Armadillo repeat protein deleted in velo-cardio-facial syndrome-like

Overview
NameArmadillo repeat protein deleted in velo-cardio-facial syndrome-like
Smed IDSMED30024138
Length (bp)2938
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like (SMED30024138) t-SNE clustered cells

Violin plots show distribution of expression levels for Armadillo repeat protein deleted in velo-cardio-facial syndrome-like (SMED30024138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like (SMED30024138) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Armadillo repeat protein deleted in velo-cardio-facial syndrome-like (SMED30024138) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024138h1SMcG0010809 dd_Smed_v4_6256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30024138h1SMcG0010809 dd_Smed_v4_6256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024138h1SMcG0010809 dd_Smed_v4_6256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024138h1SMcG0010809 dd_Smed_v4_6256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024138h1SMcG0010809 dd_Smed_v4_6256_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Human
Match: CTNND2 (catenin delta 2 [Source:HGNC Symbol;Acc:HGNC:2516])

HSP 1 Score: 209.534 bits (532), Expect = 1.926e-55
Identity = 151/548 (27.55%), Postives = 260/548 (47.45%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS--------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPM-----HAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP     ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +   +  +A   L+N+ +     D ++ + +     GI  ++ ++  + D+   EL   +LWNLS    LK  I+ +A+  L   VI+P       P  D   +   ++ S +LRN  G +RN+S    EAR ++R+ + L D++ Y+I  A    E          IDSK +ENC CILRNL+Y +  E     ++ T +        +N  + + S                      P   + PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+ S  +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P      +  SK +++  + AV  T++ VI    E  K   +  G ++ + +  S+      D++  K+ +   Q+L  +W+    R   KK  + Q   + S
Sbjct:  178 PYSKSGPALPPEGTLARSPSIDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKI--QLHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSE----------IDSKTVENCVCILRNLSYRLAAETSQGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNSNNTASKAMSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSK-----GDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVAS 702          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Human
Match: CTNND2 (catenin delta 2 [Source:HGNC Symbol;Acc:HGNC:2516])

HSP 1 Score: 209.534 bits (532), Expect = 7.117e-55
Identity = 151/548 (27.55%), Postives = 260/548 (47.45%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS--------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPM-----HAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP     ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +   +  +A   L+N+ +     D ++ + +     GI  ++ ++  + D+   EL   +LWNLS    LK  I+ +A+  L   VI+P       P  D   +   ++ S +LRN  G +RN+S    EAR ++R+ + L D++ Y+I  A    E          IDSK +ENC CILRNL+Y +  E     ++ T +        +N  + + S                      P   + PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+ S  +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P      +  SK +++  + AV  T++ VI    E  K   +  G ++ + +  S+      D++  K+ +   Q+L  +W+    R   KK  + Q   + S
Sbjct:  424 PYSKSGPALPPEGTLARSPSIDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKI--QLHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSE----------IDSKTVENCVCILRNLSYRLAAETSQGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNSNNTASKAMSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSK-----GDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVAS 948          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Human
Match: CTNND2 (catenin delta 2 [Source:HGNC Symbol;Acc:HGNC:2516])

HSP 1 Score: 208.764 bits (530), Expect = 1.213e-54
Identity = 151/548 (27.55%), Postives = 260/548 (47.45%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS--------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPM-----HAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP     ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +   +  +A   L+N+ +     D ++ + +     GI  ++ ++  + D+   EL   +LWNLS    LK  I+ +A+  L   VI+P       P  D   +   ++ S +LRN  G +RN+S    EAR ++R+ + L D++ Y+I  A    E          IDSK +ENC CILRNL+Y +  E     ++ T +        +N  + + S                      P   + PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+ S  +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P      +  SK +++  + AV  T++ VI    E  K   +  G ++ + +  S+      D++  K+ +   Q+L  +W+    R   KK  + Q   + S
Sbjct:  515 PYSKSGPALPPEGTLARSPSIDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKI--QLHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSE----------IDSKTVENCVCILRNLSYRLAAETSQGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNSNNTASKAMSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSK-----GDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVAS 1039          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Human
Match: PKP4 (plakophilin 4 [Source:HGNC Symbol;Acc:HGNC:9026])

HSP 1 Score: 200.29 bits (508), Expect = 6.034e-52
Identity = 163/585 (27.86%), Postives = 265/585 (45.30%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSF---TDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ-EV----------LDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSND-------------NPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII--------------PS-----RNLDPCNVCIPSKSTKPKLDNVN--RSSFDLVDDNRSFHN----------YPGNNK 2156
            P LP  +V+ + ++    +Q NA AYLQHL F +N+ K+EV    G++ +++L   +   +   A   L+N+ F   TD   I   ++ + GI  ++ ++  S D    EL   +LWNLS    +K  I+ +A+ TL   VI+P          D   +      S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I    +  +           DSK +ENC C LRNL+Y ++ EV          LD D L     S     S     K+K    P  D             +PKGVE+LW+   +V+    +L   +N  TLE +AG +QNLSAG+W+ +  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P       +++  +AA+   ++ V     E  K   +  G ++ + +          D+   K+ +   Q+L  LW+    R   KK  + Q+  I              PS     + + P    + S S+ P L  +   RS +D       ++N          YPG++K
Sbjct:  528 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVCRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIA--MKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKI--KFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSD----------YDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELD-DLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPS-VVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSVLSDETMAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGR-----GDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLERDRFKSHPSLSTTNQQMSPIIQSVGSTSSSPALLGIRDPRSEYDRTQPPMQYYNSQGDATHKGLYPGSSK 1089          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Human
Match: PKP4 (plakophilin 4 [Source:HGNC Symbol;Acc:HGNC:9026])

HSP 1 Score: 198.749 bits (504), Expect = 1.903e-51
Identity = 148/508 (29.13%), Postives = 240/508 (47.24%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSF---TDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ-EV----------LDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSND-------------NPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII 2018
            P LP  +V+ + ++    +Q NA AYLQHL F +N+ K+EV    G++ +++L   +   +   A   L+N+ F   TD   I   ++ + GI  ++ ++  S D    EL   +LWNLS    +K  I+ +A+ TL   VI+P          D   +      S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I    +  +           DSK +ENC C LRNL+Y ++ EV          LD D L     S     S     K+K    P  D             +PKGVE+LW+   +V+    +L   +N  TLE +AG +QNLSAG+W+ +  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P       +++  +AA+   ++ V     E  K   +  G ++ + +          D+   K+ +   Q+L  LW+    R   KK  + Q+  I
Sbjct:  528 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVCRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIA--MKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKI--KFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSD----------YDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELD-DLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPS-VVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSVLSDETMAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGR-----GDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFI 1012          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 213.386 bits (542), Expect = 1.701e-56
Identity = 145/493 (29.41%), Postives = 247/493 (50.10%), Query Frame = 3
Query:  588 IAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLA-----GIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKL-VKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPK---------GVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKK--ITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDI 2015
            + +V++   + + + QLNA  YLQHL + +N+ K E R   G+  +I L R   P I   A   LKN+SF        D  +LA     G++ +  ++ +++D S  E A   LWNLS   +LK +IL  A + L + VI P   +    P   +         S + +N  G++RN+S  S +AR +LRD   LI+++ + ++ A         I+  S +DS  +EN  C+LRNL+Y IQEV+DP+Y     +SS      +  + +        +  K         G  +LW   H+V+    +L++ +N  TLEA+AG IQNL+A  + PS E+R   R++  LP L+EL+ +  D V+ + +TALRNL  + +   LIG   LR   +K+P     ++  I++  + AVL  ++ +++    + K+    KGT +   +  S         Y  ++ ++  Q+L ++W+     +  K+   K++D 
Sbjct:  620 LKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKE----NDANKLAVMEADGVRLIAEVLRTTHDASVKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGTSDPTRHF--------GSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHA---------IQK-SQVDSPTVENAVCLLRNLSYRIQEVVDPNYDPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQ-PHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISDQTIGAVLGILFEIVRSSAAYTKDVHELKGTDKLRALSRSY------PTYSHRVCKYASQVLYVMWQHKELHDGFKRSGLKEADF 1083          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 212.231 bits (539), Expect = 2.225e-56
Identity = 147/500 (29.40%), Postives = 248/500 (49.60%), Query Frame = 3
Query:  588 IAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLA-----GIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKL-VKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPK----------------GVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKK--ITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDI 2015
            + +V++   + + + QLNA  YLQHL + +N+ K E R   G+  +I L R   P I   A   LKN+SF        D  +LA     G++ +  ++ +++D S  E A   LWNLS   +LK +IL  A + L + VI P   +    P   +         S + +N  G++RN+S  S +AR +LRD   LI+++ + ++ A         I+  S +DS  +EN  C+LRNL+Y IQEV+DP+Y        P    S+     K ++ P  +  K                G  +LW   H+V+    +L++ +N  TLEA+AG IQNL+A  + PS E+R   R++  LP L+EL+ +  D V+ + +TALRNL  + +   LIG   LR   +K+P     ++  I++  + AVL  ++ +++    + K+    KGT +   +  S         Y  ++ ++  Q+L ++W+     +  K+   K++D 
Sbjct:  450 LKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKE----NDANKLAVMEADGVRLIAEVLRTTHDASVKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGTSDPTRHF--------GSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHA---------IQK-SQVDSPTVENAVCLLRNLSYRIQEVVDPNY-------DPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQ-PHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISDQTIGAVLGILFEIVRSSAAYTKDVHELKGTDKLRALSRSY------PTYSHRVCKYASQVLYVMWQHKELHDGFKRSGLKEADF 913          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 212.616 bits (540), Expect = 2.819e-56
Identity = 147/500 (29.40%), Postives = 248/500 (49.60%), Query Frame = 3
Query:  588 IAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLA-----GIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKL-VKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPK----------------GVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKK--ITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDI 2015
            + +V++   + + + QLNA  YLQHL + +N+ K E R   G+  +I L R   P I   A   LKN+SF        D  +LA     G++ +  ++ +++D S  E A   LWNLS   +LK +IL  A + L + VI P   +    P   +         S + +N  G++RN+S  S +AR +LRD   LI+++ + ++ A         I+  S +DS  +EN  C+LRNL+Y IQEV+DP+Y        P    S+     K ++ P  +  K                G  +LW   H+V+    +L++ +N  TLEA+AG IQNL+A  + PS E+R   R++  LP L+EL+ +  D V+ + +TALRNL  + +   LIG   LR   +K+P     ++  I++  + AVL  ++ +++    + K+    KGT +   +  S         Y  ++ ++  Q+L ++W+     +  K+   K++D 
Sbjct:  693 LKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKE----NDANKLAVMEADGVRLIAEVLRTTHDASVKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGTSDPTRHF--------GSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHA---------IQK-SQVDSPTVENAVCLLRNLSYRIQEVVDPNY-------DPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQ-PHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISDQTIGAVLGILFEIVRSSAAYTKDVHELKGTDKLRALSRSY------PTYSHRVCKYASQVLYVMWQHKELHDGFKRSGLKEADF 1156          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 211.846 bits (538), Expect = 3.318e-56
Identity = 147/500 (29.40%), Postives = 248/500 (49.60%), Query Frame = 3
Query:  588 IAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLA-----GIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKL-VKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPK----------------GVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKK--ITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDI 2015
            + +V++   + + + QLNA  YLQHL + +N+ K E R   G+  +I L R   P I   A   LKN+SF        D  +LA     G++ +  ++ +++D S  E A   LWNLS   +LK +IL  A + L + VI P   +    P   +         S + +N  G++RN+S  S +AR +LRD   LI+++ + ++ A         I+  S +DS  +EN  C+LRNL+Y IQEV+DP+Y        P    S+     K ++ P  +  K                G  +LW   H+V+    +L++ +N  TLEA+AG IQNL+A  + PS E+R   R++  LP L+EL+ +  D V+ + +TALRNL  + +   LIG   LR   +K+P     ++  I++  + AVL  ++ +++    + K+    KGT +   +  S         Y  ++ ++  Q+L ++W+     +  K+   K++D 
Sbjct:  523 LKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKE----NDANKLAVMEADGVRLIAEVLRTTHDASVKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGTSDPTRHF--------GSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHA---------IQK-SQVDSPTVENAVCLLRNLSYRIQEVVDPNY-------DPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQ-PHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISDQTIGAVLGILFEIVRSSAAYTKDVHELKGTDKLRALSRSY------PTYSHRVCKYASQVLYVMWQHKELHDGFKRSGLKEADF 986          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 211.846 bits (538), Expect = 3.318e-56
Identity = 147/500 (29.40%), Postives = 248/500 (49.60%), Query Frame = 3
Query:  588 IAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLA-----GIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKL-VKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPK----------------GVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKK--ITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDI 2015
            + +V++   + + + QLNA  YLQHL + +N+ K E R   G+  +I L R   P I   A   LKN+SF        D  +LA     G++ +  ++ +++D S  E A   LWNLS   +LK +IL  A + L + VI P   +    P   +         S + +N  G++RN+S  S +AR +LRD   LI+++ + ++ A         I+  S +DS  +EN  C+LRNL+Y IQEV+DP+Y        P    S+     K ++ P  +  K                G  +LW   H+V+    +L++ +N  TLEA+AG IQNL+A  + PS E+R   R++  LP L+EL+ +  D V+ + +TALRNL  + +   LIG   LR   +K+P     ++  I++  + AVL  ++ +++    + K+    KGT +   +  S         Y  ++ ++  Q+L ++W+     +  K+   K++D 
Sbjct:  523 LKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKE----NDANKLAVMEADGVRLIAEVLRTTHDASVKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGTSDPTRHF--------GSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHA---------IQK-SQVDSPTVENAVCLLRNLSYRIQEVVDPNY-------DPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQ-PHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISDQTIGAVLGILFEIVRSSAAYTKDVHELKGTDKLRALSRSY------PTYSHRVCKYASQVLYVMWQHKELHDGFKRSGLKEADF 986          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Fly
Match: p120ctn (gene:FBgn0260799 transcript:FBtr0111114)

