVYNTSDNNRSDVAEAVQELNKLRSKACCQPLDKHQSALDVLTRYYDQLVAIENKIIISATQNPVVFKWKDAFDKGSLFSSRASLSLSDGSFERAAVLFNIGSLMSQIGAAQQFHTDDEIKVSAKLFQQSAGVFARLRDVVLGMVQQEPTPDLMPDTLAALSALMTAQAQEAIYIKGHKDKMKATSMVKISAQVAEFYSEAQKMMSKDIVRGLWDKDWSAIVSGKNLAYQALAQYHQSEVCGEARQIGEQLSRLAESLKLFDTA-----QKYLPRDITGIWDIYPSVSKAHAAAKKDNDFIYHEKVSDFRTLPTLPKAVLAKPTPMQTPMTPSFRDMFAVLVPVQVHNAMQSYDARKAELVNMETVRMREATQLMNGVLASLNLPAALDDVTSTETLPESLKLKSAKLKQNGGSSEIMRLFSELPTLYQRNEDILTETSRILNEEKESDDTMRKQLGTKWTRMSSEQLTGPLVTEIGKYRGILHTASNADKMVKEKFESHRQGIELLSKNESELRSSIPGQTAHATGE-TDTVRQ-LRQFMSQWNEVTTDRELLEKELKN-TNCDIANDFLKAMAENQLINEEHISKEKIAQIFGDLKRRVQSSLDTQETLMNQIQAANNTFTGEKTGSSTGAERERILKMLAQASDAYVELKANLEEGTKFYNDLTPILVRLQQKVSDFAFARQTEKEDLMRQLQLSIV 720          
BLAST of Programmed cell death 6-interacting protein vs. TrEMBL
Match: A0A2T7PRN0 (BRO1 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_03020 PE=4 SV=1)

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 317/718 (44.15%), Postives = 478/718 (66.57%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQ----EKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIV 2156
            M+ ++++P KK YE+  I+ +  +++  + +       +A  EFN +R+ M+ K  DKHES L  L RY DQ VA+E+K+PIAEN +R+ FKW DAF + S  G K +L IASG YE++C+LFNIAA+ SQ+A   N  +D GLK A KYFQQ++GI  +L+  V + +Q+EPT DLN DTLS+L+ +MLAQAQE IY KA  D  K+  IAK+  Q ++LYAD +KLMQL S++ +WP+DW+  V  KQA +HAMAE+YQ+     S+ +G++I+R + +++LM  +  R G  F FR+EL +++R LE  +K+N+ IYHD IPD+ +L  + K ++A+   L +P++  F D+FEKIVPL +  A+T  +N+++ + N EI RL+EA+  ++ V+ASLNLP AL++  G +VP ++L KA  ++  GGV  ++ L+  LPD+ TRN EIL E+++ LD+EE SD QL++QFK+RW+RTPS  LT+  R E  KY+ +LD A  +D IVR  Y    + I LLS+    L++S+P + +    + S  +KE LR LC E E +K+ R  +I++        + +    AL++D  ++++     +L+++ AP+R++VS SI+ QE + A++Q    E C+  +S+ S+   R ++L  L   FD + ELK+NLEEG KFY DLT +L++ Q K+ DFCFARKTEK+ELM DLQ  IV
Sbjct:    1 MATMLAIPLKKTYEVDLIKPLRNFIQSTFTQADPEYYNHALQEFNKLRNLMITKSVDKHESALEVLCRYHDQLVAIENKLPIAENQIRVQFKWRDAFDEGSFLGGKRTLAIASGAYEKVCMLFNIAALQSQIASVQNFENDEGLKLAVKYFQQSSGILGHLKDIVLSHLQQEPTPDLNPDTLSSLSAVMLAQAQESIYRKATLDRMKESMIAKLAYQCSELYADAMKLMQLTSIRDLWPRDWLATVVMKQAAFHAMAEFYQSVVAQQSKSYGQEIARLQHAVELMNASQQRGGATFAFRNELGKIQRALEAAKKDNDFIYHDKIPDLKSLEPIGKAVVAKPTPLASPLSPKFTDLFEKIVPLPVFEALTAFENRKSQLANMEIGRLREATALINSVLASLNLPAALEDLSGAKVPQSVLDKAKQMQDLGGVALIESLITALPDLLTRNREILDESIRTLDDEEKSDTQLREQFKERWTRTPSAVLTKPMRDEASKYRTILDTAIQADRIVREKYNSHKQAITLLSKPPGELEKSLPAAGNVGALQGSAVVKE-LRKLCEEVETIKAERE-VIENEIKEAKFDMTSKFFAALAADGAIDEEALSVSELDRVYAPLRQQVSDSIHKQETILARIQNANTEFCQAKSSNQSAA-QREALLKDLAAGFDNYMELKNNLEEGTKFYNDLTPLLVRLQTKINDFCFARKTEKDELMADLQKQIV 715          
BLAST of Programmed cell death 6-interacting protein vs. TrEMBL
Match: K1P3Q5 (Programmed cell death 6-interacting protein OS=Crassostrea gigas OX=29159 GN=CGI_10013051 PE=4 SV=1)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 325/788 (41.24%), Postives = 503/788 (63.83%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLEN-PINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQ----EKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNS--NIQAT------------------SGGTELSAQQPVQSEVPARPPPTYQTQNSGQP 2303
            M+  ++VP K+  E++ I+ + ++++  + + +     +A  EF+ +R+ M+ K  DKHES L  L RY DQ  A+E+K+PIAEN +R++FKW +AF K+SLFG K  L IASG YE++C+LFNIAA+ SQ+AE  N   D GLKT+AKYFQ AAGIF +L+  V + +Q+EPT DL+ DTL+AL+ +M+AQAQE IY KA  D  K+  +AKI  Q ++L++D +KLMQL S+K +WPKDW+P+VA KQA YH MAE+YQ       + +GEQI+ F+K+ +L+  A +R G  F F++E  R++REL+   K+N+ IYHD IPD+ TL  + K  +A+  +    P+++ F D+FEK+VP+ ++ A++  +N++  + N EI RL+E +  ++ ++ASLNLP AL++  G +VP +++ KA  ++  GG++ L+ L+N LP++  RN EIL E +K++D+E  SD QL++QFK+RWSRTPS KLT+  R E  KY+ +LD A ++D IV+  +++  + I LLS++   +++++P    +   E S  +++ LR L  E E +K+ R  +I++        + +   +AL+SD  +N++     +L+++  P+R++V+ S+  Q+ + +Q+Q    E C+   SD  SG  R ++L  L   FD F ELK+NLEEG KFY DLT +L++ QNK+ DFCFARKTEK+ELM DLQ +I  + +   P   S  N  AT                  S G   +A  P  +      PP Y +  SG P
Sbjct:    1 MATFLAVPLKQTQEVELIKPLRSFIQNTFSQVEPDDYNHALNEFSKLRNLMIAKSVDKHESALEVLYRYYDQLCAIENKLPIAENQIRVNFKWRNAFDKESLFGGKQILGIASGAYEKVCILFNIAALQSQIAEVQNHDSDEGLKTSAKYFQMAAGIFGHLKDIVLSHVQQEPTPDLSPDTLNALSALMVAQAQEAIYRKAAADKMKEAMVAKIAHQCSELFSDAMKLMQLASLKDLWPKDWLPLVACKQAAYHGMAEFYQGCVAQQHKTYGEQIAHFQKANELLTAAQSRGGATFAFKNEQGRIQRELQAARKDNDFIYHDKIPDLKTLPAIGKAAIAKPTAFPTKPMSEKFTDLFEKLVPIPVYEALSAFENRKTQIVNTEIGRLREQTQLMNSILASLNLPAALEDLSGQKVPQSVIEKAQQIKDIGGIQFLNKLMNDLPELLQRNREILNECIKMVDDEAASDIQLREQFKERWSRTPSDKLTQPMRDESMKYKQILDTAINADRIVQEKFQKHKQAIDLLSKSPGEIEKALPSGGGAHASESSGVVQK-LRKLMEEVETIKAERE-VIENEFKEAKFDMTSKFFSALASDGAINEEMLSASELDRIYGPLRQQVNESLQKQDSVMSQVQTTNMEFCQAKASD-QSGAQREAMLKDLAAGFDMFMELKNNLEEGTKFYNDLTPLLVRLQNKISDFCFARKTEKDELMADLQKSIANQPTGPAPPPPSYQNPTATTQNRAPPARPPPPQFSTASSGPPPTASTPSGAPSSQAGPPPYSSAPSGAP 785          
BLAST of Programmed cell death 6-interacting protein vs. TrEMBL
Match: A0A433U8B5 (BRO1 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_002160 PE=4 SV=1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 317/727 (43.60%), Postives = 475/727 (65.34%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQ----EKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPI 2183
            M+  ISVP KK YE+  ++ +  +++  + +        A  +FN +R+  + K  DKHES L+ L RY DQ VA+E+K+PIAEN +R+ FKW DAF + S  G K +L IASG YE++C+LFNIA++ SQ+A   N   + G+K   K+FQQA GI+ +L+  V + +Q++PT DLN DTLSAL+ IMLAQAQE IY KA +D  K+G IAK+  Q ++LYAD +KLMQL S++ +WPK+W+PIV  KQA +H MAE+YQ+     ++ +GE+I+R + + +L+  + +R G  F FR E  R++R LE  +K+N+ IYHD IPD+ +L  + K ++A+   L  P++  F D+FEKIVPL +H A+T  +N+++ +   E  RL+EA+  ++ V+ASLNLP AL++  G+ VP +L+ KA  +++ GG+ K+D L++ LPD+  RN EIL E++K LD+EE SD+QLK+QFK+RWSRT S  LT   R E  KY+ +LD A  +D IV+  Y      I LLS+ +  L+ ++P ++++++ + SD +K  LR L  +   +K+ R+ +I+         +      AL+ D  +N++     +L +  +P+RE+VS SI+ QE + +Q+Q    E C    S + +G  R ++L  L   FD F ELK+NLEEG KFY DLT +L++ Q K+ DFCFARKTEK+ELM DLQ AIV   S+A P+
Sbjct:    1 MASFISVPLKKTYEVDLVKPLRTFIQNTFSQANPDDYNQALADFNKLRNTTVVKSVDKHESALDVLYRYYDQLVAIENKLPIAENQIRVQFKWRDAFDEGSFLGGKRNLAIASGAYEKVCMLFNIASLQSQIAAIQNHESNDGMKLTVKFFQQACGIYGHLKDIVLSHVQQDPTPDLNPDTLSALSAIMLAQAQESIYRKATQDKMKEGTIAKLAYQTSELYADAMKLMQLGSIRDLWPKEWLPIVGMKQAAFHGMAEFYQSCVAQQAKTYGEEIARLQHAQELLNASQSRGGAIFTFRQEQGRVQRALEQAKKDNDFIYHDKIPDLKSLPSIGKAVVAKPAPLPQPMSSRFSDLFEKIVPLPVHEALTAFENRKSQIVAMESGRLREATQLINSVLASLNLPAALEDLAGERVPQSLMDKAGQIQELGGLAKIDQLMSDLPDLLNRNREILTESMKALDDEERSDQQLKEQFKERWSRTASSALTRPMRDEANKYKSILDTAIQADHIVKEKYNTHKNAIALLSKPKAELESTLPAASAAASLQGSDVVKR-LRELIEQVNTIKAERD-VIESEVKDAKFDMSAKFFAALAQDGIINEEAISASELERQYSPLREQVSDSIHRQEIVLSQIQNANTEFCTA-KSSNQTGVQRETMLKDLAAGFDSFMELKANLEEGTKFYNDLTPLLVRLQTKINDFCFARKTEKDELMADLQKAIVNTPSQAPPV 724          
BLAST of Programmed cell death 6-interacting protein vs. TrEMBL
Match: A0A3Q9HE66 (Alg-2-Interacting Protein X OS=Hirudo medicinalis OX=6421 GN=Alix PE=2 SV=1)

