SMED30024157

Overview
NameSMED30024157
Smed IDSMED30024157
Length (bp)1667
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024157 (SMED30024157) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024157 (SMED30024157) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024157 (SMED30024157) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024157 (SMED30024157) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024157

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30024157SMESG000051501.1 SmedASXL_015504SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30024157SMESG000051501.1 dd_Smed_v4_12598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024157SMESG000051501.1 dd_Smed_v4_12598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30024157SMESG000051501.1 dd_Smed_v4_12598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30024157SMESG000051501.1 dd_Smed_v4_12598_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30024157 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000487:147532..158203 -7075
Homology
BLAST of SMED30024157 vs. Ensembl Human
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 56.225 bits (134), Expect = 1.119e-7
Identity = 91/426 (21.36%), Postives = 175/426 (41.08%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNIST--TSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDY-FKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    NL  + +   R+   P   F  LS L ++ ++E  I  + D +F++  N+K L  +   +L  IS  +      +E++ L   N++   T     L  +          NN+    F   +  KH + D   L+     NS +  NL +  V    N   +   +  +KHL+  T +     N+ +     + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L W+    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  101 FNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLE-VGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVT---NTNLSTVPFLAFKHLVYLTHL-----NLSYNPISTIEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRQPTLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. Ensembl Human
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 56.225 bits (134), Expect = 1.119e-7
Identity = 91/426 (21.36%), Postives = 175/426 (41.08%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNIST--TSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDY-FKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    NL  + +   R+   P   F  LS L ++ ++E  I  + D +F++  N+K L  +   +L  IS  +      +E++ L   N++   T     L  +          NN+    F   +  KH + D   L+     NS +  NL +  V    N   +   +  +KHL+  T +     N+ +     + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L W+    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  101 FNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLE-VGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVT---NTNLSTVPFLAFKHLVYLTHL-----NLSYNPISTIEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRQPTLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. Ensembl Human
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 56.225 bits (134), Expect = 1.119e-7
Identity = 91/426 (21.36%), Postives = 175/426 (41.08%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNIST--TSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDY-FKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    NL  + +   R+   P   F  LS L ++ ++E  I  + D +F++  N+K L  +   +L  IS  +      +E++ L   N++   T     L  +          NN+    F   +  KH + D   L+     NS +  NL +  V    N   +   +  +KHL+  T +     N+ +     + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L W+    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  101 FNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLE-VGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVT---NTNLSTVPFLAFKHLVYLTHL-----NLSYNPISTIEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRQPTLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. Ensembl Xenopus
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:NCBI gene;Acc:100490134])

HSP 1 Score: 51.2174 bits (121), Expect = 4.026e-6
Identity = 88/421 (20.90%), Postives = 172/421 (40.86%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELR---LIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQAN----DQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITI-ATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    NL  +S+   R+   P   F  LS L ++ ++E  I  + D +F++  ++K L  +    L  IS  +      +E++ L   N++         + +     L + N      F+     H +  E+    L+     NS +  NL    +    N   +   +   KHLI  T +     N+ +    ++ +G F+++ +L      ++G     + P+ FQ L +L   + S N +  L E+     K  +++   +NPL C C L W+   +P +     + + ++     +S  +V++     FY    C  PK        +++L++ + E        + +Q+ C A GDP P + ++     T    SL      T+       IR++Q+ +   Y    C+ +N+ G
Sbjct:  105 FNSLFNLRSLSLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHSLKSLE-VGDNELVYISHRAFSGLVSLEQLTLEKCNLTAVPTDALSHLHNLYSLHLKYLNINVLPPFAFKRLFHLKILEISYWPLLDLVPANSLYGLNLTFLSIT---NTNLSTIPYHALKHLIYLTHL-----NLSYNPIGIIDTGVFSDLVRL--QELHLVGAQLRTIEPHAFQGLRFLRLLNVSQNLLETLEENAFQSPKALEVLCIDDNPLVCDCRLIWMLQRHPMLHFGGQQPMCSSPDSLKESSYKVLDAAVLSFY--FTCKKPKI-----RDREMLQVHVDE-------GQRVQMNCNADGDPQPMISWVTPRRRTV---SLKSNGRTTVLGNGTLEIRYAQIQDTGTY---ICVASNAAG 494          
BLAST of SMED30024157 vs. Ensembl Mouse
Match: Lingo2 (leucine rich repeat and Ig domain containing 2 [Source:MGI Symbol;Acc:MGI:2442298])

HSP 1 Score: 53.9138 bits (128), Expect = 4.772e-7
Identity = 90/423 (21.28%), Postives = 159/423 (37.59%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    +L  +++ KC +   P+    +L  L  +HL  LNI  +P   FK           HL NLE I  + L D       +L GLN+++ SI                N NL  + F +  FKH  +                       ++L +N IS                               + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L WL    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  173 FSGLLSLEQLTLEKCNLTAVPTEALSHLRSLIALHLKHLNINNMPVYAFKR--------LFHLKNLE-IDYWPLLDLMPAN--SLYGLNLTSLSIT---------------NTNLSTVPFLA--FKHLVY--------------------LTHLNLSYNPIST------------------------------IEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWLLQRQPNLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECNADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. Ensembl Mouse
Match: Lingo2 (leucine rich repeat and Ig domain containing 2 [Source:MGI Symbol;Acc:MGI:2442298])