HSP 1 Score: 122.865 bits (307), Expect = 3.317e-28
Identity = 130/475 (27.37%), Postives = 208/475 (43.79%), Query Frame = 3
Query:  627 EIQLNALAYLQHLIFN--NNEKKLEVRNSNGLRTIIEL-TRPQNPNIVCAALNVLKNMS-FTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILT--EAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSI---ILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMH--AKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII 2018
            EI  NA   L++L +   N+E K  ++N+ G+  ++ L  R Q   +      VL NMS   D +  I D   +A +  +I      + V   E     ++  +   VL+N+      A   L     L EC L       YV        +I    + NC+ I+RN+SY   E      D++  I     + S +K                    EN  C   N     +E  + D L     S+   KS          S   N   KG E LW  + +V+    +L++ +N  TLEAAAG IQNLSA  W+PS ++R   R +  LP L+EL+ +  D V+ + +TALRNL  +++   LIG   +R L +K+P       +  ++  + AVL+TI  VIK   EF +  ++  G  R + +   +      ++Y   + +F  Q+L  +W+    R+  KK  +K+ D +
Sbjct:  282 EIHKNACGALRNLSYGRQNDENKRGIKNAGGIAALVHLLCRSQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAVVCSVIKPHSGWDAVCCGETCFSTVFR-NASGVLRNVSSAGEHARGCLRNCEHLVECLL-------YVVRTSIEKNNIGNKTVENCVCILRNLSYRCQEVDDPNYDKHPFITPERVIPSSSKG-------------------ENLGCFGTNKKK--KEANNSDALNEYNISADYSKS----------SVTYNKLNKGYEQLWQPE-VVQYYLSLLQSCSNPETLEAAAGAIQNLSACYWQPSIDIRATVRKEKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDLVQKLPSGNVQHDQNTSDDTITAVLATINEVIKKNPEFSRSLLDSGGIDRLMNITKRK------EKYTSCVLKFASQVLYTMWQHNELRDVYKKNGWKEQDFV 710          

HSP 2 Score: 110.923 bits (276), Expect = 1.616e-24
Identity = 77/249 (30.92%), Postives = 128/249 (51.41%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT-DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNG-DYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDY 1316
            PNL  ++V+    N +  I+ NA AYLQHL + ++  K   R+  G+  ++ L    +P I   A   L+N+S+    +     I+   GI  ++ ++  S +    EL   +LWN+S    LK  I+ EA+  ++       C ++K  +G D V   E   +S + RN  G++RN+S     AR  LR+   L++ + Y++  +  +E+ +        I +K +ENC CILRNL+Y  QEV DP+Y
Sbjct:  225 PNL--SEVISFLSNPSSAIKANAAAYLQHLCYMDDPNKQRTRSLGGIPPLVRLLSYDSPEIHKNACGALRNLSYGRQNDENKRGIKNAGGIAALVHLLCRSQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAVV-------CSVIKPHSGWDAVCCGETC-FSTVFRNASGVLRNVSSAGEHARGCLRNCEHLVECLLYVVRTS--IEKNN--------IGNKTVENCVCILRNLSYRCQEVDDPNY 453          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Zebrafish
Match: arvcfa (ARVCF delta catenin family member a [Source:ZFIN;Acc:ZDB-GENE-091113-43])

HSP 1 Score: 208.764 bits (530), Expect = 9.183e-56
Identity = 157/555 (28.29%), Postives = 256/555 (46.13%), Query Frame = 3
Query:  630 IQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPL-PEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVL------------------------DPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNP-KGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYV-RDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS------------------------RNLDP-CNVCIPSKSTKPKLDNVNRSSFDLVDDNRSF 2132
            ++ NA AYLQHL + N++ K +VR   G+  ++ L     P +   A   L+N+SF         I+   GI  ++ ++  SNDV   EL    LWNLS H  LK +++   ++TL + +I+P   L   PN    P  PE   W+ + +N  G +RN+S +  EAR +LR+ + L+D++ + +  A  V + D        I++K +ENC CILRNL+Y + + +                         PD    R     +  +  K +    +  P    P +G+ELL+  + +V     +LK   N  TLEAAAG +QNLSAG W  S  +R   R +  LP L+EL+    D+V+R+ + ALRNL  + K   LIGS  +R L   +P   +  +K +    + A+L+TI  +I +  E  +  I  +G Q+ + + R S+           +  +    IL+ +W     R +L K  + ++   P+                        +N D  C+V  P ++       + R +F  V+D R F
Sbjct:  262 VKSNAAAYLQHLCYENDKVKQDVRQLRGIPVLVGLLDHPKPEVHRKACGALRNISFGRDNFNKVAIKNSDGIPALLRLLRKSNDVEVRELVTGTLWNLSSHEPLKMMVINHGLQTLTDEIIIPHSGLRGDPNDPARPGDPE---WNTVFKNTSGCLRNVSSDGAEARQRLRECDGLVDALLHALYSA--VAKRD--------INNKSVENCVCILRNLSYHVHKEVPGAEKFHIQAASHNAKPAGHHKKDKPDCFGGRTTKGKRHGAVEKKSGGADL--PKRSLPMRGLELLYQPE-VVRLYLSLLKLSQNHNTLEAAAGALQNLSAGHWAWSNYIRATVRKEKGLPVLVELLHSDADKVVRAVAIALRNLAIDHKNKDLIGSYAMRDLVSNLPCGQQRPAKNLEGDTVVAILNTILEIISENLENARFLIQGQGIQKLVSINRTSQSV---------RETKAASHILQAVWAYKDLRHTLLKAGWNKTHFKPAVSSLPKKLKNTKQGNDDITLPLMEKNQDGYCSVDQPERAGDAPCHMIERETFQGVNDKRHF 791          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Zebrafish
Match: ctnnd2b (catenin (cadherin-associated protein), delta 2b [Source:ZFIN;Acc:ZDB-GENE-070912-532])

HSP 1 Score: 210.69 bits (535), Expect = 1.962e-55
Identity = 158/559 (28.26%), Postives = 258/559 (46.15%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-----------QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS----------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKEL-------RVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIP---------MHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP    +++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +  ++  +A   L+N+ +     D ++ + +     GI  ++ ++  + DV   EL   +LWNLS    LK  I+ +A+  L   VI+P       P  D   L   ++ S +LRN  G +RN+S    EAR ++R+   L D++ Y+I  A    E          IDSK IENC CILRNL+Y +            E LD            +        K+K  S          P S+D PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+    L       R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P             SK +++  + A+   ++ VI    E  K   +  G ++ I +  S+      D++  K+ +   Q+L  +W+    R   KK  Y Q   + S
Sbjct:  493 PYSKSGPALPPEATLVRSPSVDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKSEIRRQGGIQLLVDLLDHRMTDVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDVEIRELLTGVLWNLSSCDALKMPIIQDALAVLTNTVIIPHSGWDTSPLQDDRKL--HLHSSQVLRNATGCLRNVSSAGEEARRRMRECEGLTDALLYVIQTALGTSE----------IDSKTIENCVCILRNLSYRLAAETSQGQQMGSEELDGVLCTDASGKDAESSGCWGKKKKKKKSHDQWDGVGPFPDSSDPPKGLQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKVGPTLKPWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNNNSTGTGGSSKSMSDDTITAICCALHEVITKNMENTKALRDAGGIEKLIGIARSK-----GDKHTPKVVKAASQVLNSMWQYRDLRSLYKKDGYSQYHFVGS 1028          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Zebrafish
Match: ctnnd2b (catenin (cadherin-associated protein), delta 2b [Source:ZFIN;Acc:ZDB-GENE-070912-532])

HSP 1 Score: 206.068 bits (523), Expect = 6.066e-54
Identity = 152/524 (29.01%), Postives = 245/524 (46.76%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-----------QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS----------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKEL-------RVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIP---------MHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +  ++  +A   L+N+ +     D ++ + +     GI  ++ ++  + DV   EL   +LWNLS    LK  I+ +A+  L   VI+P       P  D   L   ++ S +LRN  G +RN+S    EAR ++R+   L D++ Y+I  A    E          IDSK IENC CILRNL+Y +            E LD            +        K+K  S          P S+D PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+    L       R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P             SK +++  + A+   ++ VI    E  K   +  G ++ I +  S+      D++  K+ +   Q+L  +W+    R   KK  Y Q   + S
Sbjct:  534 PELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKSEIRRQGGIQLLVDLLDHRMTDVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDVEIRELLTGVLWNLSSCDALKMPIIQDALAVLTNTVIIPHSGWDTSPLQDDRKL--HLHSSQVLRNATGCLRNVSSAGEEARRRMRECEGLTDALLYVIQTALGTSE----------IDSKTIENCVCILRNLSYRLAAETSQGQQMGSEELDGVLCTDASGKDAESSGCWGKKKKKKKSHDQWDGVGPFPDSSDPPKGLQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKVGPTLKPWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNNNSTGTGGSSKSMSDDTITAICCALHEVITKNMENTKALRDAGGIEKLIGIARSK-----GDKHTPKVVKAASQVLNSMWQYRDLRSLYKKDGYSQYHFVGS 1034          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Zebrafish
Match: ctnnd2a (catenin (cadherin-associated protein), delta 2a [Source:ZFIN;Acc:ZDB-GENE-030616-60])

HSP 1 Score: 202.601 bits (514), Expect = 7.896e-53
Identity = 151/556 (27.16%), Postives = 259/556 (46.58%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ------EVLDPDYL-------------QTRXXXXXXXXXXXXXXXXXXIS--PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPM-------------HAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP     ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +   +  +A   L+N+ +     D ++ + +     GI  ++ ++  ++DV   EL   +LWNLS    LK  I+ +A+  L   VI+P       P+ +   L   ++ S +LRN  G +RN+S    EAR ++R+   L D++ ++I  +    E          IDSK IENC CILRNL+Y +       + +  D L             +T      K K     ++   +   P + + PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+ S  +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P                  K + +  + A+   ++ VI    E  K   +  G ++ I +  S+      D++  K+ +   Q+L  +W+    R   KK  Y Q   + S
Sbjct:  460 PYSKSGPALPPEGNLARSPSIDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMAEVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTSDVEVRELVTGVLWNLSSCDALKMPIIQDALAVLTNTVIIPHSTWDVSPHQEDRKL--QMHTSQVLRNATGCLRNVSSAGEEARRRMRECEGLTDTLLFVIQTSLGSSE----------IDSKTIENCVCILRNLSYRLAAETSQGQQMGTDELDGLLCSDASGKDGETSGCWGKKKKKKKSQDQWDGVGPLPDTAEPPKGIQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNASASSGGTANSTAGKTMCDDTVTAICCALHEVITKNMENAKALRDAGGIEKLIGIARSK-----GDKHSPKVVKAASQVLSSMWQYRDLRSLYKKDGYSQYHFVGS 992          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Zebrafish
Match: ctnnd2a (catenin (cadherin-associated protein), delta 2a [Source:ZFIN;Acc:ZDB-GENE-030616-60])