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 320/770 (41.56%), Postives = 494/770 (64.16%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANA-FTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQ---EKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPI-------------RNSNIQATSGGTELSAQQ-----PVQSEVPARP 2267
             +++P K+ +E+ F++ + ++++E YG    + + NA   E N +R+ ++ K  D+HES L A+ RY DQ   +E K PI+EN VRI+FKW DAF K+SLFG K  L I+SG YE+ CVLFN+AA+ SQVAET NL +D  L+ AAK FQQA+G+ +Y+R SV   IQ +PT DL  DTL+AL+ +MLAQAQ+    KA+ D  K    AK+  Q +D Y++ LKL+QL+S++ +WPK+W    AGKQ+GYHA AE+YQ++    S+ FGE+I+R R   +L+  +  R+G +F F+   +++ + L   EK+N+ IYH  +PD+++L+ + K ++A+ + +  P++K F+D+FEKIVPL++H ++   +N+R  + N+EI RL++A+  L+ ++ASLNLP A+++  G E+P ++ +KAA +++ GG + L+ L+N LP +  RN EIL E+ ++L+ EE SD QL++QF++RW+RTPS KLTES R E  KY+ +++ A  +D +VR  + +   DI LLSQ++  ++ S+P S  +++ +   ++ E LR+L    E +KSTR+ L  ++ N   + +     +AL  D  ++++     +L+ +   +RE+VS +I  QE L  ++Q    K       ++SG  R   L +L  A+D F ELK NLEEG KFY DLT IL+KFQ+KV DFCFARKTEKEEL+KDL + I R+ +   P+               S+I   S G EL   Q     P Q +VP  P
Sbjct:    7 FLAIPTKRTWEVDFVKPLKSFIQETYGAAGNAEDHNAALNELNKLRNTIISKASDRHESALEAIYRYYDQLAVIEGKFPISENQVRINFKWQDAFDKESLFGGKKILSISSGVYEKACVLFNVAAIQSQVAETQNLGNDESLRLAAKLFQQASGVLAYMRLSVVPGIQCDPTPDLQPDTLNALSHLMLAQAQDCFARKAMNDKMKPAVTAKLAMQCSDFYSEALKLLQLDSIRQLWPKEWTNSAAGKQSGYHAAAEFYQSQVAKESKDFGEEIARLRHCKELILASEMRSGAQFIFQDLQKKITKSLAEAEKDNDFIYHARVPDISSLTPIGKAVVAKSMPITVPLSKQFKDLFEKIVPLAVHQSVVACENRRMLIVNSEIGRLRDATQLLNSILASLNLPAAIEDLGGQEIPKSMSAKAAEIKQYGGFDCLEKLINDLPGLLQRNKEILDESDRMLNEEEASDTQLRNQFRERWNRTPSSKLTESIRSEASKYRTIINNAIDADAVVRERFSKHRDDIMLLSQSDGCIQSSLPSSGPNASLQNHPAVLE-LRSLLKNVENIKSTRDQLENEIKNAPLNDMAGQFLSALLKDGAIDEESLSLQKLDSIYGTMRERVSENIRGQEDLLQKIQAANNKFSEAKVQNTSGVAREEKLKSLASAYDSFTELKGNLEEGTKFYNDLTVILVKFQSKVSDFCFARKTEKEELLKDLSAGIARQSTAPTPVAPAYQKPEAPVATPRSSIPQASAGQELPPPQAAANYPGQPQVPPYP 775          
BLAST of Programmed cell death 6-interacting protein vs. TrEMBL
Match: A0A210QJ07 (Programmed cell death 6-interacting protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04656 PE=4 SV=1)

HSP 1 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 325/789 (41.19%), Postives = 492/789 (62.36%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLEN-PINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKML---NSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATS--------------------GGTELSAQQPV--QSEVPARPPPTYQTQNSGQP 2303
            M+  ++VP K+  E++ I+ +  +++  + +        A  EF+ +R+ M+ K  DKHES L  L RY DQ VA+E K+PIAEN +R+ FKW DAF K+SLF  K +L IASG YE++C+LFNIAA+ +Q+AE  N   D GLKT+AKYFQQAAGI+ +++  V + +Q++PT DLN D L+AL  +MLAQAQE IY KA  D  K+  +AKI  Q++DLYAD +KLMQL S++ +WPK+W+     KQA +H MAEY+Q+      + +GEQISR + + +L+  + TR G  F F++EL R+ R+L+  +K+N+ IYHD +PD  +L    K ++A+ I   N P+++ F D+F K+VP+ +  AMT   N++  + N EI RL+E++  ++ ++ASLNLP A+++  G++VP ++L KAA ++++GG++ +D L+  LP++  RN EIL EA + LD EE SD +L++QFK+RWSRTPS KLT++ + E  KY+ +LD A  +D +V+  Y +    I +LS+ +  L+QSIP S   S  + S ++   LR +  E   +K+ R+ +I+      T  + +    A++SD  +N++     +L++   P+RE+V+ S+ SQE L  ++Q          + S  G  R ++L  L   FD + +LK NLEEG KFY DLT +L+K Q+K+ DFCFARKTEKEELM DLQ +IV++ + A P   S  Q TS                      T+  A  P+  Q   P+ PP    +QN  QP
Sbjct:    1 MAVFLAVPLKQTQEVELIKPLRTFIQNTFTQADPDDYNQALNEFSKLRNLMISKSVDKHESALEILYRYYDQLVAIEDKLPIAENQIRVQFKWRDAFDKESLFSGKRTLAIASGNYEKVCMLFNIAALQTQIAEVQNHDSDEGLKTSAKYFQQAAGIYGHMKDVVLSHVQQDPTPDLNPDALNALVALMLAQAQEAIYRKAASDKMKESMVAKIAFQLSDLYADAMKLMQLQSLRELWPKEWVATAVMKQAAFHGMAEYFQSCVSAEKKCYGEQISRLQHANELLCASQTRGGSAFCFKNELARVNRDLQAAKKDNDFIYHDKVPDAKSLPSCGKAVIAKSIPFSNKPMSERFTDLFSKLVPIPVFEAMTAFDNRKGQIVNTEIGRLRESTQLMNSILASLNLPAAIEDLSGNKVPQSVLEKAAKIKQEGGMQYIDKLMRDLPELLQRNREILDEATRELDEEETSDNKLREQFKERWSRTPSDKLTKTLKEECTKYKSILDAAIGADRVVQEKYAKHKEAIAILSKPQAELEQSIPSSGGGSGQQSSPAVSS-LRQMMEEVATIKAERD-VIESEIKDSTFDMTSKFMAAMASDGLVNEETLSMSELDRTYGPLREQVNNSVQSQEFLMGKIQNANTQFCHEKASSQGGAQRETLLKDLASGFDMYMQLKGNLEEGTKFYNDLTPLLVKLQSKIHDFCFARKTEKEELMADLQRSIVKQPTAAAPAAPSYQQPTSTETSTSRVPPPRPPPPSFSSAPTQPPATAPMGTQPSAPSAPPGQPPSQNYNQP 787          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Cavefish
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:NCBI gene;Acc:103031070])

HSP 1 Score: 518.85 bits (1335), Expect = 2.352e-170
Identity = 284/756 (37.57%), Postives = 441/756 (58.33%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY-GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQ---EKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAH---PIRNSNIQATSGGTELSAQQ---PVQSE 2252
            M+  ISVP KK  E+  ++ +S +V   Y   E+Q+    A  E N +R   L +  DKHES+L  L RY DQ  A+E K P  E  + + F W DAF K SLFG    L +AS GYE+ CVLFNI A+ SQ+A   NL +D GLK+AAK++Q A+G F++++ +V + + REPT D++ +T+  L+ IML+QAQE+   KA  D  KD  +AK+  Q AD Y D  K  Q    K   PK+ +P++A K     A AE +Q+      + FGE+I+R + + +L+KT ++R  +    +   E++ R L   +K+N+ IYHD +P+V  L  + K  L +  S++ P+++ F D+FEK+VP+ +  +++L  ++RA   N  +  L+EA+N  +GV+ASLNLP AL++  GD VP ++L K+  V + GG+  ++ L+  LP++  RN EIL E++K+LD+EE +D +L+ +F  RW+RTPSG L +  R E   ++ +LD+A  +D +VR  Y      I LL + E  L  +IP +N + T + S+ +  VL+A   + + +K  R  L  ++ ++ T  +      AL+ D  +N++     +L+       ++V  ++ +QE L  Q+Q   ++   L   ++   DR  +L  L  A D + E+ SNL+EG KFY DLT+ILLKFQNK  D  FARKTE++EL+K+LQ +I RE S      P   SN    + G    A +   PVQ +
Sbjct:    1 MATFISVPLKKSSEVDLVKPLSKFVGSAYPAGEEQAEYLRAVEELNKLRKSALGRPLDKHESSLEILLRYYDQLCAVEPKFPFPE--LCLTFTWKDAFDKGSLFGGSVKLALASLGYEKTCVLFNIGALASQIASEQNLDNDEGLKSAAKFYQLASGAFAHIKDTVLSALNREPTMDISPETVGTLSQIMLSQAQEVFVMKATADKMKDAIVAKLANQAADFYGDAFKQCQ---YKENLPKEVLPVLAAKHCMMQATAELHQSALANQKKRFGEEIARLQHATELVKTVASRYDEYVNVKDLSEKINRALTAAKKDNDFIYHDRVPEVKDLEHIGKAALVKTTSIQVPLSQKFTDLFEKMVPMEVQQSLSLSNSRRADTVNRLVGSLREATNLCNGVLASLNLPAALEDLSGDSVPQSILEKSRAVVQQGGLHSIEQLIKDLPELLQRNREILDESLKMLDDEETTDNELRTKFSQRWNRTPSGDLYKPLRAEGGNFRSVLDKAVQADQVVRERYNSHCEMIALLCKPENELCAAIPSANPAKTLQGSEVVN-VLKAQLGQLDAIKREREVLEGEIKSV-TFDMTAKFLTALAQDGAINEEALSAAELDSRYGSHTQRVQQNLRAQEDLLGQVQTSHQEFAALKQSNAEANDREEMLKKLASAHDSYIEITSNLKEGTKFYNDLTEILLKFQNKCSDIVFARKTERDELLKELQQSIAREPSAPSFSVPAYQSNTSTPAAGGPTPAPRTMFPVQPQ 749          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Cavefish
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:103026294])