HSP 1 Score: 53.9138 bits (128), Expect = 4.772e-7
Identity = 90/423 (21.28%), Postives = 159/423 (37.59%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    +L  +++ KC +   P+    +L  L  +HL  LNI  +P   FK           HL NLE I  + L D       +L GLN+++ SI                N NL  + F +  FKH  +                       ++L +N IS                               + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L WL    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  173 FSGLLSLEQLTLEKCNLTAVPTEALSHLRSLIALHLKHLNINNMPVYAFKR--------LFHLKNLE-IDYWPLLDLMPAN--SLYGLNLTSLSIT---------------NTNLSTVPFLA--FKHLVY--------------------LTHLNLSYNPIST------------------------------IEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWLLQRQPNLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECNADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. Ensembl Mouse
Match: Lingo2 (leucine rich repeat and Ig domain containing 2 [Source:MGI Symbol;Acc:MGI:2442298])

HSP 1 Score: 53.9138 bits (128), Expect = 4.772e-7
Identity = 90/423 (21.28%), Postives = 159/423 (37.59%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    +L  +++ KC +   P+    +L  L  +HL  LNI  +P   FK           HL NLE I  + L D       +L GLN+++ SI                N NL  + F +  FKH  +                       ++L +N IS                               + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L WL    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  173 FSGLLSLEQLTLEKCNLTAVPTEALSHLRSLIALHLKHLNINNMPVYAFKR--------LFHLKNLE-IDYWPLLDLMPAN--SLYGLNLTSLSIT---------------NTNLSTVPFLA--FKHLVY--------------------LTHLNLSYNPIST------------------------------IEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWLLQRQPNLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECNADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. Ensembl Mouse
Match: Lingo2 (leucine rich repeat and Ig domain containing 2 [Source:MGI Symbol;Acc:MGI:2442298])

HSP 1 Score: 53.9138 bits (128), Expect = 4.772e-7
Identity = 90/423 (21.28%), Postives = 159/423 (37.59%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    +L  +++ KC +   P+    +L  L  +HL  LNI  +P   FK           HL NLE I  + L D       +L GLN+++ SI                N NL  + F +  FKH  +                       ++L +N IS                               + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L WL    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  173 FSGLLSLEQLTLEKCNLTAVPTEALSHLRSLIALHLKHLNINNMPVYAFKR--------LFHLKNLE-IDYWPLLDLMPAN--SLYGLNLTSLSIT---------------NTNLSTVPFLA--FKHLVY--------------------LTHLNLSYNPIST------------------------------IEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWLLQRQPNLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECNADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. Ensembl Mouse
Match: Lingo2 (leucine rich repeat and Ig domain containing 2 [Source:MGI Symbol;Acc:MGI:2442298])