HSP 1 Score: 202.216 bits (513), Expect = 9.358e-53
Identity = 151/556 (27.16%), Postives = 259/556 (46.58%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ------EVLDPDYL-------------QTRXXXXXXXXXXXXXXXXXXIS--PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPM-------------HAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP     ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +   +  +A   L+N+ +     D ++ + +     GI  ++ ++  ++DV   EL   +LWNLS    LK  I+ +A+  L   VI+P       P+ +   L   ++ S +LRN  G +RN+S    EAR ++R+   L D++ ++I  +    E          IDSK IENC CILRNL+Y +       + +  D L             +T      K K     ++   +   P + + PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+ S  +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P                  K + +  + A+   ++ VI    E  K   +  G ++ I +  S+      D++  K+ +   Q+L  +W+    R   KK  Y Q   + S
Sbjct:  502 PYSKSGPALPPEGNLARSPSIDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMAEVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTSDVEVRELVTGVLWNLSSCDALKMPIIQDALAVLTNTVIIPHSTWDVSPHQEDRKL--QMHTSQVLRNATGCLRNVSSAGEEARRRMRECEGLTDTLLFVIQTSLGSSE----------IDSKTIENCVCILRNLSYRLAAETSQGQQMGTDELDGLLCSDASGKDGETSGCWGKKKKKKKSQDQWDGVGPLPDTAEPPKGIQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNASASSGGTANSTAGKTMCDDTVTAICCALHEVITKNMENAKALRDAGGIEKLIGIARSK-----GDKHSPKVVKAASQVLSSMWQYRDLRSLYKKDGYSQYHFVGS 1034          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 220.705 bits (561), Expect = 3.589e-59
Identity = 152/517 (29.40%), Postives = 254/517 (49.13%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVD 2117
            P+LP  +V+ +  +    ++ NA AYLQHL + N++ K +VR   G+ T++ L     P +   A   L+N+S+         I+   GI  +I ++  +ND+   EL    LWNLS +  LK +I+   ++TL   VI+P      +PN D    P    WS + +N  G +RN+S +  EAR +LR+ + L+D++ + +  A   ++T          D+K +ENC CI+RNL+Y + +EV   D  Q  + +        +  K+           KG ELL+  + +V     IL    N  TLEAAAG +QNLSAG+W  S  +R   R +  LP L+EL+    D+V+R+ + ALRNL  + +   LIG+  +  L   +P   +  +K +    + AVL+TI+ +I D  E  +  I  +G ++ I +  S        Q P ++ +    +L+++W     R +L+K+ + ++      N       +P  S        + S+  LVD
Sbjct:  323 PDLP--EVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDMEVRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEPNED--SKPRDAEWSTVFKNTSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDT----------DNKSVENCVCIMRNLSYHVHKEVPGADRFQENELNQQGGIGGQQKKKKDDAGCFGGKKAKGFELLYQPE-VVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPGGQQRPAKNLEEDTVVAVLNTIHEIITDSSENARSLIQTQGIEKLITINKSS-------QSPREV-KAASHVLQMVWSYKELRGALQKEGWNKA------NFQTAVSTLPKGSKGNGKSGFDDSTLPLVD 810          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 212.616 bits (540), Expect = 2.026e-56
Identity = 153/541 (28.28%), Postives = 258/541 (47.69%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS------------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVD 2117
            P+LP  +V+ +  +    ++ NA AYLQHL + N++ K +VR   G+ T++ L     P +   A   L+N+S+         I+   GI  +I ++  +ND+   EL    LWNLS +  LK +I+   ++TL   VI+P      +PN D    P    WS + +N  G +RN+S +  EAR +LR+ + L+D++ + +  A   ++T          D+K +ENC CI+RNL+Y + +EV   D  Q  + +        +  K+                            P  +++ KG ELL+  + +V     IL    N  TLEAAAG +QNLSAG+W  S  +R   R +  LP L+EL+    D+V+R+ + ALRNL  + +   LIG+  +  L   +P   +  +K +    + AVL+TI+ +I D  E  +  I  +G ++ I +  S        Q P ++ +    +L+++W     R +L+K+ + ++      N       +P  S        + S+  LVD
Sbjct:  317 PDLP--EVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDMEVRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEPNED--SKPRDAEWSTVFKNTSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDT----------DNKSVENCVCIMRNLSYHVHKEVPGADRFQENELNQQGGIGGQQKKKKDDAGCFGGKKAKGKKNGDTDKNFDTLDLPKRSESAKGFELLYQPE-VVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPGGQQRPAKNLEEDTVVAVLNTIHEIITDSSENARSLIQTQGIEKLITINKSS-------QSPREV-KAASHVLQMVWSYKELRGALQKEGWNKA------NFQTAVSTLPKGSKGNGKSGFDDSTLPLVD 828          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 211.46 bits (537), Expect = 7.354e-56
Identity = 153/541 (28.28%), Postives = 258/541 (47.69%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS------------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVD 2117
            P+LP  +V+ +  +    ++ NA AYLQHL + N++ K +VR   G+ T++ L     P +   A   L+N+S+         I+   GI  +I ++  +ND+   EL    LWNLS +  LK +I+   ++TL   VI+P      +PN D    P    WS + +N  G +RN+S +  EAR +LR+ + L+D++ + +  A   ++T          D+K +ENC CI+RNL+Y + +EV   D  Q  + +        +  K+                            P  +++ KG ELL+  + +V     IL    N  TLEAAAG +QNLSAG+W  S  +R   R +  LP L+EL+    D+V+R+ + ALRNL  + +   LIG+  +  L   +P   +  +K +    + AVL+TI+ +I D  E  +  I  +G ++ I +  S        Q P ++ +    +L+++W     R +L+K+ + ++      N       +P  S        + S+  LVD
Sbjct:  400 PDLP--EVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDMEVRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEPNED--SKPRDAEWSTVFKNTSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDT----------DNKSVENCVCIMRNLSYHVHKEVPGADRFQENELNQQGGIGGQQKKKKDDAGCFGGKKAKGKKNGDTDKNFDTLDLPKRSESAKGFELLYQPE-VVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPGGQQRPAKNLEEDTVVAVLNTIHEIITDSSENARSLIQTQGIEKLITINKSS-------QSPREV-KAASHVLQMVWSYKELRGALQKEGWNKA------NFQTAVSTLPKGSKGNGKSGFDDSTLPLVD 911          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 211.075 bits (536), Expect = 9.257e-56
Identity = 153/541 (28.28%), Postives = 258/541 (47.69%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS------------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVD 2117
            P+LP  +V+ +  +    ++ NA AYLQHL + N++ K +VR   G+ T++ L     P +   A   L+N+S+         I+   GI  +I ++  +ND+   EL    LWNLS +  LK +I+   ++TL   VI+P      +PN D    P    WS + +N  G +RN+S +  EAR +LR+ + L+D++ + +  A   ++T          D+K +ENC CI+RNL+Y + +EV   D  Q  + +        +  K+                            P  +++ KG ELL+  + +V     IL    N  TLEAAAG +QNLSAG+W  S  +R   R +  LP L+EL+    D+V+R+ + ALRNL  + +   LIG+  +  L   +P   +  +K +    + AVL+TI+ +I D  E  +  I  +G ++ I +  S        Q P ++ +    +L+++W     R +L+K+ + ++      N       +P  S        + S+  LVD
Sbjct:  388 PDLP--EVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDMEVRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEPNED--SKPRDAEWSTVFKNTSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDT----------DNKSVENCVCIMRNLSYHVHKEVPGADRFQENELNQQGGIGGQQKKKKDDAGCFGGKKAKGKKNGDTDKNFDTLDLPKRSESAKGFELLYQPE-VVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPGGQQRPAKNLEEDTVVAVLNTIHEIITDSSENARSLIQTQGIEKLITINKSS-------QSPREV-KAASHVLQMVWSYKELRGALQKEGWNKA------NFQTAVSTLPKGSKGNGKSGFDDSTLPLVD 899          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 210.305 bits (534), Expect = 1.126e-55
Identity = 153/547 (27.97%), Postives = 258/547 (47.17%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS------------------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVD 2117
            P+LP  +V+ +  +    ++ NA AYLQHL + N++ K +VR   G+ T++ L     P +   A   L+N+S+         I+   GI  +I ++  +ND+   EL    LWNLS +  LK +I+   ++TL   VI+P      +PN D    P    WS + +N  G +RN+S +  EAR +LR+ + L+D++ + +  A   ++T          D+K +ENC CI+RNL+Y + +EV   D  Q  + +        +  K+                                  P  +++ KG ELL+  + +V     IL    N  TLEAAAG +QNLSAG+W  S  +R   R +  LP L+EL+    D+V+R+ + ALRNL  + +   LIG+  +  L   +P   +  +K +    + AVL+TI+ +I D  E  +  I  +G ++ I +  S        Q P ++ +    +L+++W     R +L+K+ + ++      N       +P  S        + S+  LVD
Sbjct:  323 PDLP--EVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDMEVRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEPNED--SKPRDAEWSTVFKNTSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDT----------DNKSVENCVCIMRNLSYHVHKEVPGADRFQENELNQQGGIGGQQKKKKDDAGCFGGKKAKEEWFNQGKKNGDTDKNFDTLDLPKRSESAKGFELLYQPE-VVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPGGQQRPAKNLEEDTVVAVLNTIHEIITDSSENARSLIQTQGIEKLITINKSS-------QSPREV-KAASHVLQMVWSYKELRGALQKEGWNKA------NFQTAVSTLPKGSKGNGKSGFDDSTLPLVD 840          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Mouse
Match: Ctnnd2 (catenin (cadherin associated protein), delta 2 [Source:MGI Symbol;Acc:MGI:1195966])

HSP 1 Score: 206.838 bits (525), Expect = 3.394e-54
Identity = 151/548 (27.55%), Postives = 261/548 (47.63%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS--------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIP-----MHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP     ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +   +  +A   L+N+ +     D ++ + +     GI  ++ ++  + D+   EL   +LWNLS    LK  I+ +A+  L   VI+P       P  D   +   ++ S +LRN  G +RN+S    EAR ++R+ + L D++ Y+I  A    E          IDSK +ENC CILRNL+Y +  E     ++ T +        +N  + + S                      P   + PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+ S  +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P      ++ SK +++  + AV  T++ VI    E  K   +  G ++ + +  S+      D++  K+ +   Q+L  +W+    R   KK  + Q   + S
Sbjct:  511 PYSKSGPALPPEGTLARSPSIDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKI--QLHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSE----------IDSKTVENCVCILRNLSYRLAAETSQGQHMGTDELDGLLCGETNGKDTESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNSNNSGSKAMSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSK-----GDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVAS 1035          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Mouse
Match: Pkp4 (plakophilin 4 [Source:MGI Symbol;Acc:MGI:109281])

HSP 1 Score: 200.675 bits (509), Expect = 3.398e-52
Identity = 163/585 (27.86%), Postives = 265/585 (45.30%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSF---TDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ-EV----------LDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSND-------------NPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII--------------PS-----RNLDPCNVCIPSKSTKPKLDNVN--RSSFDLVDDNRSFHN----------YPGNNK 2156
            P LP  +V+ + ++    +Q NA AYLQHL F +N+ K+EV    G++ +++L   +   +   A   L+N+ F   TD   I   ++ + GI  ++ ++  S D    EL   +LWNLS    +K  I+ +A+ TL   VI+P          D   +      S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I    +  +           DSK +ENC C LRNL+Y ++ EV          LD D L     S     S     K+K    P  D             +PKGVE+LW+   +V+    +L   +N  TLE +AG +QNLSAG+W+ +  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P       +++  +AA+   ++ V     E  K   +  G ++ + +          D+   K+ +   Q+L  LW+    R   KK  + Q+  I              PS     + + P    + S S+ P L  +   RS +D       ++N          YPG++K
Sbjct:  527 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVYRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIA--MKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKI--KFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSD----------YDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELD-DLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPS-VVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSILSDETVAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGR-----GDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLERDRFKSHPSLSTTNQQMSPIIQSVGSTSSSPALLGIREPRSEYDRTQPPMQYYNSQGDTTHKGLYPGSSK 1088          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Mouse
Match: Pkp4 (plakophilin 4 [Source:MGI Symbol;Acc:MGI:109281])

HSP 1 Score: 197.978 bits (502), Expect = 5.252e-52
Identity = 165/604 (27.32%), Postives = 272/604 (45.03%), Query Frame = 3
Query:  519 KTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSF---TDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ-EV----------LDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSND-------------NPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII--------------PS-----RNLDPCNVCIPSKSTKPKLDNVN--RSSFDLVDDNRSFHN----------YPGNNK 2156
            ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K+EV    G++ +++L   +   +   A   L+N+ F   TD   I   ++ + GI  ++ ++  S D    EL   +LWNLS    +K  I+ +A+ TL   VI+P          D   +      S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I    +  +           DSK +ENC C LRNL+Y ++ EV          LD D L     S     S     K+K    P  D             +PKGVE+LW+   +V+    +L   +N  TLE +AG +QNLSAG+W+ +  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P       +++  +AA+   ++ V     E  K   +  G ++ + +          D+   K+ +   Q+L  LW+    R   KK  + Q+  I              PS     + + P    + S S+ P L  +   RS +D       ++N          YPG++K
Sbjct:  167 RSPSIDSIQKDPREFAWRDPELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVYRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIA--MKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKI--KFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSD----------YDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELD-DLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPS-VVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSILSDETVAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGR-----GDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLERDRFKSHPSLSTTNQQMSPIIQSVGSTSSSPALLGIREPRSEYDRTQPPMQYYNSQGDTTHKGLYPGSSK 747          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Mouse
Match: Pkp4 (plakophilin 4 [Source:MGI Symbol;Acc:MGI:109281])

HSP 1 Score: 198.749 bits (504), Expect = 1.241e-51
Identity = 148/508 (29.13%), Postives = 240/508 (47.24%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSF---TDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ-EV----------LDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSND-------------NPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII 2018
            P LP  +V+ + ++    +Q NA AYLQHL F +N+ K+EV    G++ +++L   +   +   A   L+N+ F   TD   I   ++ + GI  ++ ++  S D    EL   +LWNLS    +K  I+ +A+ TL   VI+P          D   +      S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I    +  +           DSK +ENC C LRNL+Y ++ EV          LD D L     S     S     K+K    P  D             +PKGVE+LW+   +V+    +L   +N  TLE +AG +QNLSAG+W+ +  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P       +++  +AA+   ++ V     E  K   +  G ++ + +          D+   K+ +   Q+L  LW+    R   KK  + Q+  I
Sbjct:  543 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVYRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIA--MKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKI--KFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSD----------YDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELD-DLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPS-VVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSILSDETVAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGR-----GDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFI 1027          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Mouse
Match: Pkp4 (plakophilin 4 [Source:MGI Symbol;Acc:MGI:109281])

HSP 1 Score: 198.749 bits (504), Expect = 1.301e-51
Identity = 148/508 (29.13%), Postives = 240/508 (47.24%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSF---TDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ-EV----------LDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSND-------------NPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII 2018
            P LP  +V+ + ++    +Q NA AYLQHL F +N+ K+EV    G++ +++L   +   +   A   L+N+ F   TD   I   ++ + GI  ++ ++  S D    EL   +LWNLS    +K  I+ +A+ TL   VI+P          D   +      S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I    +  +           DSK +ENC C LRNL+Y ++ EV          LD D L     S     S     K+K    P  D             +PKGVE+LW+   +V+    +L   +N  TLE +AG +QNLSAG+W+ +  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P       +++  +AA+   ++ V     E  K   +  G ++ + +          D+   K+ +   Q+L  LW+    R   KK  + Q+  I
Sbjct:  527 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVYRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIA--MKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKI--KFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSD----------YDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELD-DLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPS-VVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSILSDETVAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGR-----GDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFI 1011          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. UniProt/SwissProt
Match: sp|Q9U308|JAC1_CAEEL (Juxtamembrane domain-associated catenin OS=Caenorhabditis elegans OX=6239 GN=jac-1 PE=1 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 3.586e-55
Identity = 147/500 (29.40%), Postives = 248/500 (49.60%), Query Frame = 3
Query:  588 IAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLA-----GIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKL-VKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPK----------------GVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKK--ITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDI 2015
            + +V++   + + + QLNA  YLQHL + +N+ K E R   G+  +I L R   P I   A   LKN+SF        D  +LA     G++ +  ++ +++D S  E A   LWNLS   +LK +IL  A + L + VI P   +    P   +         S + +N  G++RN+S  S +AR +LRD   LI+++ + ++ A         I+  S +DS  +EN  C+LRNL+Y IQEV+DP+Y        P    S+     K ++ P  +  K                G  +LW   H+V+    +L++ +N  TLEA+AG IQNL+A  + PS E+R   R++  LP L+EL+ +  D V+ + +TALRNL  + +   LIG   LR   +K+P     ++  I++  + AVL  ++ +++    + K+    KGT +   +  S         Y  ++ ++  Q+L ++W+     +  K+   K++D 
Sbjct:  693 LKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKE----NDANKLAVMEADGVRLIAEVLRTTHDASVKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGTSDPTRHF--------GSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHA---------IQK-SQVDSPTVENAVCLLRNLSYRIQEVVDPNY-------DPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQ-PHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISDQTIGAVLGILFEIVRSSAAYTKDVHELKGTDKLRALSRSY------PTYSHRVCKYASQVLYVMWQHKELHDGFKRSGLKEADF 1156          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. UniProt/SwissProt
Match: sp|Q9UQB3|CTND2_HUMAN (Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3)

