slc22a-5

Overview
Nameslc22a-5 (AKN21553.1)
Smed IDSMED30024134
Length (bp)1698
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc22a-5 (SMED30024134) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc22a-5 (SMED30024134) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024134

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024134h1SMcG0010081 SmedASXL_009015SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30024134h1SMcG0010081 dd_Smed_v4_10903_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024134h1SMcG0010081 dd_Smed_v6_10903_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30024134h1SMcG0010081 Contig48150uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30024134h1SMcG0010081 Contig48150newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30024134h1SMcG0010081 Contig48150uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30024134h1SMcG0010081 Contig48150newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30024134h1SMcG0010081 OX_Smed_1.0.11672ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
proximal tubuleSMED30024134h1SMcG0010081 Smed-slc22a-5smed_ncbi_20240424PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc22a-5 vs. Ensembl Human
Match: SLC22A5 (solute carrier family 22 member 5 [Source:HGNC Symbol;Acc:HGNC:10969])

HSP 1 Score: 166.007 bits (419), Expect = 6.005e-44
Identity = 123/415 (29.64%), Postives = 210/415 (50.60%), Query Frame = 2
Query:  356 NWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
             W++++    +TI TE+NLVC       L  ++FFVG+ +G+FI+    D+ GR  ++ + +  +   +    F+ N  + ++L  L G+G    Y     L TEI+    R +++     I Y  GYM++P  AY  +DWR L   L    +L    ++ +PESPRWL   G+F++A   +   AK NG + P   FD      L   KQ+  NI D+  +  +R+   + I +  TISV YFGLS++   L  +IF+N F+  ++E     +AW++   L RR SM     +    L+   F       +  + + L  +GKF +T A+ +  +Y  E++PT +RNM + +    + + ++ +P    +   D F+PY      +++  I    +  FLPE+ G PLP T+++
Sbjct:  116 GWEFSQDVYLSTIVTEWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFYAFGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYFGLSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLL---FMQLVPPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAI----LTLFLPESFGTPLPDTIDQ 523          
BLAST of slc22a-5 vs. Ensembl Human
Match: SLC22A5 (solute carrier family 22 member 5 [Source:HGNC Symbol;Acc:HGNC:10969])

HSP 1 Score: 156.377 bits (394), Expect = 2.148e-40
Identity = 118/403 (29.28%), Postives = 202/403 (50.12%), Query Frame = 2
Query:  392 ISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
            +  ++NLVC       L  ++FFVG+ +G+FI+    D+ GR  ++ + +  +   +    F+ N  + ++L  L G+G    Y     L TEI+    R +++     I Y  GYM++P  AY  +DWR L   L    +L    ++ +PESPRWL   G+F++A   +   AK NG + P   FD      L   KQ+  NI D+  +  +R+   + I +  TISV YFGLS++   L  +IF+N F+  ++E     +AW++   L RR SM     +    L+   F       +  + + L  +GKF +T A+ +  +Y  E++PT +RNM + +    + + ++ +P    +   D F+PY      +++  I    +  FLPE+ G PLP T+++
Sbjct:  152 LPAQWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFYAFGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYFGLSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLL---FMQLVPPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAI----LTLFLPESFGTPLPDTIDQ 547          
BLAST of slc22a-5 vs. Ensembl Human
Match: SLC22A4 (solute carrier family 22 member 4 [Source:HGNC Symbol;Acc:HGNC:10968])