HSP 1 Score: 168.703 bits (426), Expect = 3.889e-42
Identity = 174/750 (23.20%), Postives = 346/750 (46.13%), Query Frame = 3
Query:   12 PMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENG-VRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNV-IMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIW---PKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRA-GQ----KFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-PGALDNTR-GDEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASV----------LSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKE-ELMKDLQSAIVREKSEAHP 2180
            P   +I +  K+  E +F   +  ++ + YGE+  + N     +   +R   +    D      + L +Y  Q   L+S++P+       +   W + F+  ++  +  S       YE+ C+L+N+ A++S +    N   + G+K +  +FQ +AG FSYLR    +      + D++   L+ LN+ +ML QAQE +  K++ D+ K   +A+I  QV D Y +  + ++ +   ++     KDW  +V  K   + A+A  +  K     Q +GE+++  + S+D +  A   A GQ    +   R  ++ +  +  + +K+N+ IYH+++P + TL  V    L + + + NP +      DIF K+VP++ H A +L   ++A +    + ++   + TL   M SLNL P ++DN    + +P  L+ K A   VR D  V+ L   +  L  V T     L+E   +LD +E  +++L++    +        L E  R +++KY    ++A  ++  +         ++RLL    +TL++++P+   S   E   +  + ++ +  + +++K  R+ L + L +L      + +++ L +    +  +  + QL K      E+V   I+  + L AQ      +  ++    T R  +          +  L+ +++ + +L    +EG +FY DL     +   K +  C  R+ E++  L K+LQ    +  +   P
Sbjct:    5 PRMPMIWLDLKEAGEFEFGAAVKQFILKNYGEDPDNYNEQ-LKKLEQLRQSAVNVTRDF--EGCSTLRKYFGQLHYLQSRVPLGPGQEAAVPISWTEIFSGKTVTHEDIS-------YEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFSYLRDHFSHSY----SVDMSHQILN-LNINLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENSDTASMLGKIQKDWKKLVQMKIYYFAAIAHLHMGKQAEEQQKYGERLAYLQSSLDKLNEAIKLAKGQPDSVQEALRFTMDVIGGKFNSAKKDNDFIYHEAVPSLETLPSVKGAPLVKALPV-NPTDPSVTGPDIFSKLVPMAAHEASSLYSEEKAKLLRDVMAKVDGKNETLEQFMDSLNLDPNSVDNMDLYNNIPSVLMEKCAALSVRPD-TVKSLIQSMQVLSGVFTDVEASLKEIRSVLDEDEAGERRLEEAGGKQAVPAQPAALAE-IRRDLEKYLEAHEKASFTNTELHRAMNLHISNLRLLGGPLDTLREALPRPQLS---EDEVAGLQCMKRILGKVQEMKDQRSSLEKQLRDLIQQ---DDITSVLVTTERADMKRLFEEQLKKY-----EQVKVYID--QNLAAQENILKALTEANVQYATVRKGLAETEHKWNNTVQMLVASYEAYEDLMKKSQEGKEFYEDLEGKASRLLEKAKTLCKTREEERQVTLEKELQKKAPQRPTAPKP 723          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Cavefish
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:103026294])

HSP 1 Score: 165.236 bits (417), Expect = 5.278e-41
Identity = 176/755 (23.31%), Postives = 345/755 (45.70%), Query Frame = 3
Query:   42 KKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENG-VRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNV-IMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIW---PKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRA-GQ----KFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-PGALDNTR-GDEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNL-ETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASV----------LSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKE-ELMKDLQSAIVREKSEAHPIRNSNIQATSGGTE 2222
            K+  E +F   +  ++ + YGE+  + N     +   +R   +    D      + L +Y  Q   L+S++P+       +   W + F+  ++  +  S       YE+ C+L+N+ A++S +    N   + G+K +  +FQ +AG FSYLR    +      + D++   L+ LN+ +ML QAQE +  K++ D+ K   +A+I  QV D Y +  + ++ +   ++     KDW  +V  K   + A+A  +  K     Q +GE+++  + S+D +  A   A GQ    +   R  ++ +  +  + +K+N+ IYH+++P + TL  V    L + + + NP +      DIF K+VP++ H A +L   ++A +    + ++   + TL   M SLNL P ++DN    + +P  L+ K A   VR D  V+ L   +  L  V T     L+E   +LD +E  +++L++    +        L E  R +++KY    ++A  ++  +         ++RLL    +TL++++P+   S   E   +  + ++ +  + +++K  R+ L + L +L +   I + L     +D      +  + QL K      E+V   I+  + L AQ      +  ++    T R  +          +  L+ +++ + +L    +EG +FY DL     +   K +  C  R+ E++  L K+LQ    +  +   P    + +  S   E
Sbjct:   15 KEAGEFEFGAAVKQFILKNYGEDPDNYNEQ-LKKLEQLRQSAVNVTRDF--EGCSTLRKYFGQLHYLQSRVPLGPGQEAAVPISWTEIFSGKTVTHEDIS-------YEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFSYLRDHFSHSY----SVDMSHQILN-LNINLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENSDTASMLGKIQKDWKKLVQMKIYYFAAIAHLHMGKQAEEQQKYGERLAYLQSSLDKLNEAIKLAKGQPDSVQEALRFTMDVIGGKFNSAKKDNDFIYHEAVPSLETLPSVKGAPLVKALPV-NPTDPSVTGPDIFSKLVPMAAHEASSLYSEEKAKLLRDVMAKVDGKNETLEQFMDSLNLDPNSVDNMDLYNNIPSVLMEKCAALSVRPD-TVKSLIQSMQVLSGVFTDVEASLKEIRSVLDEDEAGERRLEEAGGKQAVPAQPAALAE-IRRDLEKYLEAHEKASFTNTELHRAMNLHISNLRLLGGPLDTLREALPRPQLS---EDEVAGLQCMKRILGKVQEMKDQRSSLEKQLRDLIQQDDITSVLVTTERAD----MKRLFEEQLKKY-----EQVKVYID--QNLAAQENILKALTEANVQYATVRKGLAETEHKWNNTVQMLVASYEAYEDLMKKSQEGKEFYEDLEGKASRLLEKAKTLCKTREEERQVTLEKELQKKAPQRPTAPKPAPKKHPEMDSSSME 737          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Cavefish
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:103026294])

HSP 1 Score: 151.369 bits (381), Expect = 1.173e-36
Identity = 170/750 (22.67%), Postives = 337/750 (44.93%), Query Frame = 3
Query:   42 KKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENG-VRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNV-IMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIW---PKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-PGALDNTR-GDEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNL-ETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASV----------LSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKE-ELMKDLQSAIVREKSEAHPIRNSNIQATSGGTE 2222
            K+  E +F   +  ++ + YGE+  + N     +   +R   +    D      + L +Y  Q   L+S++P+       +   W + F+  ++  +  S       YE+ C+L+N+ A++S +    N   + G+K +  +FQ +AG FSYLR    +      + D++   L+ LN+ +ML QAQE +  K++ D+ K   +A+I  QV D Y +  + ++ +   ++     KDW  +V  K   + A+A     +S          + +  ++I L K       +  +F   ++ +  +  + +K+N+ IYH+++P + TL  V    L + + + NP +      DIF K+VP++ H A +L   ++A +    + ++   + TL   M SLNL P ++DN    + +P  L+ K A   VR D  V+ L   +  L  V T     L+E   +LD +E  +++L++    +        L E  R +++KY    ++A  ++  +         ++RLL    +TL++++P+   S   E   +  + ++ +  + +++K  R+ L + L +L +   I + L     +D      +  + QL K      E+V   I+  + L AQ      +  ++    T R  +          +  L+ +++ + +L    +EG +FY DL     +   K +  C  R+ E++  L K+LQ    +  +   P    + +  S   E
Sbjct:   15 KEAGEFEFGAAVKQFILKNYGEDPDNYNEQ-LKKLEQLRQSAVNVTRDF--EGCSTLRKYFGQLHYLQSRVPLGPGQEAAVPISWTEIFSGKTVTHEDIS-------YEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFSYLRDHFSHSY----SVDMSHQILN-LNINLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENSDTASMLGKIQKDWKKLVQMKIYYFAAIAHLAYLQSS---------LDKLNEAIKLAKGQPDSVQEALRF--TMDVIGGKFNSAKKDNDFIYHEAVPSLETLPSVKGAPLVKALPV-NPTDPSVTGPDIFSKLVPMAAHEASSLYSEEKAKLLRDVMAKVDGKNETLEQFMDSLNLDPNSVDNMDLYNNIPSVLMEKCAALSVRPD-TVKSLIQSMQVLSGVFTDVEASLKEIRSVLDEDEAGERRLEEAGGKQAVPAQPAALAE-IRRDLEKYLEAHEKASFTNTELHRAMNLHISNLRLLGGPLDTLREALPRPQLS---EDEVAGLQCMKRILGKVQEMKDQRSSLEKQLRDLIQQDDITSVLVTTERAD----MKRLFEEQLKKY-----EQVKVYID--QNLAAQENILKALTEANVQYATVRKGLAETEHKWNNTVQMLVASYEAYEDLMKKSQEGKEFYEDLEGKASRLLEKAKTLCKTREEERQVTLEKELQKKAPQRPTAPKPAPKKHPEMDSSSME 721          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Cavefish
Match: ptpn23b (protein tyrosine phosphatase, non-receptor type 23, b [Source:ZFIN;Acc:ZDB-GENE-060503-179])

HSP 1 Score: 148.288 bits (373), Expect = 6.161e-36
Identity = 149/588 (25.34%), Postives = 270/588 (45.92%), Query Frame = 3
Query:   12 PMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENG-VRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAM----AEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNL 1748
            P   +I +  K   E  F      Y++  YGE  ++    A  +  ++R  ++    D      N L +Y  Q   L+S++P+A+     +   W D F+     GK+ + +  S  YE+ CVL+N+ A++S +    N   + G+KT+  +FQ +AG F+Y+R    N      + D++   LS    +MLAQAQE +  K + D+ K   IA+I  QV + Y + +++++ NS      K+W  ++  K + + A+     E+ +        +F E  ++         T S +   +F     ++ +  +  +  K+N+ IYH+S+PD+  LS V    L + + + +P +      D+F K+VP++ H A +L   ++A M    + ++ E + TL   M SL+            VP  LL K A   VR D  V+ L   +  L  V       L+EA   L  +E  +K L +    +   T    L E  + E++KY+    +A  ++  +     +   ++RLL    E L+ ++P+   S   E + S++ + R L  +  +++  R  L Q L +L
Sbjct:    5 PRMPMIWLELKDAGEFPFSHAAKQYIQRSYGENPENYT-EALKKLEHLRHNVVNVPRDF--EGCNMLRKYFGQLHFLQSRVPMAKGQEAAVPVTWTDIFS-----GKQITHEDIS--YEQACVLYNLGALHSLLGAMDNRVSEEGMKTSCTHFQCSAGAFTYIRDHY-NFNY---SSDISHQALSINISLMLAQAQECLLEKTLLDNRKSVLIARICTQVCEYYKECVRVLE-NSEGTFGKKEWRKLIYMKISYFSAVTYVSTEHTKYTEYTAHALFKEGCTKTS-----FHTHSVQEALRF----TMDVIGGKFNSARKDNDFIYHESVPDLEKLSAVKGASLVKPVPV-SPTDLSVTGPDLFSKLVPMASHEASSLYSEEKAKMLREVMAKIDEKNQTLETFMDSLSCDSVDHLEMFSTVPPVLLEKCAALSVRSD-AVKSLAQAMQALSGVYMDVGSSLEEARAALGEDEAGEKSLVEVVGQKGLPTRPPALQE-LQQELKKYETAHQEASHTNTELHRAMNEHIPNLRLLQGPLEELRNNLPQPQLSQ--EDTSSLQNMKR-LQEKVGEMRKQRVSLEQQLRDL 562          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Sea Lamprey
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:ZFIN;Acc:ZDB-GENE-040426-2678])

HSP 1 Score: 233.802 bits (595), Expect = 3.118e-70
Identity = 119/313 (38.02%), Postives = 191/313 (61.02%), Query Frame = 3
Query:  360 YERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF---RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIV 1289
            YE+ICVLFNI A+ SQ+A         G+    +Y  QA+G F  ++ SV + + REPT D++ DT+ AL+VIMLAQAQE+ Y KA  D  KD  +AK+  Q AD Y D  K  Q    K   PK+ +P++A K   Y A A+ +Q+      + FGE+I+R + + DL+KT ++R  +    +   +++ R L   +K+N+ IYHD +PD+  L  + K  L + + L +P++  F    D+FEK+VPL++++A+T    ++A + N  + +++EA+  L+G++ASLNLP AL++  GD VP ++L K+  +
Sbjct:    1 YEKICVLFNIGALMSQIA---------GISKQLQY-TQASGCFLQIKESVLSALNREPTVDISPDTVGALSVIMLAQAQEVFYMKASADKMKDAIVAKLANQAADYYGDAFKQCQY---KEQLPKEVLPLLAAKHCIYQATAQLHQSNVAKQQKKFGEEIARLQHATDLVKTVTSRYDEYISVKDLSDKISRALTAAKKDNDFIYHDRVPDIKDLEAIGKATLVKPLQLASPMSPRFVGKSDLFEKMVPLAVNNAVTAYNQRKADLVNRSVMQMREATTLLNGILASLNLPAALEDLSGDTVPPSILEKSVAI 300          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Sea Lamprey
Match: ptpn23b (protein tyrosine phosphatase, non-receptor type 23, b [Source:ZFIN;Acc:ZDB-GENE-060503-179])