HSP 1 Score: 208.764 bits (530), Expect = 5.826e-54
Identity = 151/548 (27.55%), Postives = 260/548 (47.45%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS--------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPM-----HAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP     ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +   +  +A   L+N+ +     D ++ + +     GI  ++ ++  + D+   EL   +LWNLS    LK  I+ +A+  L   VI+P       P  D   +   ++ S +LRN  G +RN+S    EAR ++R+ + L D++ Y+I  A    E          IDSK +ENC CILRNL+Y +  E     ++ T +        +N  + + S                      P   + PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+ S  +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P      +  SK +++  + AV  T++ VI    E  K   +  G ++ + +  S+      D++  K+ +   Q+L  +W+    R   KK  + Q   + S
Sbjct:  515 PYSKSGPALPPEGTLARSPSIDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKI--QLHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSE----------IDSKTVENCVCILRNLSYRLAAETSQGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNSNNTASKAMSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSK-----GDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVAS 1039          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. UniProt/SwissProt
Match: sp|Q68FH0|PKP4_MOUSE (Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 2.377e-51
Identity = 163/585 (27.86%), Postives = 265/585 (45.30%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSF---TDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ-EV----------LDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSND-------------NPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII--------------PS-----RNLDPCNVCIPSKSTKPKLDNVN--RSSFDLVDDNRSFHN----------YPGNNK 2156
            P LP  +V+ + ++    +Q NA AYLQHL F +N+ K+EV    G++ +++L   +   +   A   L+N+ F   TD   I   ++ + GI  ++ ++  S D    EL   +LWNLS    +K  I+ +A+ TL   VI+P          D   +      S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I    +  +           DSK +ENC C LRNL+Y ++ EV          LD D L     S     S     K+K    P  D             +PKGVE+LW+   +V+    +L   +N  TLE +AG +QNLSAG+W+ +  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P       +++  +AA+   ++ V     E  K   +  G ++ + +          D+   K+ +   Q+L  LW+    R   KK  + Q+  I              PS     + + P    + S S+ P L  +   RS +D       ++N          YPG++K
Sbjct:  527 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVYRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIA--MKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKI--KFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSD----------YDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELD-DLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPS-VVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSILSDETVAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGR-----GDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLERDRFKSHPSLSTTNQQMSPIIQSVGSTSSSPALLGIREPRSEYDRTQPPMQYYNSQGDTTHKGLYPGSSK 1088          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. UniProt/SwissProt
Match: sp|Q99569|PKP4_HUMAN (Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2)

HSP 1 Score: 200.29 bits (508), Expect = 2.898e-51
Identity = 163/585 (27.86%), Postives = 265/585 (45.30%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSF---TDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQ-EV----------LDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSND-------------NPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII--------------PS-----RNLDPCNVCIPSKSTKPKLDNVN--RSSFDLVDDNRSFHN----------YPGNNK 2156
            P LP  +V+ + ++    +Q NA AYLQHL F +N+ K+EV    G++ +++L   +   +   A   L+N+ F   TD   I   ++ + GI  ++ ++  S D    EL   +LWNLS    +K  I+ +A+ TL   VI+P          D   +      S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I    +  +           DSK +ENC C LRNL+Y ++ EV          LD D L     S     S     K+K    P  D             +PKGVE+LW+   +V+    +L   +N  TLE +AG +QNLSAG+W+ +  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P       +++  +AA+   ++ V     E  K   +  G ++ + +          D+   K+ +   Q+L  LW+    R   KK  + Q+  I              PS     + + P    + S S+ P L  +   RS +D       ++N          YPG++K
Sbjct:  528 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVCRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIA--MKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKI--KFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSD----------YDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELD-DLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPS-VVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSVLSDETMAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGR-----GDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLERDRFKSHPSLSTTNQQMSPIIQSVGSTSSSPALLGIRDPRSEYDRTQPPMQYYNSQGDATHKGLYPGSSK 1089          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. UniProt/SwissProt
Match: sp|O35927|CTND2_MOUSE (Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.902e-49
Identity = 151/573 (26.35%), Postives = 261/573 (45.55%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS--------------------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKE-------------------------LRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIP-----MHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP     ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +   +  +A   L+N+ +     D ++ + +     GI  ++ ++  + D+   EL   +LWNLS    LK  I+ +A+  L   VI+P       P  D   +   ++ S +LRN  G +RN+S    EAR ++R+ + L D++ Y+I  A    E          IDSK +ENC CILRNL+Y +  E     ++ T +        +N  + + S                      P   + PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+   E                         +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P      ++ SK +++  + AV  T++ VI    E  K   +  G ++ + +  S+      D++  K+ +   Q+L  +W+    R   KK  + Q   + S
Sbjct:  512 PYSKSGPALPPEGTLARSPSIDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKI--QLHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSE----------IDSKTVENCVCILRNLSYRLAAETSQGQHMGTDELDGLLCGETNGKDTESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKGWAEDVAGMAYALRSLPEGAPCLPQWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNSNNSGSKAMSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSK-----GDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVAS 1061          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. TrEMBL
Match: J9K5W2 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 GN=100167447 PE=4 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 3.464e-65
Identity = 161/505 (31.88%), Postives = 263/505 (52.08%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT-DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDY------------LQTRXXXXXXXXXXXXXXXXXXISP---------PSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMH--AKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII 2018
            PNLP  +V+    N N  I+ NA AYLQHL + ++  K + R   G++ + +L     P++   A   L+N+S+    +     I+   GI  +I+++  S D    EL   +LWNLS    LK  I+ + + T++ +++LP          D       I WS + RN  G++RNIS     AR KLR+   LIDS+ Y+IS A  +E+++        I +K +ENC CILRNL+Y  QEV DP+Y             Q +  +     +S K    + +SP         P ++  KG+ELLW  + +V++   +L++ +N  TLEAAAG IQNL+A  W+PS E+R   R +  LP L+EL+ +  D V+ + +TALRNL  +++   LIG   +R L +K+P       +  ++  +AAVL+T+  VIK   EF +  ++  G +R +      +      +Y  ++ +F  Q+L  +W+    R++ KK  +++ D +
Sbjct:  265 PNLP--EVITFLANPNNLIKANAAAYLQHLCYMDDPNKQKTRTLGGIQALAKLLNHDCPDVYRNACGALRNLSYGRQNDENKRAIKDAGGIPLLINLLHKSADAEVKELVTGVLWNLSSCEDLKKSIIDDGLSTIVNHILLPHSGWSPTACSD-------ICWSTVFRNTSGVLRNISSAGEYARKKLRECEHLIDSLLYVISTA--IEKSN--------IGNKSVENCVCILRNLSYRCQEVEDPNYDKHPLPTQSRVGPQPKAENLGCFGASKKKKDIQVVSPKENPSSRIIPRSEPAKGMELLWQPE-VVQSYLALLQSCSNPETLEAAAGAIQNLAACYWQPSIEIRAAVRKEKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDLVQKLPSGNAQHDQGTSDDTIAAVLATLNEVIKKNAEFARSLLDSSGVERLM------NIIRQRQKYTSRVLKFASQVLFAMWQHQELRDAYKKHGWREQDFV 743          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. TrEMBL
Match: A0A2H8TUA6 (Catenin delta-2 OS=Melanaphis sacchari OX=742174 GN=CTNND2_4 PE=4 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 3.466e-65
Identity = 161/505 (31.88%), Postives = 263/505 (52.08%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT-DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDY------------LQTRXXXXXXXXXXXXXXXXXXISP---------PSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMH--AKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII 2018
            PNLP  +V+    N N  I+ NA AYLQHL + ++  K + R   G++ + +L     P++   A   L+N+S+    +     I+   GI  +I+++  S D    EL   +LWNLS    LK  I+ + + T++ +++LP          D       I WS + RN  G++RNIS     AR KLR+   LIDS+ Y+IS A  +E+++        I +K +ENC CILRNL+Y  QEV DP+Y             Q +  +     +S K    + +SP         P ++  KG+ELLW  + +V++   +L++ +N  TLEAAAG IQNL+A  W+PS E+R   R +  LP L+EL+ +  D V+ + +TALRNL  +++   LIG   +R L +K+P       +  ++  +AAVL+T+  VIK   EF +  ++  G +R +      +      +Y  ++ +F  Q+L  +W+    R++ KK  +++ D +
Sbjct:  265 PNLP--EVITFLANPNNLIKANAAAYLQHLCYMDDPNKQKTRTLGGIQALAKLLNHDCPDVYRNACGALRNLSYGRQNDENKRAIKDAGGIPLLINLLHKSADAEVKELVTGVLWNLSSCEDLKKSIIDDGLSTIVNHILLPHSGWSPTVCSD-------ICWSTVFRNTSGVLRNISSAGEYARKKLRECEHLIDSLLYVISTA--IEKSN--------IGNKSVENCVCILRNLSYRCQEVEDPNYDKHPLPTQSRVGPQPKAENLGCFGASKKKKDIQVVSPKENPSSRIIPRSEPAKGMELLWQPE-VVQSYLALLQSCSNPETLEAAAGAIQNLAACYWQPSIEIRAAVRKEKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDLVQKLPSGNAQHDQGTSDDTIAAVLATLNEVIKKNAEFARSLLDSSGVERLM------NIIRQRQKYTSRVLKFASQVLFAMWQHQELRDAYKKHGWREQDFV 743          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. TrEMBL
Match: A0A2S2PDP2 (Catenin delta-2 OS=Schizaphis graminum OX=13262 GN=CTNND2 PE=4 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.873e-65
Identity = 161/505 (31.88%), Postives = 263/505 (52.08%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT-DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDY------------LQTRXXXXXXXXXXXXXXXXXXISP---------PSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMH--AKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII 2018
            PNLP  +V+    N N  I+ NA AYLQHL + ++  K + R   G++ + +L     P++   A   L+N+S+    +     I+   GI  +I+++  S D    EL   +LWNLS    LK  I+ + + T++ +++LP          D       I WS + RN  G++RNIS     AR KLR+   LIDS+ Y+IS A  +E+++        I +K +ENC CILRNL+Y  QEV DP+Y             Q +  +     +S K    + +SP         P ++  KG+ELLW  + +V++   +L++ +N  TLEAAAG IQNL+A  W+PS E+R   R +  LP L+EL+ +  D V+ + +TALRNL  +++   LIG   +R L +K+P       +  ++  +AAVL+T+  VIK   EF +  ++  G +R +      +      +Y  ++ +F  Q+L  +W+    R++ KK  +++ D +
Sbjct:  287 PNLP--EVITFLANPNNLIKANAAAYLQHLCYMDDPNKQKTRTLGGIQALAKLLNHDCPDVYRNACGALRNLSYGRQNDENKRAIKDAGGIPLLINLLHKSADAEVKELVTGVLWNLSSCEDLKKSIIDDGLSTIVNHILLPHSGWSPTACSD-------ICWSTVFRNTSGVLRNISSAGEYARKKLRECEHLIDSLLYVISTA--IEKSN--------IGNKSVENCVCILRNLSYRCQEVEDPNYDKHPLPTQSRVGPQPKAENLGCFGASKKKKDIQVVSPKENPSSRIIPRSEPAKGMELLWQPE-VVQSYLALLQSCSNPETLEAAAGAIQNLAACYWQPSIEIRAAVRKEKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDLVQKLPSGNAQHDQGTSDDTIAAVLATLNEVIKKNAEFARSLLDSSGVERLM------NIIRQRQKYTSRVLKFASQVLFAMWQHQELRDAYKKHGWREQDFV 765          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. TrEMBL
Match: A0A0L8FT46 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22008746mg PE=4 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 6.323e-65
Identity = 159/551 (28.86%), Postives = 277/551 (50.27%), Query Frame = 3
Query:  432 NSVPKSPQNWYSPPSSVKSDSRPPSVVGLKTPAHKG-LQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT-DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDN-------------------PKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPM-HAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII 2018
            N++P+   ++Y+  SS   D       GL + +  G L P+L+  D       + +V+D   + N  I+ ++  YLQHL F +++ K + R   G+  +I L   + P +   A   LKN+S+  + +     I+  +G+  +  ++  S+D    E+   +LWNLS    LK  I+ +++  L+  V++P     +Q      P P  + W+ + RN  G+IRNIS    ++R +LR+ + L++S+ + +  A  + ++D        ID+K +ENC CILRNL+Y IQEV DPD+ + R     +       N           N                   PKG E+LW+   IV    P+L + +N +TLEAA G IQNL+A DW+P  ++R   R +  L  ++EL+ +  D+V+ +A+TALRNL  +++   L+G   +R L  K+P  + +S+  T+  + AV++T+Y +IK   +F    + E G  R + +  SE  F+      +K  ++   +L  +W+        +K+ Y ++D I
Sbjct:  207 NTIPRRRPDYYNIESSKPPDEE---SDGLASSSVDGRLSPRLRKPD-------LQEVIDFLGSPNDAIKADSAGYLQHLCFMDDDVKAKTRALGGIPPLIALLNHEIPEVHKNACGALKNLSYGRNNDDNKKAIKNASGVPALTRLLRKSSDEEVKEMVTGVLWNLSSCEDLKKAIIDDSLTVLVMIVMIPHSGWGRQGTAQPQPPPGQL-WTTVFRNASGVIRNISSAGYQSRKRLRECDGLVESLIHTVKTA--IGQSD--------IDNKPVENCVCILRNLSYRIQEVDDPDFFKKRTQQRQQKMLEKGENTGCFGGAGKKKNSQKTEMKAKPDPSSHKLTPPKGQEILWHPD-IVHIYLPLLADCSNPVTLEAAVGAIQNLAACDWQPGIDIRAAVRKEKGLAIIVELLGVESDKVVCAAATALRNLALDQRNKELVGKYAMRQLVLKLPSDNRQSEATTDDTICAVIATLYEIIKKNPDFAHSLLAEGGVSRLVSITQSEGAFL------EKTVRYSAMVLHTMWQFKELSGEYRKQGYTETDFI 729          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. TrEMBL
Match: A0A2S2PXQ6 (Catenin delta-2 OS=Sipha flava OX=143950 GN=CTNND2_0 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.129e-64
Identity = 161/504 (31.94%), Postives = 264/504 (52.38%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT-DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDY------LQTR-----XXXXXXXXXXXXXXXXXXISP---------PSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMH--AKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII 2018
            PNLP  +V+    N N  I+ NA AYLQHL + ++  K + R   G+  +++L     P++   A   L+N+S+    +     I+   GI  +I+++  S D    EL   +LWNLS    LK  I+ + + T++ +++LP          D       I WS + RN  G++RNIS     AR KLR+   LIDS+ Y+IS A  +E+++        I +K +ENC CILRNL+Y  QE  DP+Y       Q+R     + +     +S K    + +SP         P ++  KG+ELLW  + +V++   +L++ +N  TLEAAAG IQNL+A  W+PS E+R   R +  LP L+EL+ +  D V+ + +TALRNL  +++   LIG   +R L +K+P       +  ++  +AAVL+T+  VIK   EF +  ++  G +R +      +      +Y  ++ +F  Q+L  +W+    R++ KK  +++ D +
Sbjct:  264 PNLP--EVITFLANPNNLIKANAAAYLQHLCYMDDPNKQKTRTLGGIPALVKLLNHDCPDVYRNACGALRNLSYGRQNDENKRAIKDAGGIPLLINLLHKSADAEVKELVTGVLWNLSSCEDLKKSIIDDGLSTIVNHILLPHSGWSPTVCSD-------ICWSTVFRNTSGVLRNISSAGEYARRKLRECEHLIDSLLYVISTA--IEKSN--------IGNKSVENCVCILRNLSYRCQEFEDPNYDKHPLPTQSRVGPPPKENLGCFGASKKKKDIQVVSPKENPSSRIIPRSEPAKGMELLWQPE-VVQSYLALLQSCSNPETLEAAAGAIQNLAACYWQPSIEIRAAVRKEKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDLVQKLPSGNAQHDQGTSDDTIAAVLATLNEVIKKNAEFARSLLDSSGVERLM------NIIRQRQKYTSRVLKFASQVLFAMWQHQELRDAYKKHGWREQDFV 741          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Cavefish
Match: ctnnd2b (catenin (cadherin-associated protein), delta 2b [Source:ZFIN;Acc:ZDB-GENE-070912-532])