HSP 1 Score: 134.806 bits (338), Expect = 4.350e-33
Identity = 132/534 (24.72%), Postives = 243/534 (45.51%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWT-------VKECQAIARS-----------------ENGTNHTI------YCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDS---LIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNN---FYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELR 1579
            +Y+E I+ +     F  L    LS     +  +  S+VF+  TP ++C  P        W        +++ + +  S                 E G +  +       C + W++++    +T+ TE+NLVC     V L  ++FFVG+ +G+F++    D+ GR  ++   +  +   +    F+ +  +  +L  + G+G    Y     L TEI+    R +++       + +GYML+P  AY  +DWR L   L    +L    ++ +PESPRWL    +F++A   +   AK N    P   FDS   L   KQ+   I D+F ++ + +   + + +    SV YF LS++   L  + +LN F+  L+E      AW++   L RR      ++I +V         F     +    +   L  +GKF +T+A+ +  ++  E++PT +RNM++ +    + + ++ AP    +   +  +PY      +V+    G+L  FF PE+ G  LP+TLE+  +++
Sbjct:    3 DYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLFATMAVQTGFSFLQIFSISWEMFTVLFVIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFFAVGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKAAKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTRNIAIMTIMSLLLWMLTSVGYFALSLDAPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRR------YIIAAVLFWGGGVLLFIQLVPVDYYFLSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSTASRVGSIIAPYFVYLGAYNRMLPYIVMGSLTVLI---GILTLFF-PESLGMTLPETLEQMQKVK 526          
BLAST of slc22a-5 vs. Ensembl Human
Match: SLC22A3 (solute carrier family 22 member 3 [Source:HGNC Symbol;Acc:HGNC:10967])

HSP 1 Score: 131.724 bits (330), Expect = 4.385e-32
Identity = 116/435 (26.67%), Postives = 218/435 (50.11%), Query Frame = 2
Query:  305 QAIARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNF-IAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL--TEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNIT--DIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP----SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNEL 1576
              +A   N +   + CR  W+Y +    +TI +EF+LVC     + L   +  +G   G F +    D+ GR+ +  L+ +   +  + + FA N  + ++ RFL G+  GK     CY+  TEIV  K+R +      + + LG +++PG+AY   +W+ +   +     LF L Y+++PESPRWL    K  KA+  L  IAK NGK    N +  + +T +++ N +  D+  +  MR    +L+F   T +V Y GL +    +  N++++ FI G++E     +  +   +L RR+    + ++  V  ++    +F    ++ + +T+ ++G+  +T A+ I  +  +E++PT +RN  + +  G+     + AP     +  +   +P      + ++  I G L+   LPETKG  LP+T+++  +L
Sbjct:  112 DPLAAFPNRSAPLVPCRGGWRYAQAH--STIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYGRIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGV-FGKGTWMTCYVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKKGDKALQILRRIAKCNGKYLSSN-YSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVACLVT---AFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAPFLLFRLAAVWLELPLI---IFGILASICGGLV-MLLPETKGIALPETVDDVEKL 535          
BLAST of slc22a-5 vs. Ensembl Human
Match: SLC22A24 (solute carrier family 22 member 24 [Source:HGNC Symbol;Acc:HGNC:28542])

HSP 1 Score: 126.716 bits (317), Expect = 2.647e-30
Identity = 113/425 (26.59%), Postives = 206/425 (48.47%), Query Frame = 2
Query:  359 WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLT-EIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIIT---KQKLG------NITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGP-VAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNEN 1594
            W Y+++   +TI TE++LVC  +   +++ ++F  G  +G  I     D++GR  +  L  +   I N C  FA    +  +LRFL+G  T  I      L+ E    + RS+        Y +G ML+ GLA+  +DW  L   +    ++ +L+ + + ES RWL I  +  + +  L  +A  NGK   E    + ++    K++L       +I  +F +  +R+++F L FV   I+V ++GL +N   L SN+ L   + G + TFT   V+ +  + + RR+S ++      + +++N F      I+ +V++TLG IG  +  +      ++ NE+ PT +R+    I           AP +  +  + P+     Y V  +++ + +   LPET+  PLP T+++    RK + N
Sbjct:  120 WVYDRSSFLSTIVTEWDLVCESQSLKSMVQSLFMAGSLLGGLIYGHLSDRVGRKIICKLCFLQLAISNTCAAFAPTFLVYCILRFLAGFSTMTILGNTFILSLEWTLPRSRSMTIMVLLCSYSVGQMLLGGLAFAIQDWHILQLTVSTPIIVLFLSSWKMVESARWLIINNQLDEGLKELRRVAHINGKKNTEETLTTELVRSTMKKELDAVRIKTSIFSLFRAPKLRMRVFGLCFVRFAITVPFYGLILNLQHLGSNVSLFQILCGAV-TFTARCVSLLTLNHMGRRISQILFTFPVGLFILVNTFLPQEMQILRVVLATLG-IGSVSAASNSAS--VHHNELVPTILRSTVAGINAVSGRTGAALAPLLMTLMAYSPHLPWISYGVFPILA-VPVILLLPETRDLPLPNTIQDVENDRKDSRN 539          
BLAST of slc22a-5 vs. Ensembl Celegans
Match: oct-1 (Organic cation transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U539])