HSP 1 Score: 157.918 bits (398), Expect = 2.012e-39
Identity = 164/738 (22.22%), Postives = 332/738 (44.99%), Query Frame = 3
Query:   12 PMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAEN-GVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWP---KDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRA-GQK-------FQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFR--DIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-------PGALDNTRGDEVPDNLLSKAAI--VRKD---GGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGER-SDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNK---LLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMK 2135
            P   +IS+  K   +  F++ +  Y+   YGEE    N     +F  +RS  +    D      + L +Y  Q   L+S++P+ E     +   W D F      GK  ++K     +E+  +L+N+ A++S +    +   + G+K +  +FQ AAG F+YLR    +      + D++   L+    +ML QAQE +  K++ D+ K   IA+I  QVA+ Y +    ++ + V ++     K+W   +  K + +  +A  Y  K     Q +GE+++ ++ ++D +  A   A GQ+        QF   ++ +  +  + +K+N+ IYH+S+P +  L  V    L + +  + P +      DI  ++VP+  H   +L   ++A M      +++E +  L   M SL +       P A D      +P  L+ K A   VR D   G V+ +  L +   DV        + ++K ++++   D++ ++ F++     P   + +    E  KY     +A  ++  +R        ++RL+S   + L+ ++P   +++  E   D++K++LR +  E  + +      I+D+        G+ ++  L +    +  +  + ++ K   L   I + +SA  N    LT    +   +  +   +     + + AL+ ++D + +L    EEG+ FY DL   + K   + +  C  +  E++++++
Sbjct:   21 PRMPMISLELKIADDFPFVDAVKQYIFGHYGEEPDKYNEE-LRKFEQLRSSAVAVTRDF--EGCSTLRKYFGQLHYLQSRVPMGEGQDAAVTVIWKDIFT-----GK--AVKYDDIHFEQAAILYNLGALHSLLGVMDSRQSEEGMKVSCTHFQCAAGAFTYLR----DHFSHSYSADMSLGILNLYITLMLGQAQECLLEKSMLDNRKSFLIARISAQVAEYYKEACHFLENHEVSSLLGREQKEWKKQIQVKISYFSCIANLYMGKQADEQQKYGERLAFYQSALDKLNEAVKCAKGQQDPAFNEALQF--TMDVVGGKYNSAKKDNDFIYHESVPSLDNLPAVKGAPLVKALPFQ-PTDPSVTGPDILARLVPMEAHKDSSLYSEEKAKMLREVGEKIEEKNKELQHFMDSLGIELEQLERPPAYDR-----IPQALMEKCAALSVRPDAIKGIVQAMQTLSSVFTDV--------EASLKEIEDQLEEDEKSENIFQEVIGPRPLSNIIKEMSKEWGKYMEAHQKASVTNMELRKAMNLHISNLRLMSGPLDQLRAALPIPTTTTADETVGDNLKKMLRKV-GEMREQRIALEHQIRDVVQ------GDDITGVLVTAAPGSVRELFNKEMKKYDQLKVYIDQNLSAQENILRALTDANAKYALVRKASEEADYKWNNAVQALVSSYDAYEDLIKKSEEGINFYKDLEGKVTKLLQRAKSVCRVQDEERQKILE 721          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004835.1 (pep scaffold:Pmarinus_7.0:GL480606:4394:25584:1 gene:ENSPMAG00000004381.1 transcript:ENSPMAT00000004835.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 9.351e-20
Identity = 71/266 (26.69%), Postives = 126/266 (47.37%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGE--EQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTK-AVRDSHKD----GNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQA 800
            LI +  K+  E+ F+    A+++E YGE  E+         E   +R  M  +   ++E  +  L  Y +Q   +E++         + F W      DSL G     +  +  +ER  VLFN+ A+Y+Q+    + +   GL +A   FQ+AAG F+YL+ +  +     PT D++  +L+ L  +M AQ QE ++ +  ++  H D     NIA+   +V+D+Y    + M   ++    P  W  +V  K   + A++ +Y A
Sbjct:   89 LIPLGLKETKEVDFLTPFKAFIEEHYGECGEKYEEEIKDLLE---LRQAM--RTPRRNEVGVELLMEYYNQLYFVENRFCPPHRHSGVFFTW-----YDSLTGMPACQRTLA--FERGSVLFNVGALYTQIGARQDRTAHDGLHSAIDAFQKAAGAFNYLKENFTHA----PTLDMSPASLTMLVRLMAAQVQECVFERFLLQGLHNDVPALFNIAQEATRVSDVYNVTHQTMDQTAITDYVPVSWRTMVRVKSLHFLALSHHYVA 338          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Yeast
Match: RIM20 (Protein involved in proteolytic activation of Rim101p; part of response to alkaline pH; PalA/AIP1/Alix family member; interaction with the ESCRT-III subunit Snf7p suggests a relationship between pH response and multivesicular body formation [Source:SGD;Acc:S000005801])

HSP 1 Score: 125.946 bits (315), Expect = 2.626e-30
Identity = 174/738 (23.58%), Postives = 302/738 (40.92%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHEST---------LNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIP-DVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYR-LKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKD-RWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTG-------ERSDSIKEVLRALCAEAEKLKST-----RNGLIQDLTNLETSSIGNTLS-----NALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDL 2141
            MS+L+++P K+  E+ F   +S  +           +  +F   +  +S +L K+ D   +          L+AL  Y    + LE K P      +I+F W    ++ S    + SL+     +E++ +++NI  MYS +A  +N      LKT+  YFQ AAG F ++     N+ +  P  D    TL+AL  +MLAQAQE  + KAV+D HKD  IAK+ QQ+ D Y + +   Q      +   DWI  +  K+A + A+  Y  A S    + FG  +   +  +  +  ++  +  KF+   E       L+  +++N  IY   +P ++ ++     V  +   +L   I KD   +F+ ++P+ +    T    ++       +   L   +  L   + +  +P  L      E+     S   ++  +  V+           V   NIE      ++L+ E  +D QL+ +     W+   S     ++  +++K +  LD+  + D       KQ     + + +N    +  +P+SN   T        ER+D I    R   +E   L        +NG +    + E   IG+          ++S  E N     +  L+K   P R  +               E  KM+  D      R   +  L  +F    E+K NL  G  FY +L        N+VQ++  AR+ EK  L K L
Sbjct:    1 MSELLAIPLKRTLEVDFATELSKLI-----------DTTSFQTASFFQSDIL-KVVDARNNAIAPDISIDGLSALKEYYVILLQLEKKFP----NNQIEFTWFQTLSQKSRGTSQYSLQ-----WEKLTIIYNIGCMYSLLALNSNNDAAESLKTSCLYFQNAAGCFKHVLDHQKNL-ETIPVVD--DATLNALTSLMLAQAQECFWFKAVQDKHKDSLIAKLSQQIVDFYCEAINDAQRGK---LIRSDWINHLKAKKAYFSAVTYYRIALSFNEKKQFGNVVKALQMGLQFINESTLSSQAKFKTVVE-----SSLKEAQRDNEFIYLQEVPSELPSIKPALMVKPSSSATLLPSIKKD-ETLFKDLIPIEVMEYCTAYNERQDEYVEQRVTNPLASLNKLLKESLTTFQIPQGLTKVSEAELSHYQASLNNLLINNKNVQ-----------VQLDNIE------QILNEEAFTDNQLRLKHGTLNWTLPESSTTNTAYYEKLKKLRGYLDEGSAID-------KQTNELFQSIDKNLIGSEIRLPESNDPLTNKIKMIIQERNDYIDRTRRK-SSEYRILPKIITSYKKNGTV----DFEPIFIGHLKYFDEDLRYVNSTKEENIKLIEEVNLSKKNNPGRSGI---------------EPKKMVRIDP-----RELYIEDLRYSFKLLDEVKENLSAGTAFYENLITSTSNLYNEVQEYDTARRAEKARLDKSL 656          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Yeast
Match: BRO1 (Cytoplasmic class E vacuolar protein sorting (VPS) factor; coordinates deubiquitination in the multivesicular body (MVB) pathway by recruiting Doa4p to endosomes [Source:SGD;Acc:S000006005])

HSP 1 Score: 93.9745 bits (232), Expect = 4.876e-20
Identity = 161/707 (22.77%), Postives = 298/707 (42.15%), Query Frame = 3
Query:   75 ISAYVKEIYGEEQQSS--NANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRD---SHKDGNIAKIVQQVADLYADGLKLM-QLNSVKAIW--PKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLM------KTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDI-------FEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQ------SIPKSNS--SSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNAL-----SSDPELNQDQFVDGQLNKLLAPIREKVSASINSQ----EKLTAQMQEKCKMLN-SDSSSG-----TDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDI 2063
            +S+Y+K+ YG  Q  +  +  A +E +++R+    ++     S  N   +Y      L  ++    + +++DF W DA    +  G K +    +  +E+ C LFNIA +++Q+A   N+++D   K +     +A   F YL  +  N     P+ DL  +    L  I  A+AQEL   K + D   S +   I+K+ +   +L+      M +++   AI+  PK W   V  K   Y +++ YY           GE I+    S+  +      KT          F+  LE+ ++EL    K+N+ IYH+S+P V  +  +  +   +  + E  +    +D+       +  I+PL ++   ++   ++A +   ++   + A+   S  +   NLP              LLS       DG +    D   +L     +      +  +  D EE  +K +   FK +        L    +  + K +  L  A +SD+ +    K    +I LL+ N +  K+      + P   S       ++D I E+L+ +   AE L++ +    ++L+ L      + ++  L      SD EL +D F + +L K   P+  ++ A+I  Q    + + A++ E   + N  D SSG      DR +    L  A   F    S+L +G++FY  L ++
Sbjct:   22 LSSYLKKSYGSSQWRTFYDEKATSELDHLRNNANGELAPSSLSEQN--LKYYSFLEHLYFRLGSKGSRLKMDFTWYDAEYSSAQKGLKYTQH--TLAFEKSCTLFNIAVIFTQIAR-ENINED--YKNSIANLTKAFSCFEYLSENFLN----SPSVDLQSENTRFLANICHAEAQELFVLKLLNDQISSKQYTLISKLSRATCNLFQKCHDFMKEIDDDVAIYGEPK-WKTTVTCKLHFYKSLSAYYHGLHLEEENRVGEAIAFLDFSMQQLISSLPFKTWLVEFIDFDGFKETLEKKQKELI---KDNDFIYHESVPAVVQVDSIKALDAIKSPTWEKILEPYMQDVANKCDSLYRGIIPLDVYEKESIYSEEKATLLRKQVEETETANLEYSSFIEFTNLP-------------RLLSDLEKQFSDGNIFSNTDTQGQLMRDQIQTWCKFIQTNEFRDIEEQMNKIV---FKRKQILEILSALPNDQKENVTKLKSSLVAASNSDEKLFACVKPHIVEINLLNDNGKIWKKFDEFNRNTPPQPSLLDIDDTKNDKILELLKQVKGHAEDLRTLKEERSRNLSELRDEINNDDITKLLIINKGKSDVEL-KDLF-EVELEK-FEPLSTRIEATIYKQSSMIDDIKAKLDEIFHLSNFKDKSSGEEKFLEDRKNFFDKLQEAVKSFSIFASDLPKGIEFYDSLFNM 694          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Nematostella
Match: EDO45795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP2])