HSP 1 Score: 53.9138 bits (128), Expect = 4.772e-7
Identity = 90/423 (21.28%), Postives = 159/423 (37.59%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    +L  +++ KC +   P+    +L  L  +HL  LNI  +P   FK           HL NLE I  + L D       +L GLN+++ SI                N NL  + F +  FKH  +                       ++L +N IS                               + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L WL    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  173 FSGLLSLEQLTLEKCNLTAVPTEALSHLRSLIALHLKHLNINNMPVYAFKR--------LFHLKNLE-IDYWPLLDLMPAN--SLYGLNLTSLSIT---------------NTNLSTVPFLA--FKHLVY--------------------LTHLNLSYNPIST------------------------------IEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWLLQRQPNLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECNADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. UniProt/SwissProt
Match: sp|Q7L985|LIGO2_HUMAN (Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=LINGO2 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 5.375e-7
Identity = 91/426 (21.36%), Postives = 175/426 (41.08%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNIST--TSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDY-FKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    NL  + +   R+   P   F  LS L ++ ++E  I  + D +F++  N+K L  +   +L  IS  +      +E++ L   N++   T     L  +          NN+    F   +  KH + D   L+     NS +  NL +  V    N   +   +  +KHL+  T +     N+ +     + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L W+    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  101 FNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLE-VGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVT---NTNLSTVPFLAFKHLVYLTHL-----NLSYNPISTIEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRQPTLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. UniProt/SwissProt
Match: sp|Q3URE9|LIGO2_MOUSE (Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.338e-6
Identity = 90/423 (21.28%), Postives = 159/423 (37.59%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIG--FHKMFPYIFQNLSYL---DASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKS-----HCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFIN-----FNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    +L  +++ KC +   P+    +L  L  +HL  LNI  +P   FK           HL NLE I  + L D       +L GLN+++ SI                N NL  + F +  FKH  +                       ++L +N IS                               + +G F+++ +L      I+G     + P+ FQ L +L   + S N +  L E++    +  +++  +NNPL C C L WL    P ++    + + A   +  E   +++D F+  +      C  PK        KK+  + + E        + +QL C A GDP P + ++          + G++++       +      IR +Q  ++  Y    C+ +N+ G
Sbjct:  173 FSGLLSLEQLTLEKCNLTAVPTEALSHLRSLIALHLKHLNINNMPVYAFKR--------LFHLKNLE-IDYWPLLDLMPAN--SLYGLNLTSLSIT---------------NTNLSTVPFLA--FKHLVY--------------------LTHLNLSYNPIST------------------------------IEAGMFSDLIRL--QELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACDCRLLWLLQRQPNLQFGGQQPMCAGPDTIRE--RSFKD-FHSTALSFYFTCKKPKI-----REKKLQHLLVDE-------GQTVQLECNADGDPQPVISWVTPRRRFITTKSNGRATV-------LGDGTLEIRFAQDQDSGMY---VCIASNAAG 490          
BLAST of SMED30024157 vs. TrEMBL
Match: T1DF80 (LRFN-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.174e-12
Identity = 117/439 (26.65%), Postives = 174/439 (39.64%), Query Frame = 2
Query:  245 DFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNN-NLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEIS--NNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMK-YVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKI-----------KCSKVIQANDQSDIEVVENYQDPFYPKSHCYPP-KTYLEIESAKKILKISI-------------AEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKS 1474
            DF++  +L  I I  C I       F    +L  V L  L +  + +  FK+S N+  LS I+L NLE I    L +  +   + L  + IST  +   L  +  T++ L+W + N + L      F  ++   L L  N+I N  F    ++ ++ L  N +S  +NF    Y  L   T+VL + +  I G FP   S     +  L + +N I   +     +F NL + D S NRI  L   +  +  K        NPL C CE+ WL  +  K KI           K   +   N   DI   +   D       C+PP    L I   KK    ++              + T  +   + I L C  +GDP+PTL + N       +S LN    IT   S        LS + K     C  +N  G S
Sbjct:   82 DFEQLESLNSIIIKSCPIETISEKLFSKKEYLGSVTLENLPLRHLRNIFFKSS-NLIELSLINLYNLEYIDSHILENQNKFSRLKLKNVTISTDVLQTVLSPIKNTIRELSWTDVNHQILVIQPMLFSSYKLGLLDLSNNKIENWNFLIYTKSRKILLK-NTVSYTSNFLLSKYASLPQFTQVLDLENIGIFGQFPSNISKPMIFLKTLNVKSNLIDSLNDNIDQMFPNLLFFDISLNRIKHLQSKLNNFFYKTEYFKLEGNPLHCNCEIRWLF-ARYKSKIQDFPRCHFGFKKSESINNRNSLKDIYFSQLSTDSL----ACFPPLPPVLSISKGKKSTMFTVNSTDPQTNSSTISKQYTLVMDPHQRIDLSCETLGDPIPTLTWSNKKGKVLHRSVLN----ITTFNSAVNTVTVGLSASEKSLVYMCTASNIEGVS 509          
BLAST of SMED30024157 vs. TrEMBL
Match: R7TAS3 (Ig-like domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_52911 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.850e-11
Identity = 98/422 (23.22%), Postives = 183/422 (43.36%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYV-LKFRQIIFSNNPLFCGCELNWLR---NSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKT--IRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLN 1495
            F     L+ + +   +I Q  +  F  L  L+ + L + +IT I +  F+  +N+ RL+      L  IS  +     +VE++ +   ++S+ +    L+ +  +L+ L W NN K L+F+++ F  F F  L+L  N I + +F E +   E+ LD N I    D+  Y +L    K+     ++ +  F +V + +F ++T                     +LSYL    N I  LSE ++ + +  + ++   N L C CEL WL+    +   + I   + ++    S +  + +  D ++    C  P     I +  + L +S  E T          L CI  GDP PT+ + + N      +S+      T+  ++    IR + L +  +Y    C   N  G + +++ +N
Sbjct:   96 FSGLIKLITLDLRFNKIQQLQAYLFSGLIKLQTLRLEDNDITSIENFAFQ-GLNLTRLNLDRNEKLRDISGKAFHST-KVEQLRISNSSLSSET-AEALVPLKDSLRELHWQNNQKPLRFATEAFVGFTFRALKLNNNGIKDIDFLEGVVTDELSLDDNPIG-PIDFSRYPNLRQVRKL-----HLSNTSFSIVLASYFNDMT---------------------HLSYLGLEDNGISSLSEDLRPIFMGLQYLLLKGNTLHCNCELRWLKRWLTAESGVNINNGEALECVTPS-VRTITSMDDVYF---TCSEPV----IVTISRTLNVSEEEGT---------SLTCIGEGDPAPTIIWSSPNGDV---ASIPPPHSRTLTENQGIFHIRSASLHDRGEY---ACTAVNLAGNNTVKVHVN 464          
BLAST of SMED30024157 vs. TrEMBL
Match: A0A1I8IQ97 (Ig-like domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.228e-9
Identity = 88/392 (22.45%), Postives = 154/392 (39.29%), Query Frame = 2
Query:  275 ISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNL---KRLKFSSDYFKHFQ-FDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLIS-----DTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVL-------KFR-QIIFSNNPLFCGCELNW------LRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSH---CYPP-----KTYLEIESAKK----ILKISIAEMTFD---------LYSCEFIQLRCIAVGDPLPTLEFI 1318
            IS+  C I + P   F  L  L  V L  L    +P  +F++S +++ L      +  + S   L +   V ++ L G  +    +   +  +   L  L++NN       L+  +  F +    +EL L  NQ+ +  F E + A+ + L +N +     W               + L + H  +   FPL     F  + +L + NN I           + L+ LD  SN+I +L   +K  +       +F+  +  ++NP+ C CEL+W      L NS PK  + C+   +   +  I          + + H   C PP     + ++ +  +KK    +L         D         L +    QL C + GDP PTL ++
Sbjct:   79 ISVHNCPIVELPDELFAYLPLLSSVILRNLPFATLPPRLFRDSPSLRTLWLTQTPHYSRQSGRPLANTI-VSDLRLTGTGLDGAGLLDLIAPIAGRLHKLSFNNRASLAGPLRLPAGAFNNTSSLEELNLSNNQLTDFGFLEGVSASRLLLSYNPVG----WPGELSFAGLRPNWRPQALELNHAGLQ-RFPLGVETAFPALQELLLANNVIKELPAEPLLALKRLTQLDVGSNQIRRLGSELKPAMLALLYRDRFKGHVYLADNPVHCNCELSWIFDSAVLHNSLPK-NVLCASGGELGGKLLI----------WAQPHQLLCLPPSKPGIQVHIAVSKSKKPTFDMLNFQPVGNGADPLSDVQQHQLPAGSTAQLICSSDGDPAPTLRWL 453          
BLAST of SMED30024157 vs. TrEMBL
Match: I1ZII9 (Leucine rich repeat and fibronectin type III domain containing-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 8.516e-8
Identity = 63/267 (23.60%), Postives = 115/267 (43.07%), Query Frame = 2
Query:  581 NNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNE-ISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQAN---DQSDIEVVENYQDPFYPKSH-----CYPPKT-YLEIESAKKILKISIA-------------EMTFDLYSCEFIQLRCIAVGDPLPTL 1309
            NN ++ +K    +F  +Q   L +  N   + +F    ++ ++ L  ++ + ++FD   +  L    ++  + +  IHG FP   S  F ++  L + +N I   H     +F +L  LD S N+I  L   +  +    +I     NPL C C++ WL   + + K K     + N     S++       D F+ +       C PP+   L I  A+  +K++++             E T  + S + ++L C   GDP PTL
Sbjct:   75 NNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLTVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWL---SARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTL 338          
BLAST of SMED30024157 vs. TrEMBL
Match: A0A2D1QA84 (Leucine rich repeat and Ig domain containing 2 (Fragment) OS=Emydura macquarii OX=90392 GN=lingo2 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.778e-7
Identity = 92/430 (21.40%), Postives = 170/430 (39.53%), Query Frame = 2
Query:  248 FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQF-DELRLIRNQIGNSE---FFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVH------------SGFFANITKLFINNNQIIGFHKMFPYIFQNLSY---LDASSNRIVKLSESMKYVLKFRQII-FSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAK---KILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYG 1468
            F    +L  +++ KC +   P+    +L  L  +HL  LNI  +P   FK    +K L         +I+ + L D       +L GLN+++ S+                N NL  + +S+   KH  +   L L  N I   E   F + ++  E+H+   ++   +        +++T + +I ++ +  +  L H            +G FA++ +L   +        + P+ FQ L +   L+ S N +  L E++ +  K  +I+  +NNPL C C L W+    P ++    + + A         +N ++  +   H      Y   +  K   K L+  + E        + +QL C A GDP PT+ ++          S        +      IR +Q  +   Y    C+ +N+ G
Sbjct:  147 FSGLLSLEQLTLEKCNLTAVPTEALSHLHNLISLHLRHLNINLLPAYAFKRLFRLKDL---------EINYWPLLDMMPAN--SLYGLNLTSLSVT---------------NTNLSAIPYSA--LKHLVYLTHLNLSFNPISTIEAGMFADLVRLQELHMVGAQLRTIYGLNLTSLSVTNTNLSAIPYSALKHLVYLTHLNLSFNPISTIEAGMFADLVRLQALHMVGAQLRTIEPHAFQGLRFLRVLNVSQNLLETLEENVFHSPKTLEILCINNNPLACDCRLLWILQRQPTLQFGSQEPMCAGP-------DNVREKPFKDFHSTALSFYFTCKKPKIRDKKLQYLVVE------EGQTVQLMCNADGDPQPTISWVTPRRRLITTKSNG--RATVLGDGMLEIRFAQDQDTGIYT---CIASNAAG 530          
BLAST of SMED30024157 vs. Ensembl Medaka
Match: lrfn1 (leucine rich repeat and fibronectin type III domain containing 1 [Source:NCBI gene;Acc:101167138])