HSP 1 Score: 206.453 bits (524), Expect = 9.292e-55
Identity = 156/557 (28.01%), Postives = 258/557 (46.32%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-----------QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS----------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEP-------SKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK-------SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP    +++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +  ++  +A   L+N+ +     D ++ + +     GI  ++ ++  + DV   EL   +LWNLS    LK  I+ +A+  L   +I+P       P  D   L   ++ S +LRN  G +RN+S    EAR ++R+   L D++ Y+I  A    E          IDSK IENC CILRNL+Y +            E LD            +        K+K  S          P S D PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+        S  +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P           +K +++  + A+   ++ VI    E  K   +  G ++ I +  S+      D++  K+ +   Q+L  +W+    R   KK  Y Q   + S
Sbjct:  234 PYSKSGPALPPEATLVRSPSVDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKSEIRRQGGIQLLVDLLDHRMTDVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDVEIRELLTGVLWNLSSCDALKMPIIQDALAVLTNTIIIPHSGWDSSPLQDERKL--HLHSSQVLRNATGCLRNVSSAGEEARRRMRECEGLTDALLYVIQTALGSSE----------IDSKTIENCVCILRNLSYRLAAETSQGQQLGSEELDGVLCTDASGKDAESSGCWGKKKKKKKSHDQWDGVGPFPDSGDPPKGLQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKVGPTPKPWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNNSSGGSVAKSMSDDTITAICCALHEVITKNMENTKALRDAGGIEKLIGIARSK-----GDKHTPKVVKAASQVLNSMWQYRDLRSLYKKDGYSQYHFVGS 767          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Cavefish
Match: PKP4 (plakophilin-4 [Source:NCBI gene;Acc:103023932])

HSP 1 Score: 205.682 bits (522), Expect = 7.123e-54
Identity = 159/577 (27.56%), Postives = 262/577 (45.41%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNI---VCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTY------------AIQEV---LDP-------DY-LQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII-------------------PSRNLDPCNVCIPSKSTKPKLDNV--NRSSFDLVDDNRSFHNYPGNNKFNR 2165
            P LP  +V+ + ++    +Q NA AYLQHL F +N  K EV    G++ +++L   +   +    C AL  L     TD   I   +    G+  ++ ++  + D    E+   +LWNLS    +K  I+ +A+ TL   VI+P          D   L    + S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I     V  +D         DSKI+ENC C LRNL+Y            A QEV   L P       DY    R+    +  +  +        P  + +PKG E+LW+   +V+    +L   +N  TLE AAG +QNLSAG+W+ S  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P    +  +++  +AA+  T++ V     E  K   +  G ++ + +          ++Y  K+ +   Q+L  LW+    R   KK  + Q+  +                    S  + P +    S ++ P +  +   RS +     +  F+NY G+N  ++
Sbjct:  605 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNRTKTEVCRLGGIKHLVDLLDHKALEVQRNSCGALRNLVYGKATDDNKIA--VRNAGGVPALLRLLRKTVDAEVREIVTGVLWNLSSCDAVKMTIVRDALATLTNTVIIPHSGWSSSSYDDDNKL--KFHSSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIKAC--VSTSD--------FDSKIVENCICTLRNLSYRLELEMPPSRLIATQEVDGLLGPESPSKEADYSCWGRKRKKKRKSTQEEQWDGVGPIPGFSKSPKGAEMLWHPS-VVKPYLTLLAESSNPATLEGAAGSLQNLSAGNWKFSAYIRAAVRKEKGLPILVELLRMDNDRVVCSVATALRNMALDVRNKELIGKYAMRDLVNRLP-GGSTTLLSDETVAAICCTLHEVSSKNMENAKALADTGGIEKLVNITKGR-----GERYSMKVVKAAAQVLNTLWQYRDLRTIYKKDGWNQNHFLTPVSTLERDRFKSQPALPTASLQMSPVHQTAGSATSSPAMLGIKEQRSDYQRTQSSMQFYNYQGDNSVHK 1158          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Cavefish
Match: PKP4 (plakophilin-4 [Source:NCBI gene;Acc:103023932])

HSP 1 Score: 205.297 bits (521), Expect = 8.533e-54
Identity = 159/577 (27.56%), Postives = 262/577 (45.41%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNI---VCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTY------------AIQEV---LDP-------DY-LQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII-------------------PSRNLDPCNVCIPSKSTKPKLDNV--NRSSFDLVDDNRSFHNYPGNNKFNR 2165
            P LP  +V+ + ++    +Q NA AYLQHL F +N  K EV    G++ +++L   +   +    C AL  L     TD   I   +    G+  ++ ++  + D    E+   +LWNLS    +K  I+ +A+ TL   VI+P          D   L    + S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I     V  +D         DSKI+ENC C LRNL+Y            A QEV   L P       DY    R+    +  +  +        P  + +PKG E+LW+   +V+    +L   +N  TLE AAG +QNLSAG+W+ S  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P    +  +++  +AA+  T++ V     E  K   +  G ++ + +          ++Y  K+ +   Q+L  LW+    R   KK  + Q+  +                    S  + P +    S ++ P +  +   RS +     +  F+NY G+N  ++
Sbjct:  483 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNRTKTEVCRLGGIKHLVDLLDHKALEVQRNSCGALRNLVYGKATDDNKIA--VRNAGGVPALLRLLRKTVDAEVREIVTGVLWNLSSCDAVKMTIVRDALATLTNTVIIPHSGWSSSSYDDDNKL--KFHSSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIKAC--VSTSD--------FDSKIVENCICTLRNLSYRLELEMPPSRLIATQEVDGLLGPESPSKEADYSCWGRKRKKKRKSTQEEQWDGVGPIPGFSKSPKGAEMLWHPS-VVKPYLTLLAESSNPATLEGAAGSLQNLSAGNWKFSAYIRAAVRKEKGLPILVELLRMDNDRVVCSVATALRNMALDVRNKELIGKYAMRDLVNRLP-GGSTTLLSDETVAAICCTLHEVSSKNMENAKALADTGGIEKLVNITKGR-----GERYSMKVVKAAAQVLNTLWQYRDLRTIYKKDGWNQNHFLTPVSTLERDRFKSQPALPTASLQMSPVHQTAGSATSSPAMLGIKEQRSDYQRTQSSMQFYNYQGDNSVHK 1036          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Cavefish
Match: PKP4 (plakophilin-4 [Source:NCBI gene;Acc:103023932])

HSP 1 Score: 205.297 bits (521), Expect = 9.353e-54
Identity = 159/577 (27.56%), Postives = 262/577 (45.41%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNI---VCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTY------------AIQEV---LDP-------DY-LQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII-------------------PSRNLDPCNVCIPSKSTKPKLDNV--NRSSFDLVDDNRSFHNYPGNNKFNR 2165
            P LP  +V+ + ++    +Q NA AYLQHL F +N  K EV    G++ +++L   +   +    C AL  L     TD   I   +    G+  ++ ++  + D    E+   +LWNLS    +K  I+ +A+ TL   VI+P          D   L    + S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I     V  +D         DSKI+ENC C LRNL+Y            A QEV   L P       DY    R+    +  +  +        P  + +PKG E+LW+   +V+    +L   +N  TLE AAG +QNLSAG+W+ S  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P    +  +++  +AA+  T++ V     E  K   +  G ++ + +          ++Y  K+ +   Q+L  LW+    R   KK  + Q+  +                    S  + P +    S ++ P +  +   RS +     +  F+NY G+N  ++
Sbjct:  591 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNRTKTEVCRLGGIKHLVDLLDHKALEVQRNSCGALRNLVYGKATDDNKIA--VRNAGGVPALLRLLRKTVDAEVREIVTGVLWNLSSCDAVKMTIVRDALATLTNTVIIPHSGWSSSSYDDDNKL--KFHSSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIKAC--VSTSD--------FDSKIVENCICTLRNLSYRLELEMPPSRLIATQEVDGLLGPESPSKEADYSCWGRKRKKKRKSTQEEQWDGVGPIPGFSKSPKGAEMLWHPS-VVKPYLTLLAESSNPATLEGAAGSLQNLSAGNWKFSAYIRAAVRKEKGLPILVELLRMDNDRVVCSVATALRNMALDVRNKELIGKYAMRDLVNRLP-GGSTTLLSDETVAAICCTLHEVSSKNMENAKALADTGGIEKLVNITKGR-----GERYSMKVVKAAAQVLNTLWQYRDLRTIYKKDGWNQNHFLTPVSTLERDRFKSQPALPTASLQMSPVHQTAGSATSSPAMLGIKEQRSDYQRTQSSMQFYNYQGDNSVHK 1144          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Cavefish
Match: PKP4 (plakophilin-4 [Source:NCBI gene;Acc:103023932])

HSP 1 Score: 205.297 bits (521), Expect = 1.022e-53
Identity = 159/577 (27.56%), Postives = 262/577 (45.41%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNI---VCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTY------------AIQEV---LDP-------DY-LQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDII-------------------PSRNLDPCNVCIPSKSTKPKLDNV--NRSSFDLVDDNRSFHNYPGNNKFNR 2165
            P LP  +V+ + ++    +Q NA AYLQHL F +N  K EV    G++ +++L   +   +    C AL  L     TD   I   +    G+  ++ ++  + D    E+   +LWNLS    +K  I+ +A+ TL   VI+P          D   L    + S++LRN  G +RN+S    EAR ++R    L+DS+ Y+I     V  +D         DSKI+ENC C LRNL+Y            A QEV   L P       DY    R+    +  +  +        P  + +PKG E+LW+   +V+    +L   +N  TLE AAG +QNLSAG+W+ S  +R   R +  LP L+EL+ +  D V+ S +TALRN+  + +   LIG   +R L  ++P    +  +++  +AA+  T++ V     E  K   +  G ++ + +          ++Y  K+ +   Q+L  LW+    R   KK  + Q+  +                    S  + P +    S ++ P +  +   RS +     +  F+NY G+N  ++
Sbjct:  541 PELP--EVIHMLQHQFPSVQANAAAYLQHLCFGDNRTKTEVCRLGGIKHLVDLLDHKALEVQRNSCGALRNLVYGKATDDNKIA--VRNAGGVPALLRLLRKTVDAEVREIVTGVLWNLSSCDAVKMTIVRDALATLTNTVIIPHSGWSSSSYDDDNKL--KFHSSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIKAC--VSTSD--------FDSKIVENCICTLRNLSYRLELEMPPSRLIATQEVDGLLGPESPSKEADYSCWGRKRKKKRKSTQEEQWDGVGPIPGFSKSPKGAEMLWHPS-VVKPYLTLLAESSNPATLEGAAGSLQNLSAGNWKFSAYIRAAVRKEKGLPILVELLRMDNDRVVCSVATALRNMALDVRNKELIGKYAMRDLVNRLP-GGSTTLLSDETVAAICCTLHEVSSKNMENAKALADTGGIEKLVNITKGR-----GERYSMKVVKAAAQVLNTLWQYRDLRTIYKKDGWNQNHFLTPVSTLERDRFKSQPALPTASLQMSPVHQTAGSATSSPAMLGIKEQRSDYQRTQSSMQFYNYQGDNSVHK 1094          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008642.1 (pep scaffold:Pmarinus_7.0:GL477625:357396:400748:1 gene:ENSPMAG00000007810.1 transcript:ENSPMAT00000008642.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 4.024e-26
Identity = 70/239 (29.29%), Postives = 125/239 (52.30%), Query Frame = 3
Query:  588 IAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELA--IDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPL--PEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI 1292
            + +V+ + ++N   IQ NA AYLQHL + ++  K EVR   G+  +++L      ++   A   LKN+ + + +     + +  G+  + +++  + D    ELA    +LWNLS    LK  ++T+A+  L+  V++P   L +       PL  P     S +LRN  G +RN+S    EAR ++R+ + L++S+ ++I    D E+          +  K++ENC C+LRNL+Y +
Sbjct:   10 LLEVIQMLQHNLPSIQGNAAAYLQHLCYRDSNIKTEVRRLGGIPLLVDLLGHPKADVQKNACGSLKNLVYGNDDN-KKALRQAGGVPALATLLRRTGDAELQELATTTGLLWNLSSCEALKMAMVTDALSALVASVVVPCAGLARDGESASAPLASPTQGIQSQVLRNATGCLRNMSSAGEEARRQMRECDGLVESLLHIIETCLDTED----------VGGKVVENCVCVLRNLSYRL 237          