HSP 1 Score: 130.954 bits (328), Expect = 3.336e-32
Identity = 117/462 (25.32%), Postives = 213/462 (46.10%), Query Frame = 2
Query:  266 FNQTQLTWTVKECQAIARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGN-FIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQ-GLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXX-XXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGK--IFPENKFDSLIITK--------QKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSV----CLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENN 1597
            +N+TQ+        A   + +     + C+N W Y+ +   +++ TEFNLVC+++ ++ +  T F+VG  +GN       DK GR R   + +   I+      FA +I   I+LRF +GL    ++Q       E +    R        + +     L+  +A   + WR      N P   + + YF LPESPRW    GK+  A   L  IAK NGK  +  +   DS+   +        ++  N+TD+F +  +R K  ++ ++    ++ Y GL++N S L  + + +  I G +E     V W +     RR ++    ++C +     + + + Y +       ++++   IGKF + + + +  ++  E++PT +R + + +   +A    + AP I  + + +         +M L +G+L  FFLPET G PLP T+E+     K  E +
Sbjct:   80 YNETQINVFRAFTSAPVDTYSDRISLVPCQNGWDYDNSTYLDSLVTEFNLVCDQQAWIEISTTSFYVGSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRIFSGLMTSLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVELPGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGYPW-------LVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMGMSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILT-FFLPETLGAPLPMTIEDAENFGKKPEPD 533          
BLAST of slc22a-5 vs. Ensembl Celegans
Match: oct-1 (Organic cation transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U539])

HSP 1 Score: 130.954 bits (328), Expect = 3.336e-32
Identity = 117/462 (25.32%), Postives = 213/462 (46.10%), Query Frame = 2
Query:  266 FNQTQLTWTVKECQAIARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGN-FIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQ-GLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXX-XXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGK--IFPENKFDSLIITK--------QKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSV----CLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENN 1597
            +N+TQ+        A   + +     + C+N W Y+ +   +++ TEFNLVC+++ ++ +  T F+VG  +GN       DK GR R   + +   I+      FA +I   I+LRF +GL    ++Q       E +    R        + +     L+  +A   + WR      N P   + + YF LPESPRW    GK+  A   L  IAK NGK  +  +   DS+   +        ++  N+TD+F +  +R K  ++ ++    ++ Y GL++N S L  + + +  I G +E     V W +     RR ++    ++C +     + + + Y +       ++++   IGKF + + + +  ++  E++PT +R + + +   +A    + AP I  + + +         +M L +G+L  FFLPET G PLP T+E+     K  E +
Sbjct:   80 YNETQINVFRAFTSAPVDTYSDRISLVPCQNGWDYDNSTYLDSLVTEFNLVCDQQAWIEISTTSFYVGSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRIFSGLMTSLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVELPGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGYPW-------LVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMGMSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILT-FFLPETLGAPLPMTIEDAENFGKKPEPD 533          
BLAST of slc22a-5 vs. Ensembl Celegans
Match: oct-1 (Organic cation transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U539])