HSP 1 Score: 56.6102 bits (135), Expect = 5.732e-8
Identity = 80/338 (23.67%), Postives = 127/338 (37.57%), Query Frame = 2
Query:  614 DYFKHFQFDELRLIRNQIGN--SEFFENLQAAE-VHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGF-----------------HKMFPYI-------FQNLSYLDASSNRIVKL------------SESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSH-----CYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLN 1495
            D+        L L RN I       F  L++   +H+D N + N     ++K LI + + L +G+N IH V       F + I  L ++NN + G                  H +  +I          L  LD +SNR+ KL            SE          + F  NPL C CEL WLR           ++ + +D       E+  D ++         C PP     + S   +++             + + L+C AVGDP P   FI++ ++  GK   N    I        I  S L +N  YN   C+ +N+ G +   +++ 
Sbjct:   70 DFVNMTSLVHLTLSRNTISQIVPHAFVGLRSLRALHMDGNRL-NIIKSDHFKGLI-NLRHLILGNNQIHEVASTSFDEFVSTIEDLDLSNNNLRGLPWEAIARMSNINTLTLDHNLIDHIEAGTFTLLTKLVRLDMTSNRLQKLPPDSLFQHAQVLSEVKGSSSSTLAVSFGGNPLHCNCELLWLR-----------RLTREDDLETCASPEHLMDKYFWSIQEEEFICEPPLITKHVASKSYVME------------GQGVTLKCKAVGDPDP---FIHW-QSPDGKLVHNNSRTILYDNGTLDILISTLKDNGAYN---CVASNAAGIATAAVEIT 375          
BLAST of SMED30024157 vs. Ensembl Medaka
Match: chad (chondroadherin [Source:NCBI gene;Acc:105356591])