HSP 2 Score: 91.6633 bits (226), Expect = 1.727e-19
Identity = 63/211 (29.86%), Postives = 100/211 (47.39%), Query Frame = 3
Query: 1389 PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKK----------ITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKK 1991
            P   D P+G E L++   +V     +LK  AN  TLE AAG +QNL+AG W+ SK +R   R +  LP L+EL+ +  D V+ + +TALRN+  +  +  LIG   +R L +++P    +             +   +AAV   +  V     E  K   +  G +R ++V          D++  K+ +   Q+L  LW+    R   KK
Sbjct:  310 PECPDPPRGPERLFHPS-VVNPYLGLLKKCANPATLEGAAGALQNLAAGGWKLSKYVRAMVRREKGLPVLVELLRMDSDRVVCAVATALRNMAMDVLSKELIGKYAMRDLVQRLPAARGAGGNGNNGHGEMCASEDTVAAVCCALNEVTTQNMENAKALRDAGGIERLVHVTRGR-----TDRFSPKVVKAAAQVLSTLWQYRDLRALYKK 514          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004698.1 (pep scaffold:Pmarinus_7.0:GL479318:180257:182606:1 gene:ENSPMAG00000004277.1 transcript:ENSPMAT00000004698.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.030e-17
Identity = 62/223 (27.80%), Postives = 105/223 (47.09%), Query Frame = 3
Query:  642 ALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRP-QNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKL---VKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQE 1298
            A A++Q   + N   K +V    G+R ++EL +  ++  +  AA   L+N+ F D    + ++  + GI  +  ++ +S D   +  A   LWNLS    LK  +L E +  L+E  ++P   +       N D    PE      I  N  G +RN+S    EAR ++R+   L++S++             EN  T   ++ + +ENC C LRNL+Y + E
Sbjct:   27 ASAFIQSACYRNQANKDKVYTLMGIRDLVELLQENRSAEVQSAACGALRNVIFEDKRNKL-ELRNVQGIPALAGMLGASKDKEVLRQATGALWNLSSCEELKQQLLHEVLDPLVERGVVPHSGVGNVANTLNSD----PE------IFYNATGCLRNLSSAGVEARKQMRECEGLVESLSLFT----------ENAVTSGKLEERTVENCVCTLRNLSYQLGE 228          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Nematostella
Match: EDO39592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9K2])

HSP 1 Score: 157.918 bits (398), Expect = 4.247e-41
Identity = 126/495 (25.45%), Postives = 242/495 (48.89%), Query Frame = 3
Query:  597 VMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLD---------PDYLQTRXXXXXX---XXXXXXXXXXXXISPPSNDNP-------KGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIP---MHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYK 2003
            +++  + +++ + +N+  Y+QHL +N+   K ++R   G+  ++ L    +  +  AA + L+N+SF+    + ++ I + +   GI+ ++ +++ +      EL + +LWNLS    LK  I+   +  ++  +I+P     K       P+P  I WS + RN  GI+RN+S    EAR ++R    L+D   +++     + ++D        +D+K +EN  C+LRNL+Y +++ +D         P+  + +   + +      +  G  +K  +P     P       +GV LLW  + IV+    I+   +N  TLE  AG + NL A DW  +  +R   R    LP L+EL+ I  D V+R+ +T LRNL  + +   LIG   +R L  ++P     + S++++   +  +L  I+ V+    +  K+     G ++ + +  ++      ++Y  KI +   Q+L  LW     R SLKK+ ++
Sbjct:    7 LIEYLQTDDINLVVNSAYYIQHLCYNDEAVKGKIRELGGIPALVHLLNHDHYEVHRAAASCLRNVSFSKERDENKLAIAECD---GIETLLRLLQRTPKDEVKELVLGVLWNLSSCEALKYRIIRLCLIIIVTTIIIPYSGWDKNLFQSGKPIP-PIKWSTVFRNASGILRNLSSAGLEARREMRACAGLVDCFVWIVHAP--IGKSD--------VDNKSVENSVCVLRNLSYRLEDEIDRELHPDAPLPNEEKKKDKVASEHPPSCFAGCGGMRKGKAPKDKKEPTVKRDPVEGVALLWQPE-IVKPYLSIMAEASNPETLEGVAGALHNLMACDWRWAVVIRSAVRKDKGLPILVELLRIDNDPVVRAVATCLRNLAIDPRNKDLIGKYAMRDLVRRLPDPEKESDSERVSETVIGPILCAIHQVVNKSLDNGKQCREHGGFKKIVAISKNK------ERYSYKILKTANQVLMTLWALTALRNSLKKEEWE 480          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Nematostella
Match: EDO49843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RES5])

HSP 1 Score: 81.6481 bits (200), Expect = 4.191e-16
Identity = 69/248 (27.82%), Postives = 127/248 (51.21%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNM-SFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELA-IDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPD 1313
            P++P   ++D  ++ NV+  ++A  YLQHL +N+++ K +VR   G+  ++     QN  +  AA  VL+N+ S T ++    +I    GI+++I +++ S+     EL  +     L +  +  ++++   +KT   +      + V Q +    P      WS +LR+   I+RN+S    +AR  +R+E  LID + ++I  +  V+  + N E V        ENC C +RNL+Y ++  LD D
Sbjct:    2 PDIP--DLLDYMQSGNVDKMIHAGFYLQHLCYNDDDVKNKVRILGGIPIVVRCLSHQNDQVRFAAACVLRNLSSGTKSDQNKLEIADCDGIEKLIEMLQRSDKPESCELGFVLQTLRLRILRLCLHMLVIIIIKTYSGWD-----RNVAQRD----PPKMDGQWSELLRHATRIVRNLSSAGLQAREDMRNEEYLIDCLVWIIRTS--VKNKNWNDECV--------ENCVCTMRNLSYRLESELDRD 228          

HSP 2 Score: 68.1662 bits (165), Expect = 9.211e-12
Identity = 45/179 (25.14%), Postives = 89/179 (49.72%), Query Frame = 3
Query: 1413 GVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHA--KSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQI 1943
            G  LL+     V   F +LKN  N  TLE +AG + NL+A  W+ + ++R + R +  +P +I L+ I  D  IR+++  LRNL  + +   +IG  G   L  ++P     + + I +  + +++  +Y + +  ++  K      G +R + +  S+      ++Y D++ +   Q+
Sbjct:  305 GAALLYQGT-TVRQYFILLKNAKNNETLEGSAGALHNLTACSWKWAIKIRGDTRREQVIPNVISLLRIDYDPTIRASAILLRNLSVDRENKRIIGEKGTGPLVNRLPTGEPREPRVINDATIVSIMCALYQLGQKSEKNAKILRKTTGIRRMVRIAKSQ------ERYDDRVVRTANQV 476          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Medaka
Match: arvcfa (armadillo repeat protein deleted in velo-cardio-facial syndrome homolog [Source:NCBI gene;Acc:101157472])

HSP 1 Score: 208.379 bits (529), Expect = 2.038e-55
Identity = 147/532 (27.63%), Postives = 259/532 (48.68%), Query Frame = 3
Query:  630 IQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVDDNRSFHNYPGNNKFNRDSCSTMVSNSALQQRNSR 2219
            ++ NA AYLQHL + N+  K EVR  NG+  ++ L       +   A   L+N+S+         I+   GIQ ++ ++  S+ +   ELA   LWNLS H  LK +++ + ++TL + +I+P     ++ + D   L ++  W+ + +N  G +RN+S +  EAR +LR+   L+ ++ + +  A   ++TD          +K +ENC CILRNL+Y + + + P   + ++  +   +S     K+      +   PKG+ELL+  + +V     +L    N  TLEAAAG +QNL+AG W  S  +RV  R +  LP L+EL+    D+V+R+ + ALRNL  +++   LI +  LR L   +P   +  +K +    + ++L+TI+ +I D  E  +  +     Q+ + +  S            +  +    +L+ +W     R SL K  + +S   P+ +         SKS K  +D++   +  L+D N+  ++    N    D     V    LQ  + R
Sbjct:  331 VKSNAAAYLQHLCYENDRIKQEVRQLNGVPILVALLDHPKAEVHRKACGALRNISYGKDHNNKIAIKNCGGIQALVRLLRKSSSMEVKELATGTLWNLSSHEPLKMMVINQGLQTLTDEIIIPHSGWRRRDSADSSKL-QSAEWTTVFKNTSGCLRNVSSDGAEARQRLRECEGLVAALLHALQSAVINKDTD----------NKSVENCVCILRNLSYHVHKEV-PGTERLQEPHACHLRSVGLQKKKNEPDSLAGKRPKGLELLYQPE-VVRLYLSLLTCSHNHNTLEAAAGALQNLAAGQWAWSSYIRVTVRKEKGLPVLVELLRSDVDKVVRAVAIALRNLAIDKRNKDLIANYALRELVGNLPCGQQHPAKNLEGDTVVSILNTIHEIITDSPENARALVQCHAVQKLVAINKSSQ--------STRETKAASHVLQTIWTFKELRNSLNKAGWNKSHFKPTTS----GAAKKSKSGKQGIDDI---TSPLMDKNQDVYSTLEPNGRAGDGKGPAVERDPLQATSER 834          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Medaka
Match: ctnnd2b (catenin delta-2 [Source:NCBI gene;Acc:101168153])

HSP 1 Score: 206.838 bits (525), Expect = 2.298e-54
Identity = 153/548 (27.92%), Postives = 258/548 (47.08%), Query Frame = 3
Query:  471 PSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFT----DTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-----------QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXIS---------PPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKS------KKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPS 2024
            P S    + PP     ++P+   +Q   +      P LP  +V+ + ++    +Q NA AYLQHL F +N+ K E+R   G++ +++L   +  ++  +A   L+N+ +     D ++ + +     GI  ++ ++  + DV   EL   +LWNLS    LK  I+ +A+  L   VI+P       P+         ++ S +LRN  G +RN+S    EAR ++R+   L D++ Y+I  A    E          IDSK +ENC CILRNL+Y +            E LD  +  T    +       K  K+K            P   + PKG+++LW+   IV+    +L   +N  TLE AAG +QNL+AG W+ S  +R   R +  LP L+EL+ I  D V+ + +TALRN+  + +   LIG   +R L  ++P  + +      K +++  + A+   ++ VI    E  K   +  G ++ I +  S+      D++  K+ +   Q+L  +W+    R   KK  Y Q   + S
Sbjct:  368 PYSKSGPALPPEAALGRSPSVDSIQKDPREFGWRDPELP--EVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKSEIRRQGGIQLLVDLLDHRMTDVHRSACGALRNLVYGKANDDNKIALKNC---GGIPALVRLLRKTTDVEIRELLTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWDTSPH-TQEDRKLHLHSSQVLRNATGCLRNVSSAGEEARRRMRECEGLTDALLYVIQTALGSSE----------IDSKTVENCVCILRNLSYRLAAETAHSQQGGSEELDGLFCDTGGKDAESSGCWGKKKKKKKGHDQWDGVGPFPDLAEPPKGIQMLWHPS-IVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDIRNKELIGKYAMRDLVHRLPGGSNNNNTTTRKTMSDDTITAICCALHEVITKNMENTKALRDAGGIEKLISIARSK-----GDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGYSQYHFVGS 893          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Medaka
Match: ARVCF (ARVCF delta catenin family member [Source:NCBI gene;Acc:101156416])

HSP 1 Score: 204.527 bits (519), Expect = 7.131e-54
Identity = 139/491 (28.31%), Postives = 237/491 (48.27%), Query Frame = 3
Query:  630 IQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYV-RDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNV 2090
            ++ NA AYLQHL + N++ K +VR   G+  ++ L       +   A   L+N+S+         I+   GI  +I ++  +ND+   EL    LWNLS +  LK +I+   ++T+   VI+P      +PN D    P    W+ + +N  G +RN+S +  EAR +LR+   L+D++ + +  A  V + D        +D+K +ENC CI+RNL+Y + +EV   +  Q          +     K+           KG ELL+  + +V     +L    N  TLEAAAG +QNLSAG W  S  +R   R +  LP L+EL+    D+V+R+ + ALRNL  + +   LIGS  +R L   +P   +  +K +    + A+L+TI+ ++ D  E  +  I  +  ++ + + R S+           +  +    +L+ +W     R +L K  + ++   P+  + P      +K+ KP  D+ 
Sbjct:  466 VKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVGLLDHPKSEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDMEVRELITGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEHEPNEDSK--PRDAEWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSA--VGKKD--------MDNKSVENCVCIMRNLSYHVHKEVPGAERFQDPSAPQAPGSAGPHRKKKDDAGCFGGKKAKGFELLYQPE-VVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWMWSNYIRATVRKEKGLPVLVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPSGQQRPAKNLEEDTVVAILNTIHEIVTDSSENARSLIQAQAIEKLVAINRTSQSA---------RETKAASHVLQTVWSYKDLRNALTKDGWNKTHFQPTVAVTP----KATKNGKPGYDDT 930          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Medaka
Match: arvcfa (armadillo repeat protein deleted in velo-cardio-facial syndrome homolog [Source:NCBI gene;Acc:101157472])