HSP 1 Score: 517.309 bits (1331), Expect = 1.519e-170
Identity = 276/721 (38.28%), Postives = 438/721 (60.75%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFG-KKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQ-DQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQ---EKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVRE 2162
            M+  I +PCK+   + F + +  ++K  + E+    N++A ++ N +R+  + +  DKHES L  L RY DQ VA+E K+PI E+ +R+ F W D F K SLFG KK SL  A+  YER+C+LFNI A+ SQ+A   NL  D GLK AAK FQ A+G F+ L+ SV   + + PT D++ + L+AL  IMLAQ QE I+ K   D  KDG IAK+  Q++D Y +  +  Q+ +VK    K+W  ++  KQ  + A+++Y+QA        +GE ++R + +  L+  A+  +   F  ++ ++R+KR     EK+NNLIYHD IP V TL+++ +  LA+ + L  P + +F D+F K+VP+++H A+T  +N++A + N E+ RL+E +  ++ ++ASLNLP A+++  GD+VP ++L KAA V++ GGV  +D L+  LP++  RN EIL EA +++D EE  D Q++++F  +W+  PS +LT   R E  KY+ +L+ A  +D IVR  Y    + + LL + E  +  ++P  N++S+   + S  + LR L +E + +K+ R G+ +DL   +       LS AL++D  +   +  + G L     PI+++V  SI+ QEK  A +Q   EK      +  + ++R + L  L  AFD + EL +NL+EG KFY DLT IL++FQ K+ D  FARKTE+EEL + LQ+ I ++
Sbjct:    1 MAGWIVIPCKRSEAVDFKKPLEKFIKNTFSEDVLKENSDAISDLNKLRNSAVMQTPDKHESALEPLLRYYDQLVAIEGKLPINESQIRVSFTWFDCFDKGSLFGYKKASL--ATSAYERLCLLFNIGALESQIASAQNLQTDDGLKLAAKMFQSASGCFNLLKDSVYAQLHQVPTPDMSVEMLNALGSIMLAQGQESIWFKTEHDKMKDGIIAKVAAQLSDFYNEANQACQVQTVKQQLEKEWTAVLGAKQKYFKAISQYHQATVAMEKGKYGENVARLKLANQLVGEAAKESMGMFDTKTWVDRIKRGFVEAEKDNNLIYHDMIPSVDTLAVIGRASLAKSLPLSKPASINFIDMFTKLVPMAVHGALTAYENRKAEIINFEVGRLREGTQLINSILASLNLPAAIEDLSGDKVPKSVLEKAATVKERGGVNTIDSLMQDLPELLQRNREILDEAARMMDEEEGQDTQMRERFTSKWTPKPSAELTAQLRDEANKYRGILENAVRADAIVREKYNAHRQAMDLLCKGESEIAAALPTVNATSSATAASSTVQQLRKLLSEIDSIKAAREGIEEDLKAQQDDMAVKFLS-ALAADGSITDCEGLISGNLASTYEPIQDQVKDSISRQEKTLAAIQTANEKFVQERQEGRAVSEREAKLKELASAFDIYMELTANLKEGTKFYNDLTPILVRFQQKISDLVFARKTEREELSRSLQNTIAQQ 718          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Nematostella
Match: EDO34525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP33])

HSP 1 Score: 81.2629 bits (199), Expect = 8.820e-16
Identity = 70/268 (26.12%), Postives = 120/268 (44.78%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIA-SGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGN----IAKIVQQVADLYADGLKLMQLNSVKAIW----PKDWIPIVAGKQAGYHAMAEYYQA 800
            +I +  ++  ++ F      ++++ Y E+ +      F  +  +R  M     DK    + +L  Y +Q   +E K       + + F W DA          G  K+  S  +E+  V+FNI A++SQ+    +     G++ A   FQ+AAG F ++R +  N     P+ D+  DTL AL  +ML QAQ  ++ K  R  H D +      +  Q+ A++ + G K +QL     I     P  W  +V    A Y A++ Y+ A
Sbjct:  135 MIPLGLRETQDVDFCSQFKEFLQDHYDEDPEKYTEE-FARYRKLRKTMCNPSRDK--DGILSLYEYYNQMYFVERKFFPKRGSMAVYFHWYDAMT--------GLPKVQRSAAFEKASVMFNIGALWSQIGTKQDRGTAEGVEEACMAFQKAAGAFRFIRDNFMN----SPSVDMTQDTLEALIPLMLVQAQACMWEKR-RLLHDDVDGFQECIQAGQECAEI-SQGYKRVQLLMNSGICMDSIPTAWRNLVKIMSAHYKALSHYHTA 385          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Nematostella
Match: EDO43006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU6])

HSP 1 Score: 61.2326 bits (147), Expect = 1.045e-9
Identity = 63/262 (24.05%), Postives = 112/262 (42.75%), Query Frame = 3
Query:  279 IDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKY---FQQAAGIFSYLRSSVPNIIQR---EPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLY---ADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTA---------------STRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPD 992
            I FKW ++   ++   +  ++      +E + +  NIA+ Y++ A      +D  +  A +     + AAG+F Y++  +   +++   E   D+    + A ++  +A+AQE+   +AV   HK   I+ +  + A L+   AD LK     SV  +    W   +  K A Y A A  +Q +    +   G+ I   ++S  L KTA               + R  +   FR     MK  L+   +EN  IY   IP+
Sbjct:   88 IMFKWTNSICGNTPLCEADTV------FELLSMCMNIASWYTKHAAKLAAKEDISMDEAKEVHTSLRTAAGMFQYVKDQLLGRLEQLSAEKGADIEKRVVEAYHMQCVAEAQEVTVARAVELKHKASLISSLANETAKLFTSAADSLK-----SVDDLKAGKWRKYLELKAAFYEAYAYCFQGEQLLDADECGKAIRSLQESEKLYKTAEALCRDYSATKGPGTTARPQEHPFFRRIGPLMKTRLDKATRENGFIYFHKIPE 338          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Medaka
Match: pdcd6ip (programmed cell death 6 interacting protein [Source:NCBI gene;Acc:101156751])

HSP 1 Score: 538.88 bits (1387), Expect = 4.758e-178
Identity = 285/724 (39.36%), Postives = 441/724 (60.91%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIY-GEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQL--NSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQ---EKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKS 2168
            M+  ISVP KK  E+  ++ +S Y+   Y   E Q+    A  E N +R   L +  DKH+S+L  L RY DQ  ALE K P +EN + + F W DAF K SLFG    L +AS GYE+ CVLFN AA+ SQ+A   N+ +D  LKTAAKY+Q A+G FS+++ +V + + REPT D+  +T+  L++IMLAQAQE+ + KA  D  KD  IAK+  Q AD Y D  K  Q   N  K  + ++ +P++A K     A AE +Q+      + FGE+I+R + +++L+KT ++R  +    +  ++++ R L   +K+N+ IYHD +P+V  L  + K  L +  ++  P+++ F D+FEK+VP+++  +M++   ++A   N  +  ++EA+N  +GV+ASLNLP AL++  GD VP +++ KA  + + GG++ ++ L+  LP++ TRN EIL E++K+LD+EE++D +L+ +F  RW+RTPSG L +  R E   ++ +LD+A  +D +VR  Y      I LL +    L  +IP +N + T + S+ I  VLR+  A+ E++K  R  L  ++  + T  +  T   AL+ D  +N++Q    QL+KL     E+V AS+ SQE+L  Q+Q   ++   L   ++ G  R  +L  L  A D + E+ +NL EG KFY DLT+ILLKFQNK  D  FARKTE++EL+K+LQ +I RE S
Sbjct:    1 MATFISVPLKKSSEVDLVKPLSKYITVTYPAGEDQTEYIRAVEELNKLRKNALGRPLDKHDSSLEILLRYYDQLCALEPKFPFSENQICLSFTWKDAFDKGSLFGGSVKLSLASLGYEKTCVLFNCAALASQIAAEQNMDNDECLKTAAKYYQLASGAFSHIKDTVLSALSREPTMDICPETVGTLSLIMLAQAQEVFFLKATSDKMKDAVIAKLANQAADFYGDAFKQCQYKDNLPKYFYFQEVLPVLAAKHCIMQANAELHQSALAKQKKHFGEEIARLQHALELVKTVASRYDEYVSVKDLMDKINRALTAAKKDNDFIYHDRVPEVKDLEQIGKAALVKATAITPPLSQKFTDLFEKMVPMAVQQSMSVYGQRKAETVNRLVGTMREATNLCNGVLASLNLPAALEDLSGDSVPQSIVEKARSIVEKGGLQSIEQLIRDLPELLTRNREILDESLKMLDDEESTDNELRGKFNQRWNRTPSGDLYKPLRIEGTNFRNVLDKAVQADQVVRDRYNAHCDMIALLCKPPSELSAAIPSANPTKTLQGSE-IVNVLRSQLAQLEEVKKERETLEGEIKAV-TFDMSVTFLTALAQDGAINEEQLSLTQLDKLYGSYNERVQASLRSQEELLGQVQVSHQEFSSLKQSNTEGHQREEILKKLASAHDSYIEISNNLREGTKFYNDLTEILLKFQNKCSDIVFARKTERDELLKELQQSIAREPS 722          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Medaka
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:101156355])

HSP 1 Score: 165.622 bits (418), Expect = 3.704e-41
Identity = 178/769 (23.15%), Postives = 350/769 (45.51%), Query Frame = 3
Query:   12 PMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPI-AENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNV-IMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIW---PKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRA-----GQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-PGALDNTRG-DEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGE--------IQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNL-ETSSIGNTLSNALSSDPELNQDQFVDGQLNK---LLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELM-KDLQSAIVREKSEAHP---IRNSNIQATSGGTE 2222
            P   +I +  K+  E +F   +  ++ + YGE   + N     +   +R   +    D      + L +Y  Q   L+S++P+ A     +   W + F+     GK  +    S  YE+ C+L+N+ A++S +    N   + G+K +  +FQ +AG F+YLR    +      + D++   L+ LN+ +ML QAQE +  K++ D+ K   +A+I  QV D Y +  + ++ +   ++     KDW  +V  K   + A+A  +  K     Q FGE+++  + S+D +  A   A     G +   R  ++ +  +  + +K+N+ IYH+++P + TL+ V    L + + + NP +      D+F K+VP++ H A +L   ++A +    I ++   + TL   M SL L P ++DN      +P  L+ K A   VR D  V+ L   +  L  V T     L+E   +L+ +E  ++ LK+          +G +  + +G+        ++KY    ++A  ++  +         ++RLL    ++L++++P+   S   E   +  + ++ +  + ++++  RN L + L +L +   I +TL      D      +  + QL K   +   I + ++A  N  + LT    +   +    S +     S +  L+ +++ + +L    +EG +FY DL     +   K +  C  R  E+  ++ K++Q       + A P    R S++ + S   E
Sbjct:    5 PRMPMIWLDLKEAGEFQFSPSVRQFILKNYGENPDNYNEQ-MKKLETLRQSAVNVTRDF--EGCSTLRKYFGQLHYLQSRVPMGAGQEAAVPISWTEIFS-----GKNVTHDDIS--YEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFTYLRDHFSHNF----SVDMSHQILN-LNINLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENSETASMLGKIQKDWKKLVQMKIYYFAAIAHLHMGKQAEEQQKFGERLAYLQSSLDKLGEAIKLAKGQPDGVQEALRFTMDVIGGKYNSAKKDNDFIYHETVPSLETLASVKGAPLVKALPV-NPTDPSVTGPDLFAKLVPMAAHEASSLYSEEKAKLLRDIIAKIDGKNETLEQFMDSLGLEPDSVDNLEMYSHIPPVLMEKCAALSVRPD-TVKSLIQSMQVLSGVFTDVESSLREIKDVLEADETGEQALKEAGGPA-----AGDIHPAAQGQALAEIQRDLEKYMEAHEKASFTNTELHRAMNLHISNLRLLGGPLDSLREALPRPQLS---EEEVAGLQTMKRILGKVQEMREQRNSLEKQLRDLIQQDDITSTLVTTERGD----MKRIFEEQLKKYEQVKVYIDQNLAAQENILKALTEANVQYASVRKRLSQTEQQWNSTVQGLVGSYEAYEDLMKKSQEGKEFYDDLEAKASRLLEKAKTLCQTRAEERRPILEKEIQKKAPARPTAAKPSLKPRGSDVDSASSSME 744          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Medaka
Match: ptpn23a (protein tyrosine phosphatase non-receptor type 23 [Source:NCBI gene;Acc:101156355])