HSP 1 Score: 54.6842 bits (130), Expect = 1.258e-7
Identity = 79/328 (24.09%), Postives = 151/328 (46.04%), Query Frame = 2
Query:  104 CVTSKNFEIHQTECTSIPDENDLLRIPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLAN--LEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLK---FSSD---YFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLS---YLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLR 1054
            C+     +  Q++C   PD+ D L   P++ ++I  C+ +  +K+I      +NL  +++ +  +   P+  F     L  +H+    +TEI    FK    +K+L++++L+N  +  I P +  D  ++  + L G  IS  +  +F  +++     L+ NN ++ L+   FS      + H   ++L+ +  Q G+ +  ENL  A  HLD N  S        K  + +   L++G N +  +       F   + +L ++N   +G  K     F  ++    L   +NR+  L +S+K+       +F NNP  C C+L+ LR
Sbjct:   10 CLLGAAVQEAQSQC---PDQCDCL---PNLQHVI--CD-NKGLKEIPQVAESTNL--LNLQRNSLGSIPAGAFSESKGLISLHMQHCQLTEIGSQAFKG---LKKLTYLYLSNNDISSIKPGAFEDLTKLTYLYLDGNQISRLAKGIFSPMINLFSLQLS-NNKMRELRTGTFSGAKNLRWLHLNKNDLQTL--QPGSLDDVENL--AVFHLDGNNFSTYPSAAMSKLRVVEE--LTLGGNPMKTIPDNAFQSFGRYMERLHLDN---MGLEKFSDDAFNGVTAIKLLHLDNNRLKALPKSLKFGTITNMTLF-NNPWNCSCQLHSLR 312          
BLAST of SMED30024157 vs. Planmine SMEST
Match: SMESG000051501.1 (SMESG000051501.1)

HSP 1 Score: 1022.69 bits (2643), Expect = 0.000e+0
Identity = 540/540 (100.00%), Postives = 540/540 (100.00%), Query Frame = 2
Query:   41 MKFVIVIYYILLSNTFSDATTCVTSKNFEIHQTECTSIPDENDLLRIPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYXXXXXXXXXXXXXXXXFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL 1660
            MKFVIVIYYILLSNTFSDATTCVTSKNFEIHQTECTSIPDENDLLRIPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIHLFLLVVHKTLKVLTWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYGKRKSKKSIEGIKKSKFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL
Sbjct:    1 MKFVIVIYYILLSNTFSDATTCVTSKNFEIHQTECTSIPDENDLLRIPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIHLFLLVVHKTLKVLTWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYGKRKSKKSIEGIKKSKFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL 540          
BLAST of SMED30024157 vs. Planmine SMEST
Match: SMESG000051501.1 (SMESG000051501.1)

HSP 1 Score: 931.398 bits (2406), Expect = 0.000e+0
Identity = 495/496 (99.80%), Postives = 495/496 (99.80%), Query Frame = 2
Query:  173 LRIPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYXXXXXXXXXXXXXXXXFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL 1660
            L IPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIHLFLLVVHKTLKVLTWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYGKRKSKKSIEGIKKSKFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL
Sbjct:   27 LGIPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIHLFLLVVHKTLKVLTWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYGKRKSKKSIEGIKKSKFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL 522          
BLAST of SMED30024157 vs. Planmine SMEST
Match: SMESG000051501.1 (SMESG000051501.1)