HSP 1 Score: 203.371 bits (516), Expect = 7.751e-54
Identity = 150/537 (27.93%), Postives = 258/537 (48.04%), Query Frame = 3
Query:  630 IQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQ----TRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVDDNRSFHNYPGNNKFNRDSCSTMVSNSALQQRNSR 2219
            ++ NA AYLQHL + N+  K EVR  NG+  ++ L       +   A   L+N+S+         I+   GIQ ++ ++  S+ +   ELA   LWNLS H  LK +++ + ++TL + +I+P     ++ + D   L ++  W+ + +N  G +RN+S +  EAR +LR+   L+ ++ + +  A   ++T          D+K +ENC CILRNL+Y + +EV   + LQ        S    K  N+ +      P      +G+ELL+  + +V     +L    N  TLEAAAG +QNL+AG W  S  +RV  R +  LP L+EL+    D+V+R+ + ALRNL  +++   LI +  LR L   +P   +  +K +    + ++L+TI+ +I D  E  +  +     Q+ + +  S            +  +    +L+ +W     R SL K  + +S   P+ +         SKS K  +D++   +  L+D N+  ++    N    D     V    LQ  + R
Sbjct:  331 VKSNAAAYLQHLCYENDRIKQEVRQLNGVPILVALLDHPKAEVHRKACGALRNISYGKDHNNKIAIKNCGGIQALVRLLRKSSSMEVKELATGTLWNLSSHEPLKMMVINQGLQTLTDEIIIPHSGWRRRDSADSSKL-QSAEWTTVFKNTSGCLRNVSSDGAEARQRLRECEGLVAALLHALQSAVINKDT----------DNKSVENCVCILRNLSYHVHKEVPGTERLQEPHACHLRSVGLQKKKNEPDSLAGKRPKEEWFTQGLELLYQPE-VVRLYLSLLTCSHNHNTLEAAAGALQNLAAGQWAWSSYIRVTVRKEKGLPVLVELLRSDVDKVVRAVAIALRNLAIDKRNKDLIANYALRELVGNLPCGQQHPAKNLEGDTVVSILNTIHEIITDSPENARALVQCHAVQKLVAINKSSQ--------STRETKAASHVLQTIWTFKELRNSLNKAGWNKSHFKPTTS----GAAKKSKSGKQGIDDI---TSPLMDKNQDVYSTLEPNGRAGDGKGPAVERDPLQATSER 840          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Medaka
Match: arvcfa (armadillo repeat protein deleted in velo-cardio-facial syndrome homolog [Source:NCBI gene;Acc:101157472])

HSP 1 Score: 202.216 bits (513), Expect = 1.115e-53
Identity = 151/537 (28.12%), Postives = 257/537 (47.86%), Query Frame = 3
Query:  630 IQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAI-QEVLDPDYLQ----TRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAK--SKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVDDNRSFHNYPGNNKFNRDSCSTMVSNSALQQRNSR 2219
            ++ NA AYLQHL + N+  K EVR  NG+  ++ L       +   A   L+N+S+         I+   GIQ ++ ++  S+ +   ELA   LWNLS H  LK +++ + ++TL + +I+P     ++ + D   L  A  W+ + +N  G +RN+S +  EAR +LR+   L+ ++ + +  A   ++T          D+K +ENC CILRNL+Y + +EV   + LQ        S    K  N+ +      P      +G+ELL+  + +V     +L    N  TLEAAAG +QNL+AG W  S  +RV  R +  LP L+EL+    D+V+R+ + ALRNL  +++   LI +  LR L   +P   +  +K +    + ++L+TI+ +I D  E  +  +     Q+ + +  S            +  +    +L+ +W     R SL K  + +S   P+ +         SKS K  +D++   +  L+D N+  ++    N    D     V    LQ  + R
Sbjct:  272 VKSNAAAYLQHLCYENDRIKQEVRQLNGVPILVALLDHPKAEVHRKACGALRNISYGKDHNNKIAIKNCGGIQALVRLLRKSSSMEVKELATGTLWNLSSHEPLKMMVINQGLQTLTDEIIIPHSGWRRRDSADSSKLQSA-EWTTVFKNTSGCLRNVSSDGAEARQRLRECEGLVAALLHALQSAVINKDT----------DNKSVENCVCILRNLSYHVHKEVPGTERLQEPHACHLRSVGLQKKKNEPDSLAGKRPKEEWFTQGLELLYQPE-VVRLYLSLLTCSHNHNTLEAAAGALQNLAAGQWAWSSYIRVTVRKEKGLPVLVELLRSDVDKVVRAVAIALRNLAIDKRNKDLIANYALRELVGNLPCGQQHPAKNLEGDTVVSILNTIHEIITDSPENARALVQCHAVQKLVAINKSSQ--------STRETKAASHVLQTIWTFKELRNSLNKAGWNKSHFKPTTS----GAAKKSKSGKQGIDDI---TSPLMDKNQDVYSTLEPNGRAGDGKGPAVERDPLQATSER 781          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Planmine SMEST
Match: SMESG000061216.1 (SMESG000061216.1)

HSP 1 Score: 1536.16 bits (3976), Expect = 0.000e+0
Identity = 810/814 (99.51%), Postives = 811/814 (99.63%), Query Frame = 3
Query:  246 GRSSANDGDNHCYVNLNQTHSGPRISSNNSNHGNAMYSPAKKPLTVNNVNKLPPKVSLNNSRNSVPKSPQNWYSPPSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVDDNRSFHNYPGNNKFNRDSCSTMVSNSALQQRNSRAFTTNVVPGYGQVKVPIXXXXXXXXXXXXXXXXXXXEKSGKEIKKRGQPYIYNEIVSKPRMSTSNQKIHNSPAGGPGXXXXXXXXXXXXXQEDISKNWPNRHVAKNPNRPPPDITNQRDSQISNVSDVYNYEYSVPIKAQKTPITADKHDKVDSWV 2687
            GRSSANDGDNHCYVNLNQTHSGPRISSNNS HGNAMYSPAKKPLTVNNVNKLPPKVSLNNSRNSVPKSPQNWYSPPSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQ RQNSSPKPKSSNKGNKQKSISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVDDNRSFHNYPGNNKFNRDSCSTMVSNSALQQRNSRAFTTNVVPGYGQVKVPINSNPRNKNNTNFNSFDTTSEKSGKEIKKRGQPYIYNEIVSKPRMSTSNQK+HNSPAGGPGSHHSYSNNSYASSQEDISKNWPNRHVAKNPNRPP DITNQRDSQISNVSDVYNYEYSVPIKAQKTPITADKHDKVDSWV
Sbjct:   17 GRSSANDGDNHCYVNLNQTHSGPRISSNNSYHGNAMYSPAKKPLTVNNVNKLPPKVSLNNSRNSVPKSPQNWYSPPSSVKSDSRPPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIRNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQARQNSSPKPKSSNKGNKQKSISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKNYKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVDDNRSFHNYPGNNKFNRDSCSTMVSNSALQQRNSRAFTTNVVPGYGQVKVPINSNPRNKNNTNFNSFDTTSEKSGKEIKKRGQPYIYNEIVSKPRMSTSNQKVHNSPAGGPGSHHSYSNNSYASSQEDISKNWPNRHVAKNPNRPPLDITNQRDSQISNVSDVYNYEYSVPIKAQKTPITADKHDKVDSWV 830          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Planmine SMEST
Match: SMESG000072739.1 (SMESG000072739.1)

HSP 1 Score: 150.214 bits (378), Expect = 1.677e-37
Identity = 126/468 (26.92%), Postives = 227/468 (48.50%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQ------IELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGII----RNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKS--KKITNP-----------------ALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFF 1892
            P +P  +++D+    NV+IQ N LA+LQH+ ++N   K  +R   G+  I+ L    +  +   A  V++N+S      I T ++ L G +R+I IIE+  + S       +E    IL NLS   +    +    + T + +V+LP   +   P  + V L +  + +I   + L  +    +N+S    E R  +R    L+DS+T +I  + + E            +++ +E+C CI+RNL Y++      D LQ+    S   K+      +   S P   +  G  LLWNS+ +++    I+    N +++EAA G +QNL+    + ++E RV FR +  LP L+  V   PD V++ A  ALRNL ++ +   LIG++GL  + + +P  ++   K+I +P                  + ++LS I  +++  +  ++ F+   G + CIY+  S+ F+
Sbjct:    9 PGIP--ELLDVLATGNVDIQSNVLAFLQHITYDNENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIKTLLKEL-GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLNITFGSWLEFVTLFLKNMSSGPNETRDMMRMCEGLLDSVTSIIQFSFNTEA----------FNNRTVESCICIIRNLCYSLH-----DILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGGQMLLWNSE-MIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKLAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSILSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFY 457          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Planmine SMEST
Match: SMESG000072739.1 (SMESG000072739.1)

HSP 1 Score: 149.058 bits (375), Expect = 4.030e-37
Identity = 124/468 (26.50%), Postives = 225/468 (48.08%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQ------IELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGII----RNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKS--KKITNP-----------------ALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFF 1892
            P +P  +++D+    NV+IQ N LA+LQH+ ++N   K  +R   G+  I+ L    +  +   A  V++N+S          I++  G +R+I IIE+  + S       +E    IL NLS   +    +    + T + +V+LP   +   P  + V L +  + +I   + L  +    +N+S    E R  +R    L+DS+T +I  + + E            +++ +E+C CI+RNL Y++      D LQ+    S   K+      +   S P   +  G  LLWNS+ +++    I+    N +++EAA G +QNL+    + ++E RV FR +  LP L+  V   PD V++ A  ALRNL ++ +   LIG++GL  + + +P  ++   K+I +P                  + ++LS I  +++  +  ++ F+   G + CIY+  S+ F+
Sbjct:    9 PGIP--ELLDVLATGNVDIQSNVLAFLQHITYDNENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLNITFGSWLEFVTLFLKNMSSGPNETRDMMRMCEGLLDSVTSIIQFSFNTEA----------FNNRTVESCICIIRNLCYSLH-----DILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGGQMLLWNSE-MIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKLAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSILSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFY 454          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Planmine SMEST
Match: SMESG000072739.1 (SMESG000072739.1)

HSP 1 Score: 149.058 bits (375), Expect = 4.413e-37
Identity = 124/468 (26.50%), Postives = 225/468 (48.08%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQ------IELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGII----RNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKS--KKITNP-----------------ALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFF 1892
            P +P  +++D+    NV+IQ N LA+LQH+ ++N   K  +R   G+  I+ L    +  +   A  V++N+S          I++  G +R+I IIE+  + S       +E    IL NLS   +    +    + T + +V+LP   +   P  + V L +  + +I   + L  +    +N+S    E R  +R    L+DS+T +I  + + E            +++ +E+C CI+RNL Y++      D LQ+    S   K+      +   S P   +  G  LLWNS+ +++    I+    N +++EAA G +QNL+    + ++E RV FR +  LP L+  V   PD V++ A  ALRNL ++ +   LIG++GL  + + +P  ++   K+I +P                  + ++LS I  +++  +  ++ F+   G + CIY+  S+ F+
Sbjct:    9 PGIP--ELLDVLATGNVDIQSNVLAFLQHITYDNENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLNITFGSWLEFVTLFLKNMSSGPNETRDMMRMCEGLLDSVTSIIQFSFNTEA----------FNNRTVESCICIIRNLCYSLH-----DILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGGQMLLWNSE-MIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKLAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSILSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFY 454          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Planmine SMEST
Match: SMESG000072739.1 (SMESG000072739.1)