HSP 1 Score: 130.954 bits (328), Expect = 4.166e-32
Identity = 117/462 (25.32%), Postives = 213/462 (46.10%), Query Frame = 2
Query:  266 FNQTQLTWTVKECQAIARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGN-FIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQ-GLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXX-XXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGK--IFPENKFDSLIITK--------QKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSV----CLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENN 1597
            +N+TQ+        A   + +     + C+N W Y+ +   +++ TEFNLVC+++ ++ +  T F+VG  +GN       DK GR R   + +   I+      FA +I   I+LRF +GL    ++Q       E +    R        + +     L+  +A   + WR      N P   + + YF LPESPRW    GK+  A   L  IAK NGK  +  +   DS+   +        ++  N+TD+F +  +R K  ++ ++    ++ Y GL++N S L  + + +  I G +E     V W +     RR ++    ++C +     + + + Y +       ++++   IGKF + + + +  ++  E++PT +R + + +   +A    + AP I  + + +         +M L +G+L  FFLPET G PLP T+E+     K  E +
Sbjct:   97 YNETQINVFRAFTSAPVDTYSDRISLVPCQNGWDYDNSTYLDSLVTEFNLVCDQQAWIEISTTSFYVGSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRIFSGLMTSLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVELPGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGYPW-------LVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMGMSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILT-FFLPETLGAPLPMTIEDAENFGKKPEPD 550          
BLAST of slc22a-5 vs. Ensembl Celegans
Match: Y82E9BR.16 (pep chromosome:WBcel235:III:1419867:1427226:-1 gene:WBGene00022348.1 transcript:Y82E9BR.16a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y82E9BR.16)

HSP 1 Score: 111.694 bits (278), Expect = 8.909e-26
Identity = 111/468 (23.72%), Postives = 201/468 (42.95%), Query Frame = 2
Query:  350 CRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNF-IAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLT-----EIVSIKRRSL---------------------YTNNYWILYVLGYMLIPGL---------AYGTKDWRLSRHLMNXXXXXXXXXXX--XXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSL-----------IITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSING--IDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQT---LEEGNELRKGNE 1591
            C    ++ + +  T    + + C++      +   ++VG   G+    + GD+IGR ++  LA++ +I     +  A   WL  L R     GTG  + G+  +      E+V  K R L                     Y  NY IL+V+  +  P L         A   K    +  L +F L     +    +PES RWL    ++K+A   L   A  NG + PEN ++ L               +KL    D+F +  +R +  V+ F+   IS+ Y+G+++  + L  +I++N      +E     + +++  ++ RR+ +     I   CL++N  +   + +   +  T  +  K ++T  Y     Y  E+FPT IRN ++     IA +  + A  I+    ++F   F    +  M +++ ++   FLPET G PLP++   +EEG+  R  +E
Sbjct:  105 CHEHIFDHSKVEYTAVQRWEITCDRSWIKATIQAAYYVGQMAGSTTFGMLGDRIGRKKVFFLAIVIQITCAYLIAIAPYWWLYALAR----AGTGFSHPGIFVIAVVIGMELVGPKYRKLASVITGLFFALGQIFLGIEAIYFTNYQILHVV--IASPALLFLSYCQKSAKNRKKIDFANFLADFLLKNRFFFSRWLVPESARWLVSQKRYKEADEVLQKAASVNGTVLPENWWEQLDDSTTGGGGAPGAPTKKLTG-ADLFRTPELRKRTLVVFFLWPVISMVYYGMAMKANVLGGDIYVNFIFAAFVEIPALFIVYLLIDRIGRRLILAGGLFIAGACLLVN--WLMGDNVQLWMAITQMAFTKGSITGVYAAIYTYSPELFPTVIRNTAMGFCSTIARVGAIAASYISMWIAEQFGKVFMIIPFGCMAVLAAVMTLLFLPETMGKPLPESIEEIEEGDSYRSSHE 563          
BLAST of slc22a-5 vs. Ensembl Celegans
Match: K05F1.6 (pep chromosome:WBcel235:II:5782942:5787658:1 gene:WBGene00019408.1 transcript:K05F1.6c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K05F1.6)