HSP 1 Score: 929.472 bits (2401), Expect = 0.000e+0
Identity = 494/494 (100.00%), Postives = 494/494 (100.00%), Query Frame = 2
Query:  179 IPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYXXXXXXXXXXXXXXXXFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL 1660
            IPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIHLFLLVVHKTLKVLTWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYGKRKSKKSIEGIKKSKFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL
Sbjct:    5 IPPDINYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIHLFLLVVHKTLKVLTWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDASSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMTFDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYGKRKSKKSIEGIKKSKFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL 498          
BLAST of SMED30024157 vs. Planmine SMEST
Match: SMESG000080200.1 (SMESG000080200.1)

HSP 1 Score: 134.035 bits (336), Expect = 3.676e-33
Identity = 140/512 (27.34%), Postives = 231/512 (45.12%), Query Frame = 2
Query:   47 FVIVIYYILLSNTFSDATT-----CVTSKNFEIH-QTECTSIPDENDLLRIPPDINYLIIKCNYSSKIKKIFD--FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEIS--NNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYI---FQNLSYLDASSNRIVKLSESMKYVL--KFRQIIFSNNPLFCGCELNWLRN-SNPKIK-IKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMT-------FDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFG--KSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMY 1504
            F+I ++  LL    S  TT         +NF    ++ C+ IP + +  RI  +     I+C +S+K   + D   +    LV+I I  C +   P + F++L+ L  V+L  L I  + ++ FKNS N+  L    L +L++I P  L D  ++  + L   NI  T +   LL V+ TL    W  N++ L    DYF+ F F+ + L  N I N++F E L   E+ L  N I      +WKNY+ L    K L +    +     L     F  + +L +++N   G H++  ++     NL  LD  +N++  L  S+ Y+L  KF ++    N   C CE+ W+R+    +IK +KC  V       + E+  +       K  C  P   L++    K    +I+ ++       FDLY    I  +CI  G+P P L++I  N+ T       L+  +  T+  +       + ++N  Y    C   +  G S IRL++ K Y
Sbjct:   44 FLIEMWIYLLIGAISVVTTDQEGLVCNRQNFNNKPESHCSDIPSKEEWERIK-NTTIQTIRCKHSNKSNSLSDIRMKNLQRLVYIYIGDCNVQSLPMNFFEDLTQLETVYLDNLPIEILKENTFKNSSNIIELILSGLGSLKRIHPRFLGDQNKLATLTLTKSNIDPTQLRPTLLTVYNTLAKFYWRRNVQNLIIGKDYFQPFNFESVILEYNGITNTDFLELLNTKELSLKGNPIGIKEKLNWKNYRKLSKSLKKLDLSETGLD----LRPDMKFPKLEELALSSN---GIHQIPSHVEKFLPNLQLLDIRNNKLTTLP-SLDYMLRYKFGKVYLQGNIFNCNCEMIWIRSIEADRIKGLKCDNVNFEKHVKNQELTRSRI--LKSKMICTEPLLKLQLSDQFKSYDYTISVVSDTLQIYKFDLYPNHLISWQCIGEGNPAPRLKWIK-NQQTLKIENPPLDRLNNKTVMKNLIIPDDIKTADNETY---VCRAKSIAGISEIRLEVTKKY 540          
BLAST of SMED30024157 vs. Planmine SMEST
Match: SMESG000080200.1 (SMESG000080200.1)