HSP 1 Score: 148.673 bits (374), Expect = 7.075e-36
Identity = 172/764 (22.51%), Postives = 343/764 (44.90%), Query Frame = 3
Query:   12 PMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPI-AENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNV-IMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIW---PKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDF--RDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNL-PGALDNTRG-DEVPDNLLSKAAI--VRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGE--------IQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNL-ETSSIGNTLSNALSSDPELNQDQFVDGQLNK---LLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELM-KDLQSAIVREKSEAHP---IRNSNIQATSGGTE 2222
            P   +I +  K+  E +F   +  ++ + YGE   + N     +   +R   +    D      + L +Y  Q   L+S++P+ A     +   W + F+     GK  +    S  YE+ C+L+N+ A++S +    N   + G+K +  +FQ +AG F+YLR    +      + D++   L+ LN+ +ML QAQE +  K++ D+ K   +A+I  QV D Y +  + ++ +   ++     KDW  +V  K   + A+A     +S          + +  ++I L K       +  +F   ++ +  +  + +K+N+ IYH+++P + TL+ V    L + + + NP +      D+F K+VP++ H A +L   ++A +    I ++   + TL   M SL L P ++DN      +P  L+ K A   VR D  V+ L   +  L  V T     L+E   +L+ +E  ++ LK+          +G +  + +G+        ++KY    ++A  ++  +         ++RLL    ++L++++P+   S   E   +  + ++ +  + ++++  RN L + L +L +   I +TL      D      +  + QL K   +   I + ++A  N  + LT    +   +    S +     S +  L+ +++ + +L    +EG +FY DL     +   K +  C  R  E+  ++ K++Q       + A P    R S++ + S   E
Sbjct:    5 PRMPMIWLDLKEAGEFQFSPSVRQFILKNYGENPDNYNEQ-MKKLETLRQSAVNVTRDF--EGCSTLRKYFGQLHYLQSRVPMGAGQEAAVPISWTEIFS-----GKNVTHDDIS--YEQACILYNLGALHSMLGAMDNRVSEEGMKVSCTHFQCSAGAFTYLRDHFSHNF----SVDMSHQILN-LNINLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENSETASMLGKIQKDWKKLVQMKIYYFAAIAHLAYLQSS---------LDKLGEAIKLAKGQPDGVQEALRF--TMDVIGGKYNSAKKDNDFIYHETVPSLETLASVKGAPLVKALPV-NPTDPSVTGPDLFAKLVPMAAHEASSLYSEEKAKLLRDIIAKIDGKNETLEQFMDSLGLEPDSVDNLEMYSHIPPVLMEKCAALSVRPD-TVKSLIQSMQVLSGVFTDVESSLREIKDVLEADETGEQALKEAGGPA-----AGDIHPAAQGQALAEIQRDLEKYMEAHEKASFTNTELHRAMNLHISNLRLLGGPLDSLREALPRPQLS---EEEVAGLQTMKRILGKVQEMREQRNSLEKQLRDLIQQDDITSTLVTTERGD----MKRIFEEQLKKYEQVKVYIDQNLAAQENILKALTEANVQYASVRKRLSQTEQQWNSTVQGLVGSYEAYEDLMKKSQEGKEFYDDLEAKASRLLEKAKTLCQTRAEERRPILEKEIQKKAPARPTAAKPSLKPRGSDVDSASSSME 728          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Medaka
Match: rhpn2 (rhophilin Rho GTPase binding protein 2 [Source:NCBI gene;Acc:101173292])

HSP 1 Score: 98.2117 bits (243), Expect = 1.162e-20
Identity = 71/264 (26.89%), Postives = 127/264 (48.11%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDG-----NIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQA 800
            LI++  K+  E+ F      ++ E Y E+ +    +   +  ++R    C+   + E+ +  L +Y +    +ES+     N   I F W D+F    +  +  SL+ AS       +LFN+AA++SQ+   +N    +GL+ A   FQ+A+GI +YL+ +        P++D+    LS L  +MLAQAQE ++ K+V    ++       +A+   +VA++Y    + M    +K   P  W  +   K   Y +MA Y+ A
Sbjct:  111 LIALGLKETKEVDFSAPFKDFIMEHYNEDSRKFE-DEIADLMDLREA--CRTPSRSEAGVELLEKYYNHLPMIESRFFAPTNQTGIFFTWYDSFTGVPVCQQNLSLEKAS-------ILFNMAALFSQIGTRSNRQTTAGLEEAISSFQKASGILNYLKET----FTHTPSFDMGPAMLSMLIRLMLAQAQECLFEKSVLPGTRNKFNAMIKVAQEAAKVAEVYDQVHQCMIQTQLKDNVPLFWSTMTQVKTNHYSSMAHYFVA 360          
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Medaka
Match: rhpn1 (rhophilin Rho GTPase binding protein 1 [Source:NCBI gene;Acc:101168940])

HSP 1 Score: 90.8929 bits (224), Expect = 2.228e-18
Identity = 70/264 (26.52%), Postives = 125/264 (47.35%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTK---AVRDSHKDGN--IAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQA 800
            +I +  K+  ++ F   I  ++ E YGE+  S       E   +R  M  +   ++++ L  L  Y +Q   ++ +   A   + + F W      DSL G   S +  +  +E+  VLFNI A+Y+Q+    +    + +  A   FQ+AAG F+YL+ +  N     P+ D++  +LS L  +MLAQ QE ++ +   A R +H      +++   +V+D+Y    + M    +K   P  W  +V  K   + A++ YY A
Sbjct:  126 MIPLGLKETKDVDFTIPIQDFICEHYGEDS-SQYDREVRELMELRQAM--RTPSRNQAGLELLMEYYNQLYYVDQRFFSAHRNLGVHFHW-----YDSLTGVPSSQRALA--FEKGSVLFNIGALYTQIGARQDRCATADIDAAIDAFQRAAGAFNYLKENFSNA----PSLDMSAPSLSMLVRLMLAQVQECVFERIALASRSAHFSSQLRLSQEAARVSDVYLLVQQTMTQPLMKDYVPFPWASMVQVKSEHFRALSHYYAA 375          
BLAST of Programmed cell death 6-interacting protein vs. Planmine SMEST
Match: SMESG000019014.1 (SMESG000019014.1)

HSP 1 Score: 1566.59 bits (4055), Expect = 0.000e+0
Identity = 762/765 (99.61%), Postives = 763/765 (99.74%), Query Frame = 3
Query:   15 MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATSGGTELSAQQPVQSEVPARPPPTYQTQNSGQPNV 2309
            MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRD+FEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSD SSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATSGGTELSAQQPVQSEVPARPPPTYQT NSGQPNV
Sbjct:    1 MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINKDFRDLFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLLDQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQDQFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDGSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKTEKEELMKDLQSAIVREKSEAHPIRNSNIQATSGGTELSAQQPVQSEVPARPPPTYQTPNSGQPNV 765          
BLAST of Programmed cell death 6-interacting protein vs. Planmine SMEST
Match: SMESG000061288.1 (SMESG000061288.1)

HSP 1 Score: 135.191 bits (339), Expect = 7.943e-32
Identity = 161/727 (22.15%), Postives = 327/727 (44.98%), Query Frame = 3
Query:    9 FPMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAEN-GVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIF-SYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLN----SVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFG----------EQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLE-NPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLL---DQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALC---AEAEKLKSTRNGLIQDLTNLETSSIGNTLSNA-LSSDPELNQDQFVDGQLNK---LLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFAR 2108
             P   +IS+  K+  E      +  Y++  Y E  ++    AF +F ++R   +     ++ + L ++ RY  Q   L+++ P++ N  + + + W+D+           ++ +A   +E   +LFNI +++  +    +  D    K A  +FQ +A  F + L    P  +      DL  D L  LN++MLAQA E +  K++ D  + G  AKI  Q++D Y     L++      +V +   K+W      K+  Y  ++ YY       +  +G          E++ +  KS+  +K++S  A +  +F  ++  +  +LE+  K+NN +Y+D +P+   L  +   +L + I  + N      +DIF  ++P+  H + ++   K+A +  +      E +  +   +  +       +    +VP  L S AA +  +  +     + N + D+++ +IE+ +E++++L N   + K +              K  +SW+   Q+Y   +   + AK S+D +R  +     D  L+ Q   T+  S+P  + +   E +D IK+++   C    + E++ S R+ L   L  L+T  + + L+   LSS+ +  +++ ++  L K   L+  +R+ +SA     + +                   +R  V+S ++ +F+ + ++    EEG+ FY  L+D + K Q  V  F  A+
Sbjct:    4 LPRISMISLDLKESSEAPDFSPLYKYIESQYNENSENY-KEAFKDFLHLRKTSVSG--SENLNCLTSMKRYYSQLQLLKARFPLSTNESIAVTWFWEDS-------NTNTTVSLADVRFEEASILFNIGSLHCNLGAKESRVDLDSTKIACTHFQCSAWAFQTILDKYTPLSVA-----DLECDLLRFLNLLMLAQAHECVLEKSMVDQRRAGITAKIAFQISDFYKQCQGLLRSENIGYAVNSRQYKNWKRTCILKEHLYFCLSYYYMGLMAEEANKYGDIVAWMKLAKEKLDKCLKSVKELKSSS--ADETIKFVQDV--VNGKLESSVKDNNFVYYDKVPEPDMLPPIKGAMLLKGIGFDVNDPEIIGKDIFHSLIPMETHFSSSVYSEKKAEVLRSIQNDADEKNEEIKQFLMDMQWDNETLSLSDSKVPQELYSCAAFIAVNPDI--FSTIKNMMQDISSISIEV-EESLEVLSNRMRTIKNV--------------KALDSWKSIEQEYSEFISNFEDAKESNDQLREAFACTLGDFTLVQQPMSTVIDSLP--SVTEISENAD-IKKLIEESCRLLGKVEEMMSQRSDL---LVQLKTQMMEDDLTQQLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMSAQTRIMDAIVEHNAHIAGFKMQILEIKQEREKVISRIIRSFNLYKDIIKKGEEGIAFYRKLSDRITKLQKDVDRFIPAK 688          
BLAST of Programmed cell death 6-interacting protein vs. Planmine SMEST
Match: SMESG000061288.1 (SMESG000061288.1)