HSP 1 Score: 92.4337 bits (228), Expect = 2.243e-19
Identity = 112/461 (24.30%), Postives = 195/461 (42.30%), Query Frame = 2
Query:  350 CRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGL-GTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSR------HLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNIT------------------------DIFGSKIMRLKMFVLIFVHGTISVSYFGLSI---NESFLSSNIF-----LNVFIQGLLETFT-GPVAWIMSSKLNRRVSMLIN------FLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFI--------PYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEG 1567
            C+ + + K  M  TI T+FNLVC+        +  + +G  +G  +  I  DKIGR   I    I   ++ + LPF     + +L+R LS +              EI   K R++  +     + LGY L+  +AY TK W+  +      H M+      +    +PESPRWL +  +  +A    ++        FP N     + T  K GN+                         D+F  K +R +   +  V    ++ Y+GL +   ++S     +F     LN  I G +E  T     W+M  +L R+ ++++       F+I ++  M++  Y      +          GK A+  A+ I  ++ +E++PT +RN ++    G+ S+   F    +G+  +I        P      ++V  L +G+L+ F LPET   PLP+TL++ 
Sbjct:  330 CQAYHFEKDVMVETIVTDFNLVCDSWFAKGHAHMFYSIGYLLGCVLGGIASDKIGRKPTIIGFGILSSMLGVFLPFNDYYPMFLLIRLLSAICNEAADLAAYTLCMEITGTKYRAMVGSMLQAPWALGYALLALIAYLTKSWKTIQVIAAGLHFMS-----IIFICSIPESPRWLMVQNRVSEA--EEVIRKACREPPFPFN-----MCTTSKCGNLPSDLELVSHRERKLNKKNGGKIGFLDLFTMKELRYRTISVCIVFMATALVYYGLVMALSDQSAPGRTLFTGYFHLNNGIAGAIEIPTLFACVWMM--QLGRKKALMLTLITSGLFIIVAMLSMVSGHYMLALAFMY--------FGKIAVQGAFNILYIFTSELYPTVVRNTAV----GVTSMVARFG---SGLSSYIALLSNISLPIVPMIIFAVFSLFAGMLV-FVLPETSEKPLPETLDDA 760          
BLAST of slc22a-5 vs. Ensembl Fly
Match: Balat (gene:FBgn0033778 transcript:FBtr0087815)

HSP 1 Score: 135.961 bits (341), Expect = 1.450e-33
Identity = 124/443 (27.99%), Postives = 208/443 (46.95%), Query Frame = 2
Query:  296 KECQAIARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLT-EIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNG----KIFPENKFDSLIITKQKLGN--------ITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNEL 1576
            ++ + + + +  T   + C++ W Y+K+  ++T+  E+NLVC++   VTL   +F VG  +GN++     D  GR    +  ++ EII      FA N +  + LRF+ GL    I      L  E+V  +RR   T    I Y LG +++ G+ Y  +DWR LS  +    L+ +  +F+LPESPRWL   GK ++AI  L ++A+ NG    + F E     L+IT+             I D+F    MR K  ++  +    +  Y GLS     L  +   N F+ G +E  T  + W   S   RR  + I+ L+  V  +    Y         +   L  +GK  +++++ +  +  +E++PT +R + +     I+ +  +  P IN + + +          + LI G      LPET+   LPQTLEEG  +
Sbjct:  107 QQAEDLLKLQPDTTQVVPCQHGWHYDKSIYSSTVVQEWNLVCDRSFLVTLALVVFGVGGLLGNYVFGYLVDLWGRRPSFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAILASPYVLAIELVGPERRVFCTIVSNIAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRWLMAVGKTRRAIKILKVMARVNGVRVNRDFVERLQRKLVITRAAETKSSMTTHYGILDLFRGPNMRRKTLIITLIWFANTSVYVGLSYYAPALGGDEIWNFFLAGAVELPTYLLLWPGLSYFGRRWILFISMLVGGVACVATFLYP-------DITLLLYCVGKMGISSSFVVLPLMASELYPTVVRGLGMSFSSVISMVGPIVIPMINHMGQQMLVLPLIVMGAL-LILGGFASLLLPETRNRNLPQTLEEGEAV 541          
BLAST of slc22a-5 vs. Ensembl Fly
Match: CG6126 (gene:FBgn0038407 transcript:FBtr0083278)