HSP 1 Score: 132.88 bits (333), Expect = 6.231e-33
Identity = 131/477 (27.46%), Postives = 218/477 (45.70%), Query Frame = 2
Query:  134 QTECTSIPDENDLLRIPPDINYLIIKCNYSSKIKKIFD--FQRFSNLVFISISKCRINQFPSSTFQNLSFLREVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVEEINLGGLNISTTSIXXXXXXXXXXXXXXXWNNNLKRLKFSSDYFKHFQFDELRLIRNQIGNSEFFENLQAAEVHLDFNEIS--NNFDWKNYKHLISDTKVLSIGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYI---FQNLSYLDASSNRIVKLSESMKYVL--KFRQIIFSNNPLFCGCELNWLRN-SNPKIK-IKCSKVIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMT-------FDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFG--KSSLNFYDEITIATSRKTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMY 1504
            ++ C+ IP + +  RI  +     I+C +S+K   + D   +    LV+I I  C +   P + F++L+ L  V+L  L I  + ++ FKNS N+  L    L +L++I P  L D  ++  + L   NI  T +   LL V+ TL    W  N++ L    DYF+ F F+ + L  N I N++F E L   E+ L  N I      +WKNY+ L    K L +    +     L     F  + +L +++N   G H++  ++     NL  LD  +N++  L  S+ Y+L  KF ++    N   C CE+ W+R+    +IK +KC  V       + E+  +       K  C  P   L++    K    +I+ ++       FDLY    I  +CI  G+P P L++I  N+ T       L+  +  T+  +       + ++N  Y    C   +  G S IRL++ K Y
Sbjct:   32 ESHCSDIPSKEEWERIK-NTTIQTIRCKHSNKSNSLSDIRMKNLQRLVYIYIGDCNVQSLPMNFFEDLTQLETVYLDNLPIEILKENTFKNSSNIIELILSGLGSLKRIHPRFLGDQNKLATLTLTKSNIDPTQLRPTLLTVYNTLAKFYWRRNVQNLIIGKDYFQPFNFESVILEYNGITNTDFLELLNTKELSLKGNPIGIKEKLNWKNYRKLSKSLKKLDLSETGLD----LRPDMKFPKLEELALSSN---GIHQIPSHVEKFLPNLQLLDIRNNKLTTLP-SLDYMLRYKFGKVYLQGNIFNCNCEMIWIRSIEADRIKGLKCDNVNFEKHVKNQELTRSRI--LKSKMICTEPLLKLQLSDQFKSYDYTISVVSDTLQIYKFDLYPNHLISWQCIGEGNPAPRLKWIK-NQQTLKIENPPLDRLNNKTVMKNLIIPDDIKTADNETY---VCRAKSIAGISEIRLEVTKKY 493          
The following BLAST results are available for this feature:
BLAST of SMED30024157 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
LINGO21.119e-721.36leucine rich repeat and Ig domain containing 2 [So... [more]
LINGO21.119e-721.36leucine rich repeat and Ig domain containing 2 [So... [more]
LINGO21.119e-721.36leucine rich repeat and Ig domain containing 2 [So... [more]
back to top
BLAST of SMED30024157 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024157 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024157 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024157 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LINGO24.026e-620.90leucine rich repeat and Ig domain containing 2 [So... [more]
back to top
BLAST of SMED30024157 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lingo24.772e-721.28leucine rich repeat and Ig domain containing 2 [So... [more]
Lingo24.772e-721.28leucine rich repeat and Ig domain containing 2 [So... [more]
Lingo24.772e-721.28leucine rich repeat and Ig domain containing 2 [So... [more]
Lingo24.772e-721.28leucine rich repeat and Ig domain containing 2 [So... [more]
Lingo24.772e-721.28leucine rich repeat and Ig domain containing 2 [So... [more]
back to top
BLAST of SMED30024157 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q7L985|LIGO2_HUMAN5.375e-721.36Leucine-rich repeat and immunoglobulin-like domain... [more]
sp|Q3URE9|LIGO2_MOUSE3.338e-621.28Leucine-rich repeat and immunoglobulin-like domain... [more]
back to top
BLAST of SMED30024157 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1DF801.174e-1226.65LRFN-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
R7TAS36.850e-1123.22Ig-like domain-containing protein (Fragment) OS=Ca... [more]
A0A1I8IQ971.228e-922.45Ig-like domain-containing protein OS=Macrostomum l... [more]
I1ZII98.516e-823.60Leucine rich repeat and fibronectin type III domai... [more]
A0A2D1QA842.778e-721.40Leucine rich repeat and Ig domain containing 2 (Fr... [more]
back to top
BLAST of SMED30024157 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024157 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024157 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024157 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024157 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lrfn15.732e-823.67leucine rich repeat and fibronectin type III domai... [more]
chad1.258e-724.09chondroadherin [Source:NCBI gene;Acc:105356591][more]
back to top
BLAST of SMED30024157 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051501.10.000e+0100.00SMESG000051501.1[more]
SMESG000051501.10.000e+099.80SMESG000051501.1[more]
SMESG000051501.10.000e+0100.00SMESG000051501.1[more]
SMESG000080200.13.676e-3327.34SMESG000080200.1[more]
SMESG000080200.16.231e-3327.46SMESG000080200.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024157 ID=SMED30024157|Name=SMED30024157|organism=Schmidtea mediterranea sexual|type=transcript|length=1667bp
TTTTATTTATTAGTTTTCTACATAATATTGTTTTTCTACAATGAAATTTG
TGATCGTTATTTACTATATTTTACTCTCAAATACATTCTCAGATGCGACT
ACCTGCGTTACATCAAAAAATTTTGAAATACATCAAACTGAATGTACCTC
AATTCCAGATGAAAACGATTTATTACGTATTCCTCCAGACATTAATTATC
TAATCATTAAATGCAATTATTCCAGCAAAATTAAAAAAATATTCGATTTC
CAGAGATTTTCAAATCTTGTGTTTATATCGATCTCAAAGTGCCGGATCAA
TCAATTTCCTTCATCAACATTTCAAAATTTATCATTTTTAAGAGAAGTTC
ATCTGGCCGAGCTCAATATTACTGAAATACCGGACGATATCTTTAAAAAT
TCAGTGAACGTTAAACGATTGTCTTTCATTCATCTAGCCAACCTCGAGAA
AATTTCTCCATTCTCTCTTAGAGATTGTTTTCAGGTCGAAGAAATAAATC
TTGGGGGTTTGAACATATCAACTACTTCCATCCATCTATTCTTACTTGTC
GTCCATAAAACCTTGAAGGTTTTGACGTGGAATAACAATTTGAAAAGGCT
CAAATTCAGTTCAGACTACTTTAAGCACTTTCAATTCGATGAATTGAGAT
TAATTCGTAACCAGATTGGCAATTCCGAATTTTTCGAAAATCTCCAAGCT
GCCGAAGTTCATTTGGATTTCAATGAAATAAGTAATAATTTTGACTGGAA
AAATTACAAACATTTAATAAGCGACACAAAAGTGCTCAGCATTGGACATA
ATATTATTCACGGAGTTTTCCCATTGGTCCACAGCGGATTTTTTGCGAAC
ATTACAAAGCTATTTATCAACAACAATCAAATCATCGGATTTCATAAAAT
GTTTCCATATATCTTTCAAAATCTGTCCTATTTAGACGCAAGTTCAAATA
GAATAGTAAAACTGTCAGAATCCATGAAATATGTTCTGAAATTCAGGCAA
ATTATCTTTTCTAATAATCCTTTGTTTTGTGGATGTGAACTGAACTGGTT
GCGGAACTCGAATCCGAAAATTAAAATCAAATGTTCCAAAGTAATTCAGG
CGAATGATCAGTCAGATATTGAGGTCGTAGAAAATTATCAAGACCCCTTC
TACCCTAAATCTCATTGTTACCCACCAAAAACATATTTAGAAATCGAAAG
CGCCAAAAAGATTTTGAAAATTTCAATTGCGGAAATGACTTTCGACCTGT
ACTCCTGTGAGTTTATTCAATTAAGATGTATAGCTGTAGGAGATCCCTTA
CCGACTTTAGAATTTATCAATTTTAATGAAGCAACATTTGGCAAATCTTC
ATTAAATTTTTATGACGAGATAACAATTGCAACTTCCCGTAAAACTATCA
GACATTCGCAATTATCAGAGAATTCCAAATATAATCAACTTCATTGTCTT
GGAACCAACTCGTACGGGAAGTCCATAATTCGACTCCAATTGAACAAGAT
GTATGGTAAACGTAAGTCTAAAAAGTCCATCGAAGGTATAAAAAAATCAA
AATTCTGTCGTGAAAGATCTTCAAGATTGACTGCTAATAGCCTGAAAGTC
ACATTCTTATTTTTTCTTCCGATGTTGATAAATTTTATTATTGAAAATGA
CCAATTTTTGTAATAAA
back to top