HSP 1 Score: 135.191 bits (339), Expect = 8.360e-32
Identity = 161/727 (22.15%), Postives = 327/727 (44.98%), Query Frame = 3
Query:    9 FPMSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAEN-GVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIF-SYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLN----SVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFG----------EQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLE-NPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLL---DQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALC---AEAEKLKSTRNGLIQDLTNLETSSIGNTLSNA-LSSDPELNQDQFVDGQLNK---LLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFAR 2108
             P   +IS+  K+  E      +  Y++  Y E  ++    AF +F ++R   +     ++ + L ++ RY  Q   L+++ P++ N  + + + W+D+           ++ +A   +E   +LFNI +++  +    +  D    K A  +FQ +A  F + L    P  +      DL  D L  LN++MLAQA E +  K++ D  + G  AKI  Q++D Y     L++      +V +   K+W      K+  Y  ++ YY       +  +G          E++ +  KS+  +K++S  A +  +F  ++  +  +LE+  K+NN +Y+D +P+   L  +   +L + I  + N      +DIF  ++P+  H + ++   K+A +  +      E +  +   +  +       +    +VP  L S AA +  +  +     + N + D+++ +IE+ +E++++L N   + K +              K  +SW+   Q+Y   +   + AK S+D +R  +     D  L+ Q   T+  S+P  + +   E +D IK+++   C    + E++ S R+ L   L  L+T  + + L+   LSS+ +  +++ ++  L K   L+  +R+ +SA     + +                   +R  V+S ++ +F+ + ++    EEG+ FY  L+D + K Q  V  F  A+
Sbjct:    4 LPRISMISLDLKESSEAPDFSPLYKYIESQYNENSENY-KEAFKDFLHLRKTSVSG--SENLNCLTSMKRYYSQLQLLKARFPLSTNESIAVTWFWEDS-------NTNTTVSLADVRFEEASILFNIGSLHCNLGAKESRVDLDSTKIACTHFQCSAWAFQTILDKYTPLSVA-----DLECDLLRFLNLLMLAQAHECVLEKSMVDQRRAGITAKIAFQISDFYKQCQGLLRSENIGYAVNSRQYKNWKRTCILKEHLYFCLSYYYMGLMAEEANKYGDIVAWMKLAKEKLDKCLKSVKELKSSS--ADETIKFVQDV--VNGKLESSVKDNNFVYYDKVPEPDMLPPIKGAMLLKGIGFDVNDPEIIGKDIFHSLIPMETHFSSSVYSEKKAEVLRSIQNDADEKNEEIKQFLMDMQWDNETLSLSDSKVPQELYSCAAFIAVNPDI--FSTIKNMMQDISSISIEV-EESLEVLSNRMRTIKNV--------------KALDSWKSIEQEYSEFISNFEDAKESNDQLREAFACTLGDFTLVQQPMSTVIDSLP--SVTEISENAD-IKKLIEESCRLLGKVEEMMSQRSDL---LVQLKTQMMEDDLTQQLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMSAQTRIMDAIVEHNAHIAGFKMQILEIKQEREKVISRIIRSFNLYKDIIKKGEEGIAFYRKLSDRITKLQKDVDRFIPAK 688          
BLAST of Programmed cell death 6-interacting protein vs. Planmine SMEST
Match: SMESG000061288.1 (SMESG000061288.1)

HSP 1 Score: 133.265 bits (334), Expect = 2.944e-31
Identity = 160/722 (22.16%), Postives = 326/722 (45.15%), Query Frame = 3
Query:   24 LISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSKMLCKIFDKHESTLNALTRYLDQFVALESKIPIAEN-GVRIDFKWDDAFAKDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKYFQQAAGIF-SYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLN----SVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFG----------EQISRFRKSIDLMKTASTRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLE-NPINKDFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASLNLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIEILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLL---DQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSIKEVLRALC---AEAEKLKSTRNGLIQDLTNLETSSIGNTLSNA-LSSDPELNQDQFVDGQLNK---LLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRASVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFAR 2108
            +IS+  K+  E      +  Y++  Y E  ++    AF +F ++R   +     ++ + L ++ RY  Q   L+++ P++ N  + + + W+D+           ++ +A   +E   +LFNI +++  +    +  D    K A  +FQ +A  F + L    P  +      DL  D L  LN++MLAQA E +  K++ D  + G  AKI  Q++D Y     L++      +V +   K+W      K+  Y  ++ YY       +  +G          E++ +  KS+  +K++S  A +  +F  ++  +  +LE+  K+NN +Y+D +P+   L  +   +L + I  + N      +DIF  ++P+  H + ++   K+A +  +      E +  +   +  +       +    +VP  L S AA +  +  +     + N + D+++ +IE+ +E++++L N   + K +              K  +SW+   Q+Y   +   + AK S+D +R  +     D  L+ Q   T+  S+P  + +   E +D IK+++   C    + E++ S R+ L   L  L+T  + + L+   LSS+ +  +++ ++  L K   L+  +R+ +SA     + +                   +R  V+S ++ +F+ + ++    EEG+ FY  L+D + K Q  V  F  A+
Sbjct:    1 MISLDLKESSEAPDFSPLYKYIESQYNENSENY-KEAFKDFLHLRKTSVSG--SENLNCLTSMKRYYSQLQLLKARFPLSTNESIAVTWFWEDS-------NTNTTVSLADVRFEEASILFNIGSLHCNLGAKESRVDLDSTKIACTHFQCSAWAFQTILDKYTPLSVA-----DLECDLLRFLNLLMLAQAHECVLEKSMVDQRRAGITAKIAFQISDFYKQCQGLLRSENIGYAVNSRQYKNWKRTCILKEHLYFCLSYYYMGLMAEEANKYGDIVAWMKLAKEKLDKCLKSVKELKSSS--ADETIKFVQDV--VNGKLESSVKDNNFVYYDKVPEPDMLPPIKGAMLLKGIGFDVNDPEIIGKDIFHSLIPMETHFSSSVYSEKKAEVLRSIQNDADEKNEEIKQFLMDMQWDNETLSLSDSKVPQELYSCAAFIAVNPDI--FSTIKNMMQDISSISIEV-EESLEVLSNRMRTIKNV--------------KALDSWKSIEQEYSEFISNFEDAKESNDQLREAFACTLGDFTLVQQPMSTVIDSLP--SVTEISENAD-IKKLIEESCRLLGKVEEMMSQRSDL---LVQLKTQMMEDDLTQQLLSSNNDSERNRIIEEGLKKHSELIDYLRQNMSAQTRIMDAIVEHNAHIAGFKMQILEIKQEREKVISRIIRSFNLYKDIIKKGEEGIAFYRKLSDRITKLQKDVDRFIPAK 680          
BLAST of Programmed cell death 6-interacting protein vs. Planmine SMEST
Match: SMESG000055804.1 (SMESG000055804.1)