HSP 1 Score: 146.747 bits (369), Expect = 1.411e-36
Identity = 124/468 (26.50%), Postives = 225/468 (48.08%), Query Frame = 3
Query:  576 PNLPIAKVMDLCKNNNVEIQLNALAYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSFTDTEVIITDIERLAGIQRMISIIESSNDVSQ------IELAIDILWNLSVHYVLKNIILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGII----RNISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKIIENCACILRNLTYAIQEVLDPDYLQTRXXXXXXXXXXXXXXXXXXISPPSNDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEPSKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIGSNGLRILTEKIPMHAKS--KKITNP-----------------ALAAVLSTIYAVIKDQDEFMKEFINEKGTQRCIYVRDSEDFF 1892
            P +P  +++D+    NV+IQ N LA+LQH+ ++N   K  +R   G+  I+ L    +  +   A  V++N+S          I++  G +R+I IIE+  + S       +E    IL NLS   +    +    + T + +V+LP   +   P  + V L +  + +I   + L  +    +N+S    E R  +R    L+DS+T +I  + + E            +++ +E+C CI+RNL Y++      D LQ+    S   K+      +   S P   +  G  LLWNS+ +++    I+    N +++EAA G +QNL+    + ++E RV FR +  LP L+  V   PD V++ A  ALRNL ++ +   LIG++GL  + + +P  ++   K+I +P                  + ++LS I  +++  +  ++ F+   G + CIY+  S+ F+
Sbjct:    9 PGIP--ELLDVLATGNVDIQSNVLAFLQHITYDNENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLNITFGSWLEFVTLFLKNMSSGPNETRDMMRMCEGLLDSVTSIIQFSFNTEA----------FNNRTVESCICIIRNLCYSLH-----DILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGGQMLLWNSE-MIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKLAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSILSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFY 454          
The following BLAST results are available for this feature:
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTNND21.926e-5527.55catenin delta 2 [Source:HGNC Symbol;Acc:HGNC:2516][more]
CTNND27.117e-5527.55catenin delta 2 [Source:HGNC Symbol;Acc:HGNC:2516][more]
CTNND21.213e-5427.55catenin delta 2 [Source:HGNC Symbol;Acc:HGNC:2516][more]
PKP46.034e-5227.86plakophilin 4 [Source:HGNC Symbol;Acc:HGNC:9026][more]
PKP41.903e-5129.13plakophilin 4 [Source:HGNC Symbol;Acc:HGNC:9026][more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jac-11.701e-5629.41Juxtamembrane domain-associated catenin [Source:U... [more]
jac-12.225e-5629.40Juxtamembrane domain-associated catenin [Source:U... [more]
jac-12.819e-5629.40Juxtamembrane domain-associated catenin [Source:U... [more]
jac-13.318e-5629.40Juxtamembrane domain-associated catenin [Source:U... [more]
jac-13.318e-5629.40Juxtamembrane domain-associated catenin [Source:U... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
p120ctn3.317e-2827.37gene:FBgn0260799 transcript:FBtr0111114[more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arvcfa9.183e-5628.29ARVCF delta catenin family member a [Source:ZFIN;A... [more]
ctnnd2b1.962e-5528.26catenin (cadherin-associated protein), delta 2b [S... [more]
ctnnd2b6.066e-5429.01catenin (cadherin-associated protein), delta 2b [S... [more]
ctnnd2a7.896e-5327.16catenin (cadherin-associated protein), delta 2a [S... [more]
ctnnd2a9.358e-5327.16catenin (cadherin-associated protein), delta 2a [S... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARVCF3.589e-5929.40ARVCF, delta catenin family member [Source:NCBI ge... [more]
ARVCF2.026e-5628.28ARVCF, delta catenin family member [Source:NCBI ge... [more]
ARVCF7.354e-5628.28ARVCF, delta catenin family member [Source:NCBI ge... [more]
ARVCF9.257e-5628.28ARVCF, delta catenin family member [Source:NCBI ge... [more]
ARVCF1.126e-5527.97ARVCF, delta catenin family member [Source:NCBI ge... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctnnd23.394e-5427.55catenin (cadherin associated protein), delta 2 [So... [more]
Pkp43.398e-5227.86plakophilin 4 [Source:MGI Symbol;Acc:MGI:109281][more]
Pkp45.252e-5227.32plakophilin 4 [Source:MGI Symbol;Acc:MGI:109281][more]
Pkp41.241e-5129.13plakophilin 4 [Source:MGI Symbol;Acc:MGI:109281][more]
Pkp41.301e-5129.13plakophilin 4 [Source:MGI Symbol;Acc:MGI:109281][more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U308|JAC1_CAEEL3.586e-5529.40Juxtamembrane domain-associated catenin OS=Caenorh... [more]
sp|Q9UQB3|CTND2_HUMAN5.826e-5427.55Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 ... [more]
sp|Q68FH0|PKP4_MOUSE2.377e-5127.86Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=... [more]
sp|Q99569|PKP4_HUMAN2.898e-5127.86Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1... [more]
sp|O35927|CTND2_MOUSE1.902e-4926.35Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9K5W23.464e-6531.88Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A2H8TUA63.466e-6531.88Catenin delta-2 OS=Melanaphis sacchari OX=742174 G... [more]
A0A2S2PDP24.873e-6531.88Catenin delta-2 OS=Schizaphis graminum OX=13262 GN... [more]
A0A0L8FT466.323e-6528.86Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2S2PXQ62.129e-6431.94Catenin delta-2 OS=Sipha flava OX=143950 GN=CTNND2... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctnnd2b9.292e-5528.01catenin (cadherin-associated protein), delta 2b [S... [more]
PKP47.123e-5427.56plakophilin-4 [Source:NCBI gene;Acc:103023932][more]
PKP48.533e-5427.56plakophilin-4 [Source:NCBI gene;Acc:103023932][more]
PKP49.353e-5427.56plakophilin-4 [Source:NCBI gene;Acc:103023932][more]
PKP41.022e-5327.56plakophilin-4 [Source:NCBI gene;Acc:103023932][more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008642.14.024e-2629.29pep scaffold:Pmarinus_7.0:GL477625:357396:400748:1... [more]
ENSPMAT00000004698.11.030e-1727.80pep scaffold:Pmarinus_7.0:GL479318:180257:182606:1... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO395924.247e-4125.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498434.191e-1627.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arvcfa2.038e-5527.63armadillo repeat protein deleted in velo-cardio-fa... [more]
ctnnd2b2.298e-5427.92catenin delta-2 [Source:NCBI gene;Acc:101168153][more]
ARVCF7.131e-5428.31ARVCF delta catenin family member [Source:NCBI gen... [more]
arvcfa7.751e-5427.93armadillo repeat protein deleted in velo-cardio-fa... [more]
arvcfa1.115e-5328.12armadillo repeat protein deleted in velo-cardio-fa... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061216.10.000e+099.51SMESG000061216.1[more]
SMESG000072739.11.677e-3726.92SMESG000072739.1[more]
SMESG000072739.14.030e-3726.50SMESG000072739.1[more]
SMESG000072739.14.413e-3726.50SMESG000072739.1[more]
SMESG000072739.11.411e-3626.50SMESG000072739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024138 ID=SMED30024138|Name=Armadillo repeat protein deleted in velo-cardio-facial syndrome-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2938bp
CTTACTTGTTTTAATATTTGCGTTAGTGTAAGACTATTGGTAACCTATTT
TAAACCTTTCAAAGGAAATTATTTTTGTTATTAATATTTAACAATTCAAA
TTAGAAATATATTTTTTCATTTATTATTTTTAACTGTAATATAATAAAAA
TATTATTTATGATACTTTAAAAATTATTTAAACATCTTTAAATCTCAATG
TCATCAAATAACAACAAAACAGCAAATAACAAAAATCTAACATCTGGAAG
AAGCTCTGCGAATGACGGTGATAATCATTGCTATGTTAATTTGAACCAGA
CGCATTCAGGTCCTCGAATTTCATCGAACAATAGTAATCATGGCAATGCA
ATGTATTCACCAGCTAAAAAACCGCTCACAGTAAATAATGTAAATAAATT
ACCACCAAAAGTTTCTCTAAACAATTCAAGAAATTCTGTCCCAAAATCAC
CTCAAAACTGGTACTCACCCCCGAGCAGCGTTAAGTCCGATTCCAGGCCA
CCAAGTGTAGTTGGCTTGAAGACGCCGGCTCACAAAGGTCTACAACCAAA
ATTGCAGACCATCGATGAAAATGCGCCAAATTTACCAATTGCTAAAGTAA
TGGATTTGTGCAAAAACAATAACGTAGAGATACAGTTGAACGCTCTTGCA
TATCTGCAGCATTTAATATTTAATAACAATGAGAAAAAATTGGAAGTCAG
AAATTCCAACGGATTAAGGACTATCATAGAATTAACAAGACCACAAAATC
CAAATATTGTCTGTGCCGCTTTAAATGTTCTGAAAAATATGTCCTTTACC
GACACCGAAGTGATTATTACTGACATTGAAAGACTGGCAGGAATTCAAAG
GATGATCTCAATTATAGAAAGCAGCAATGATGTTTCACAAATAGAATTGG
CTATAGACATTTTATGGAATTTATCTGTACATTATGTCCTAAAAAATATC
ATCCTAACTGAAGCAGTGAAAACCTTAATGGAATATGTTATATTACCCGA
ATGTAAGTTAGTGAAGCAGCCAAATGGAGATTATGTTCCTTTACCAGAAG
CAATAAATTGGTCCATTATTTTAAGGAATTGTCTAGGAATAATAAGGAAT
ATCAGTTATGAAAGTACGGAAGCTCGCATTAAATTACGAGACGAGAACTT
ACTGATCGACAGTATAACTTATTTAATTAGTAAAGCAAAGGATGTTGAAG
AAACTGACGAAAACATCGAAACGGTCTCTCTCATAGATAGTAAAATCATT
GAAAATTGCGCATGTATTTTGAGAAATTTAACGTACGCAATTCAAGAAGT
TCTTGATCCGGATTATTTACAAACTCGACAGAATTCTTCGCCAAAACCAA
AAAGTTCAAATAAAGGAAACAAACAGAAAAGTATCTCCCCACCATCCAAC
GATAACCCTAAAGGCGTTGAATTGTTGTGGAATTCCAAACATATAGTTGA
AACGATATTTCCAATTTTAAAAAATGGTGCTAATGCAATAACCTTGGAAG
CAGCAGCAGGAATAATTCAAAATTTAAGTGCTGGAGATTGGGAACCGAGT
AAAGAGTTGCGAGTTGAGTTTCGCATCCAATTAGCCTTACCGTATTTAAT
TGAATTGGTAGATATAGCTCCAGATGAAGTCATACGATCAGCATCAACTG
CATTGAGAAATCTCGTGCAAGAAGAAAAGACCTGCATGCTTATAGGATCA
AATGGACTTCGTATTCTAACGGAAAAGATTCCAATGCACGCAAAGAGTAA
AAAAATCACCAATCCAGCACTTGCTGCCGTTTTATCAACGATTTATGCAG
TTATTAAAGATCAAGATGAATTTATGAAAGAGTTTATAAATGAAAAAGGC
ACCCAAAGATGTATTTATGTCCGAGATTCTGAGGATTTTTTTGTCTTTGA
TGACCAATATCCTGATAAAATTGCTCAATTTTGTAAACAAATATTAGAAC
TATTATGGAAGACACCAACCGCAAGAGAATCCCTTAAGAAAAAGAATTAC
AAACAATCAGACATTATTCCGTCACGTAATCTGGATCCATGTAATGTTTG
TATACCTTCGAAATCAACGAAGCCGAAACTAGATAATGTTAATAGGAGTT
CTTTTGATTTGGTCGACGATAATCGTTCTTTCCATAATTACCCCGGGAAT
AACAAATTCAATAGAGATAGCTGTAGCACAATGGTTTCAAATTCCGCTTT
ACAGCAGAGAAATTCTAGGGCATTTACTACAAACGTGGTTCCTGGATATG
GACAGGTTAAGGTTCCTATAAATAGCAATCCCAGAAACAAAAACAACACT
AATTTTAATTCGTTTGACACAACCAGTGAAAAAAGTGGTAAAGAAATTAA
AAAAAGAGGCCAACCATACATTTATAATGAGATCGTTTCTAAACCAAGAA
TGAGCACAAGTAATCAAAAGATTCATAATTCTCCTGCAGGAGGTCCAGGA
TCACACCACAGTTACTCAAATAACAGTTATGCAAGCAGTCAAGAGGATAT
ATCAAAAAATTGGCCCAATAGACATGTAGCAAAGAATCCTAATCGACCTC
CGCCAGATATTACAAATCAAAGAGATTCCCAAATTAGTAATGTTTCGGAT
GTATACAATTATGAATATTCCGTTCCCATAAAAGCACAGAAGACTCCGAT
CACAGCGGATAAACATGATAAAGTTGACAGTTGGGTTTAAATATTAATTT
CACAGTTTTCTTTACTACTTTTCTATAAAATTTCTGAATAATAAGGAATT
AATTTATATCATTTTGGTTTGAATTTGATTGGACCTATCATGAGTATATA
ACTTTTGAATACAAATTGTCATTTTTGTCGCATAATGATTTATATTTTCT
ATTTTTTTCAAAATCCAAAGAATTGTTTGTCAAATAGAATATCACAAGAA
ATAGATTATTTTGATTTTATGACACAAAATTATTTGCT
back to top

protein sequence of SMED30024138-orf-1

>SMED30024138-orf-1 ID=SMED30024138-orf-1|Name=SMED30024138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=831bp
MSSNNNKTANNKNLTSGRSSANDGDNHCYVNLNQTHSGPRISSNNSNHGN
AMYSPAKKPLTVNNVNKLPPKVSLNNSRNSVPKSPQNWYSPPSSVKSDSR
PPSVVGLKTPAHKGLQPKLQTIDENAPNLPIAKVMDLCKNNNVEIQLNAL
AYLQHLIFNNNEKKLEVRNSNGLRTIIELTRPQNPNIVCAALNVLKNMSF
TDTEVIITDIERLAGIQRMISIIESSNDVSQIELAIDILWNLSVHYVLKN
IILTEAVKTLMEYVILPECKLVKQPNGDYVPLPEAINWSIILRNCLGIIR
NISYESTEARIKLRDENLLIDSITYLISKAKDVEETDENIETVSLIDSKI
IENCACILRNLTYAIQEVLDPDYLQTRQNSSPKPKSSNKGNKQKSISPPS
NDNPKGVELLWNSKHIVETIFPILKNGANAITLEAAAGIIQNLSAGDWEP
SKELRVEFRIQLALPYLIELVDIAPDEVIRSASTALRNLVQEEKTCMLIG
SNGLRILTEKIPMHAKSKKITNPALAAVLSTIYAVIKDQDEFMKEFINEK
GTQRCIYVRDSEDFFVFDDQYPDKIAQFCKQILELLWKTPTARESLKKKN
YKQSDIIPSRNLDPCNVCIPSKSTKPKLDNVNRSSFDLVDDNRSFHNYPG
NNKFNRDSCSTMVSNSALQQRNSRAFTTNVVPGYGQVKVPINSNPRNKNN
TNFNSFDTTSEKSGKEIKKRGQPYIYNEIVSKPRMSTSNQKIHNSPAGGP
GSHHSYSNNSYASSQEDISKNWPNRHVAKNPNRPPPDITNQRDSQISNVS
DVYNYEYSVPIKAQKTPITADKHDKVDSWV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005912adherens junction
GO:0005913cell-cell adherens junction
Vocabulary: biological process
TermDefinition
GO:0098609cell-cell adhesion
GO:0006260DNA replication
GO:0010172embryonic body morphogenesis
GO:0016337single organismal cell-cell adhesion
GO:0032956regulation of actin cytoskeleton organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR028446JAC-1
IPR028435Plakophilin/d_Catenin
IPR000225Armadillo
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0003677DNA binding
GO:0005524ATP binding
GO:0045296cadherin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000225ArmadilloSMARTSM00185arm_5coord: 306..363
e-value: 38.0
score: 8.7
coord: 465..506
e-value: 8.3
score: 13.9
coord: 202..244
e-value: 92.0
score: 5.8
coord: 160..200
e-value: 4.6E-4
score: 29.5
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 131..621
e-value: 5.4E-100
score: 337.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 705..783
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 74..100
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 74..105
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 746..783
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 377..402
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 705..725
IPR028446Juxtamembrane domain-associated cateninPANTHERPTHR10372:SF27ADHERENS JUNCTION PROTEIN P120coord: 110..798
IPR028435Plakophilin/Delta cateninPANTHERPTHR10372PLAKOPHILLIN-RELATEDcoord: 110..798
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 133..603