protein sequence of SMED30024157-orf-1

>SMED30024157-orf-1 ID=SMED30024157-orf-1|Name=SMED30024157-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=541bp
MKFVIVIYYILLSNTFSDATTCVTSKNFEIHQTECTSIPDENDLLRIPPD
INYLIIKCNYSSKIKKIFDFQRFSNLVFISISKCRINQFPSSTFQNLSFL
REVHLAELNITEIPDDIFKNSVNVKRLSFIHLANLEKISPFSLRDCFQVE
EINLGGLNISTTSIHLFLLVVHKTLKVLTWNNNLKRLKFSSDYFKHFQFD
ELRLIRNQIGNSEFFENLQAAEVHLDFNEISNNFDWKNYKHLISDTKVLS
IGHNIIHGVFPLVHSGFFANITKLFINNNQIIGFHKMFPYIFQNLSYLDA
SSNRIVKLSESMKYVLKFRQIIFSNNPLFCGCELNWLRNSNPKIKIKCSK
VIQANDQSDIEVVENYQDPFYPKSHCYPPKTYLEIESAKKILKISIAEMT
FDLYSCEFIQLRCIAVGDPLPTLEFINFNEATFGKSSLNFYDEITIATSR
KTIRHSQLSENSKYNQLHCLGTNSYGKSIIRLQLNKMYGKRKSKKSIEGI
KKSKFCRERSSRLTANSLKVTFLFFLPMLINFIIENDQFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000421FA58C
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004860protein kinase inhibitor activity
GO:0005057signal transducer activity, downstream of receptor
GO:0005104fibroblast growth factor receptor binding
GO:0030674protein binding, bridging
GO:0042803protein homodimerization activity
GO:0045499chemorepellent activity
Vocabulary: biological process
TermDefinition
GO:0003345proepicardium cell migration involved in pericardium morphogenesis
GO:0006469negative regulation of protein kinase activity
GO:0007155cell adhesion
GO:0007275multicellular organism development
GO:0007411axon guidance
GO:0007416synapse assembly
GO:0007507heart development
GO:0008543fibroblast growth factor receptor signaling pathway
GO:0019221cytokine-mediated signaling pathway
GO:0031175neuron projection development
GO:0046426negative regulation of JAK-STAT cascade
GO:0048598embryonic morphogenesis
GO:0048678response to axon injury
GO:0050919negative chemotaxis
GO:0051965positive regulation of synapse assembly
GO:0060322head development
GO:0098742cell-cell adhesion via plasma-membrane adhesion molecules
GO:1990138neuron projection extension
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005615extracellular space
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0005911cell-cell junction
GO:0005925focal adhesion
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030424axon
GO:0042995cell projection
GO:0043679axon terminus
GO:0044295axonal growth cone
GO:0097060synaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 217..365
e-value: 4.1E-12
score: 47.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 13..216
e-value: 2.6E-17
score: 64.4
NoneNo IPR availablePANTHERPTHR24373SLIT RELATED LEUCINE-RICH REPEAT NEURONAL PROTEINcoord: 19..438
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.619
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 17..340
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 294..315
score: 7.019
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 99..120
score: 4.793
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 75..96
score: 4.693
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 198..219
score: 4.716