HSP 1 Score: 69.707 bits (169), Expect = 3.970e-12
Identity = 69/297 (23.23%), Postives = 127/297 (42.76%), Query Frame = 3
Query:  279 IDFKWDDAFA-KDSLFGKKGSLKIASGGYERICVLFNIAAMYSQVA------ETANLSDDSGLKTAAKYFQQAAGIFSYLRSSV-----PNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTKAVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQAGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTA---------------STRAGQKFQFRSELERMKRELETVEKENNLIYHDSIPD-VATLSIVAKVILAREISLENP-INKDFRDIF 1082
            ++F+W  + + K  L      L++    +E + ++ N+A  Y++ A      E+ N+ D    K   K  + AAGIF+ ++++      P I+ +  T D++   L A      A+AQE+   +A+   H    IA +  + + ++      +   + KA+    W   +  K A Y A A  Y  +        GE I+  ++ + L + +               + R  +   FR     ++R  E   +EN LIYH  +PD +  L + A   LA   SL+ P IN  ++  +
Sbjct:   88 LNFRWSQSLSIKGDL-----PLELTDAMFEFVNMMINVALWYTKHAAKVSAKESVNMED---AKETHKCLRTAAGIFTEIKNTYISQLGPTIMNKSKTTDIDDQILEAYINQCTAEAQEITMARAIELEHSPSIIASLAFETSKMFECAALALSGGNEKAV--TKWQRYLEFKCACYRAYAYSYHGEQKLKEDKAGEAIAALKEGLKLYQESEVKIKEYSKAPGPGMTARPQEHLFFRKLGPFLQRTYEKCNRENGLIYHQKVPDSIPILELKATYGLASPESLKLPEINPAWKGAY 374          
The following BLAST results are available for this feature:
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDCD6IP2.106e-16937.97programmed cell death 6 interacting protein [Sourc... [more]
PDCD6IP1.148e-16737.60programmed cell death 6 interacting protein [Sourc... [more]
PDCD6IP2.186e-5643.10programmed cell death 6 interacting protein [Sourc... [more]
PTPN232.102e-3823.00protein tyrosine phosphatase non-receptor type 23 ... [more]
PDCD6IP6.313e-2029.06programmed cell death 6 interacting protein [Sourc... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alx-17.546e-16735.95Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-15.882e-16637.21Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-12.400e-16537.21Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-12.400e-16537.21Apoptosis-linked gene 2-interacting protein X 1 [... [more]
alx-11.964e-8238.83Apoptosis-linked gene 2-interacting protein X 1 [... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ALiX0.000e+039.10gene:FBgn0086346 transcript:FBtr0085241[more]
mop9.214e-3322.70gene:FBgn0036448 transcript:FBtr0075700[more]
Rhp2.982e-1825.75gene:FBgn0026374 transcript:FBtr0074095[more]
Rhp2.982e-1825.75gene:FBgn0026374 transcript:FBtr0074096[more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd6ip2.574e-17037.79programmed cell death 6 interacting protein [Sourc... [more]
ptpn23b1.762e-4124.10protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn23a9.838e-4123.00protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn23b1.299e-3823.78protein tyrosine phosphatase, non-receptor type 23... [more]
ptpn23a3.948e-3622.42protein tyrosine phosphatase, non-receptor type 23... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd6ip1.741e-16837.90programmed cell death 6 interacting protein [Sourc... [more]
pdcd6ip2.311e-16737.66programmed cell death 6 interacting protein [Sourc... [more]
pdcd6ip6.934e-16437.29programmed cell death 6 interacting protein [Sourc... [more]
pdcd6ip3.549e-13934.55programmed cell death 6 interacting protein [Sourc... [more]
pdcd6ip7.659e-13033.47programmed cell death 6 interacting protein [Sourc... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdcd6ip1.784e-16938.37programmed cell death 6 interacting protein [Sourc... [more]
Pdcd6ip5.237e-16837.98programmed cell death 6 interacting protein [Sourc... [more]
Ptpn236.926e-4123.67protein tyrosine phosphatase, non-receptor type 23... [more]
Rhpn21.959e-1827.27rhophilin, Rho GTPase binding protein 2 [Source:MG... [more]
Rhpn21.959e-1827.27rhophilin, Rho GTPase binding protein 2 [Source:MG... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QZA2|PDC6I_RAT3.682e-16937.87Programmed cell death 6-interacting protein OS=Rat... [more]
sp|Q8WUM4|PDC6I_HUMAN1.011e-16837.97Programmed cell death 6-interacting protein OS=Hom... [more]
sp|Q9WU78|PDC6I_MOUSE1.248e-16838.37Programmed cell death 6-interacting protein OS=Mus... [more]
sp|Q9W6C5|PDC6I_XENLA9.464e-16537.48Programmed cell death 6-interacting protein OS=Xen... [more]
sp|P34552|ALXA_CAEEL3.053e-16437.21Apoptosis-linked gene 2-interacting protein X 1 OS... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PRN00.000e+044.15BRO1 domain-containing protein OS=Pomacea canalicu... [more]
K1P3Q50.000e+041.24Programmed cell death 6-interacting protein OS=Cra... [more]
A0A433U8B50.000e+043.60BRO1 domain-containing protein OS=Elysia chlorotic... [more]
A0A3Q9HE660.000e+041.56Alg-2-Interacting Protein X OS=Hirudo medicinalis ... [more]
A0A210QJ070.000e+041.19Programmed cell death 6-interacting protein OS=Miz... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd6ip2.352e-17037.57programmed cell death 6 interacting protein [Sourc... [more]
ptpn23a3.889e-4223.20protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23a5.278e-4123.31protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23a1.173e-3622.67protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23b6.161e-3625.34protein tyrosine phosphatase, non-receptor type 23... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pdcd6ip3.118e-7038.02programmed cell death 6 interacting protein [Sourc... [more]
ptpn23b2.012e-3922.22protein tyrosine phosphatase, non-receptor type 23... [more]
ENSPMAT00000004835.19.351e-2026.69pep scaffold:Pmarinus_7.0:GL480606:4394:25584:1 ge... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RIM202.626e-3023.58Protein involved in proteolytic activation of Rim1... [more]
BRO14.876e-2022.77Cytoplasmic class E vacuolar protein sorting (VPS)... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO457951.519e-17038.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345258.820e-1626.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430061.045e-924.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcd6ip4.758e-17839.36programmed cell death 6 interacting protein [Sourc... [more]
ptpn23a3.704e-4123.15protein tyrosine phosphatase non-receptor type 23 ... [more]
ptpn23a7.075e-3622.51protein tyrosine phosphatase non-receptor type 23 ... [more]
rhpn21.162e-2026.89rhophilin Rho GTPase binding protein 2 [Source:NCB... [more]
rhpn12.228e-1826.52rhophilin Rho GTPase binding protein 1 [Source:NCB... [more]
back to top
BLAST of Programmed cell death 6-interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019014.10.000e+099.61SMESG000019014.1[more]
SMESG000061288.17.943e-3222.15SMESG000061288.1[more]
SMESG000061288.18.360e-3222.15SMESG000061288.1[more]
SMESG000061288.12.944e-3122.16SMESG000061288.1[more]
SMESG000055804.13.970e-1223.23SMESG000055804.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024174 ID=SMED30024174|Name=Programmed cell death 6-interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2765bp
TCAGTTAATTTCCTATGTCTCAACTTATCTCTGTGCCTTGTAAAAAGGGC
TATGAAATTAAATTTATAGAAGTTATTTCTGCTTATGTTAAAGAGATATA
TGGTGAAGAACAGCAAAGTAGTAACGCAAATGCATTTACGGAATTCAATA
ATATGCGATCAAAGATGCTTTGTAAAATATTCGACAAACACGAATCAACT
TTAAATGCTTTAACAAGATATCTGGATCAGTTTGTTGCACTTGAAAGTAA
GATCCCAATAGCTGAAAATGGAGTTAGAATTGATTTTAAATGGGATGATG
CATTCGCAAAAGATTCTTTATTTGGCAAAAAAGGATCATTAAAAATAGCG
TCGGGTGGCTATGAAAGAATTTGTGTTTTATTTAATATTGCTGCAATGTA
TTCGCAAGTGGCGGAAACTGCAAATTTATCTGATGATAGTGGCCTAAAAA
CTGCAGCTAAATATTTTCAGCAAGCAGCTGGAATATTTTCCTACTTGAGG
TCGAGCGTTCCTAATATCATCCAACGTGAACCAACTTACGATTTAAATGG
AGATACTCTTAGTGCATTAAATGTTATAATGTTGGCTCAAGCCCAAGAAC
TAATTTATACTAAAGCAGTCAGAGATTCTCACAAAGACGGCAACATTGCT
AAAATCGTTCAACAGGTTGCCGACCTGTATGCAGATGGTCTGAAATTAAT
GCAATTAAATTCCGTGAAAGCAATTTGGCCTAAGGATTGGATTCCGATCG
TAGCGGGAAAACAGGCCGGTTATCATGCAATGGCCGAATATTATCAAGCT
AAATCGTGTGGTGGAAGTCAAATGTTCGGTGAACAGATATCGCGATTTAG
AAAATCAATAGATTTAATGAAAACTGCCAGTACTAGAGCTGGGCAGAAAT
TTCAGTTCCGTTCCGAGTTAGAGCGAATGAAACGAGAACTGGAAACAGTG
GAAAAGGAAAACAATTTAATTTACCATGACTCAATTCCTGACGTAGCTAC
ATTATCGATTGTAGCCAAAGTTATTTTAGCGCGAGAAATATCCTTAGAGA
ATCCTATTAATAAAGATTTCAGAGATATATTCGAAAAAATCGTTCCTCTA
TCTATGCATTCAGCAATGACATTGCTACAGAATAAACGAGCTGCAATGAC
AAATGCAGAAATCTATCGCTTGAAAGAAGCCAGCAATACATTGAGTGGTG
TTATGGCTTCATTGAATCTCCCGGGAGCACTGGACAACACCAGGGGCGAT
GAAGTTCCCGATAATTTACTATCCAAGGCCGCTATTGTGAGAAAGGACGG
CGGAGTTGAAAAGCTGGATGACCTATTGAATCGATTGCCAGATGTGACGA
CGAGAAATATTGAGATTCTCCAAGAAGCTGTTAAATTGCTTGACAACGAA
GAGAATTCCGACAAACAATTAAAGGATCAATTTAAAGATCGATGGAGTCG
AACTCCGTCCGGGAAATTGACGGAGTCTTGGCGAGGAGAAATCCAAAAAT
ATCAAGTATTACTTGATCAAGCCAAGTCATCAGATGACATCGTGCGCACC
AATTACAAGCAGTTTGCTAGAGATATTCGCTTGCTGAGTCAAAATGAAGA
AACCCTAAAGCAAAGTATTCCGAAATCTAACTCATCGAGTACCGGCGAAC
GATCTGATTCCATCAAAGAAGTGTTGCGTGCTTTATGCGCCGAGGCAGAG
AAATTGAAGTCCACTCGCAACGGTTTAATTCAAGATTTGACCAATTTGGA
AACCAGCAGCATTGGAAATACGCTGAGTAATGCTTTATCAAGTGATCCGG
AGTTGAATCAAGATCAATTTGTCGATGGTCAACTGAATAAACTCCTGGCA
CCTATCAGAGAAAAAGTCAGTGCATCGATCAATAGCCAAGAAAAACTGAC
AGCTCAGATGCAAGAAAAATGCAAAATGCTAAATAGTGACAGCTCCAGTG
GAACTGACCGAGCTAGCGTGTTATCTGCATTGCTATTGGCTTTCGATAAA
TTCCATGAGCTCAAAAGCAATCTTGAAGAAGGCCTGAAATTCTACGGCGA
TTTAACTGATATTCTGCTAAAATTCCAAAACAAGGTTCAAGATTTCTGTT
TCGCAAGAAAAACTGAAAAAGAAGAACTGATGAAAGATCTTCAGTCTGCA
ATAGTTCGAGAGAAATCCGAAGCTCACCCGATCCGAAATTCGAATATTCA
GGCCACATCGGGAGGAACAGAATTGTCAGCACAACAGCCAGTCCAAAGTG
AAGTTCCTGCCAGACCTCCTCCAACATACCAAACACAAAATTCCGGACAA
CCTAATGTACCAATGGCAGCAGCTGGTGCCAGTGCACCGCCTAGTCAACC
TGCACCGATGGGATTGCCGTATCCACCCAATCCATATGGCAACATGCCGC
CGCCGCATCACCCGCCATATATGCCAGGCGTTCCGTACTCACAATATCCT
TATCCGCCGCAACAAGCGCCCATGCAACCCGGTCAAATGCCACAGTATCC
TCCAACTGGATACAATTATCCCCCAAATTACAACACTTATCCTGGTTACA
ATCCATATTATCCTCCCCGTTAAGGGGGCACACAACTTACTATTTGACTG
ATGAATAAATATTGATATTCGTTGCTGTTGTTGTTAGTCTCAGTCAATAT
GAGCGTTTATTCTTTTTGAATTATTAATGTTCATTACGCGCAGAGTGGGC
CAATAAACATGCCGCAGCATCCAGTTATTGTATGGATAGATGGAGCAGAA
TGACTGGAACAGAAT
back to top

protein sequence of SMED30024174-orf-1

>SMED30024174-orf-1 ID=SMED30024174-orf-1|Name=SMED30024174-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=853bp
MSQLISVPCKKGYEIKFIEVISAYVKEIYGEEQQSSNANAFTEFNNMRSK
MLCKIFDKHESTLNALTRYLDQFVALESKIPIAENGVRIDFKWDDAFAKD
SLFGKKGSLKIASGGYERICVLFNIAAMYSQVAETANLSDDSGLKTAAKY
FQQAAGIFSYLRSSVPNIIQREPTYDLNGDTLSALNVIMLAQAQELIYTK
AVRDSHKDGNIAKIVQQVADLYADGLKLMQLNSVKAIWPKDWIPIVAGKQ
AGYHAMAEYYQAKSCGGSQMFGEQISRFRKSIDLMKTASTRAGQKFQFRS
ELERMKRELETVEKENNLIYHDSIPDVATLSIVAKVILAREISLENPINK
DFRDIFEKIVPLSMHSAMTLLQNKRAAMTNAEIYRLKEASNTLSGVMASL
NLPGALDNTRGDEVPDNLLSKAAIVRKDGGVEKLDDLLNRLPDVTTRNIE
ILQEAVKLLDNEENSDKQLKDQFKDRWSRTPSGKLTESWRGEIQKYQVLL
DQAKSSDDIVRTNYKQFARDIRLLSQNEETLKQSIPKSNSSSTGERSDSI
KEVLRALCAEAEKLKSTRNGLIQDLTNLETSSIGNTLSNALSSDPELNQD
QFVDGQLNKLLAPIREKVSASINSQEKLTAQMQEKCKMLNSDSSSGTDRA
SVLSALLLAFDKFHELKSNLEEGLKFYGDLTDILLKFQNKVQDFCFARKT
EKEELMKDLQSAIVREKSEAHPIRNSNIQATSGGTELSAQQPVQSEVPAR
PPPTYQTQNSGQPNVPMAAAGASAPPSQPAPMGLPYPPNPYGNMPPPHHP
PYMPGVPYSQYPYPPQQAPMQPGQMPQYPPTGYNYPPNYNTYPGYNPYYP
PR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000281mitotic cytokinesis
GO:0000915actomyosin contractile ring assembly
GO:0006810transport
GO:0006915apoptotic process
GO:0007049cell cycle
GO:0015031protein transport
GO:0045199maintenance of epithelial cell apical/basal polarity
GO:0051301cell division
GO:0070830bicellular tight junction assembly
GO:0090559regulation of membrane permeability
Vocabulary: cellular component
TermDefinition
GO:0005923bicellular tight junction
GO:0030054cell junction
GO:0090543Flemming body
GO:0005576extracellular region
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0042470melanosome
GO:0042641actomyosin
GO:0070062extracellular exosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038499BRO1_sf
IPR004328BRO1_dom
IPR025304ALIX_V_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017124SH3 domain binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 452..472
NoneNo IPR availableCOILSCoilCoilcoord: 561..581
NoneNo IPR availableCOILSCoilCoilcoord: 699..719
NoneNo IPR availableCOILSCoilCoilcoord: 295..322
NoneNo IPR availableGENE3DG3DSA:1.20.120.560coord: 367..641
e-value: 8.4E-82
score: 276.8
NoneNo IPR availableGENE3DG3DSA:1.20.140.50coord: 410..698
e-value: 8.4E-82
score: 276.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 716..759
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 723..745
NoneNo IPR availablePANTHERPTHR23030:SF22PROGRAMMED CELL DEATH 6-INTERACTING PROTEINcoord: 1..815
NoneNo IPR availablePANTHERPTHR23030PCD6 INTERACTING PROTEIN-RELATEDcoord: 1..815
IPR004328BRO1 domainSMARTSM01041BRO1_2coord: 3..383
e-value: 1.6E-110
score: 383.2
IPR004328BRO1 domainPFAMPF03097BRO1coord: 4..376
e-value: 2.0E-99
score: 333.1
IPR004328BRO1 domainPROSITEPS51180BRO1coord: 3..397
score: 48.286
IPR025304ALIX V-shaped domainPFAMPF13949ALIX_LYPXL_bndcoord: 414..701
e-value: 7.9E-73
score: 245.3
IPR038499BRO1 domain superfamilyGENE3DG3DSA:1.25.40.280coord: 2..360
e-value: 3.7E-107
score: 360.5