HSP 1 Score: 130.954 bits (328), Expect = 4.546e-32
Identity = 117/520 (22.50%), Postives = 231/520 (44.42%), Query Frame = 2
Query:  116 EEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWT------------------VKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNF-IAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGL--GTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXX-XXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLG-------NITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGN 1588
            E+ + ++    ++  L      +    + M + S+V +   P ++C     + + L+ T                  ++ C     S  GTN TI C  + Y+ T    + + ++N VC+++    ++ T+F +G+  G   +    DK+GR  +   + ++++II + + F    +  ++ R+L G+    G    G     E+V   +R++    +  ++  G ML+ G      D +  + +      LF   ++ L ESPRWL + G+  +A+  +    + NG   P +K   +   KQ+          ++D+F +  +R+K   +       S+ Y+GLS++   L  N +L +FI GL+E  +      +  +L RR       L   +C ++  + +  +   + V+      GK  +  ++ +   Y  E+FPT +RN ++ +    A +     P I  +D F P      + V+ LISG  +  FLPET   P+P+++E+G    KG+
Sbjct:    8 EDLMGKLGEFGKYQFLQFFLQVLSGLTAGMHMLSLVTVAAVPEHRCFIEGVDNSSLSVTPWNSSAILAAIPLKPNGELESCLMFDPSSPGTNTTINCERYVYDTTYYKTSRTIDWNFVCDRRWMGAIVQTVFMLGVFTGAVTLGGLADKVGRKTVFCWSALFQLIIGVGVAFIPEYFSFMVARYLLGIVGSAGAYICGFVLTMELVGPTKRTVCGITFQAVFAGGIMLVAGWGALIPDRQWLQVIYGLHGCLFLGHWWWLDESPRWLWMQGRAAEAVDIVAKGLRINGSGIPVDKEYYVQKAKQQAAAEEKSSAGLSDLFRTPNLRMKTLNVCLCWFANSLVYYGLSLSAGKLYGNPYLILFIMGLVEFPSYITIVFVLDRLGRRSITSTLMLGGGLCCIVAAYIAQGSTTSTAVVMA----GKLLIAGSFAVIYNYSAELFPTVVRNSAMGLGSMCARLSGALTPLITLLDSFDPKIPAVLFGVVALISGFWV-MFLPETMNQPMPESIEDGENFGKGD 522          
BLAST of slc22a-5 vs. Ensembl Fly
Match: CG7458 (gene:FBgn0037144 transcript:FBtr0078475)

HSP 1 Score: 123.25 bits (308), Expect = 1.668e-29
Identity = 114/431 (26.45%), Postives = 199/431 (46.17%), Query Frame = 2
Query:  353 RNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTM----FFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLS-GLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIIT-KQKLGNITDIFGSKIMRLKMFVLI---------FVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENN 1597
            R++K+   D   TISTEF + C  +  ++++ T+     FVG+ +G + A   D+ GR  ++ +A     ++ +    ++N  + ++  FL   +G+           E+V  KRR        I Y LG   +  LA   + WR L R L    +L  L  ++LPES RWL   G  +KA   L   A+ N +  PE + + L+ + +QKL    +     IMR  +F  +         F H  I++   GLS+N   L  N + N  + G ++     +  ++  ++ RR S+  + L+C++C+  +   +            L  IGK A+T ++ I   + +E+FPT +RN  + +   +  I ++ AP    + ++  Y     ++   LISG L   F PET    LP T+EE  +L +    +
Sbjct:  151 RDFKFR--DEEKTISTEFGIYCEDEWKLSMVGTINNVGQFVGIPLGGYFA---DRYGRRTMLAVAGSVSALMGVIRSLSSNYSMFLVFEFLDMAVGSTLFPTAFLLAIELVGPKRRVAAATIITIFYALGEAFLGFLASQVQHWRWLLRVLYAPAVLQILFLWILPESVRWLLSQGAEEKASNVLRRAARINQRPLPEEQLNDLLTSNRQKLSQANES-QYPIMRAVVFFSLRIANCCLCWFTHTLIAL---GLSLNSVNLGGNKYTNFMLNGFIQIPGLLLPLVIMDRVGRRHSLCASMLLCAICMGAS---AAVPADNYAGSLALFLIGKLAITCSFQILYFFTSEIFPTNVRNTLLSLCSMVGRIGSMLAPQTPLLAKYYIYAPQILFATFALISGFLTLAF-PETADKVLPTTIEEARDLNQAKRRS 568          
BLAST of slc22a-5 vs. Ensembl Fly
Match: CG8654 (gene:FBgn0034479 transcript:FBtr0086340)

HSP 1 Score: 122.094 bits (305), Expect = 2.359e-29
Identity = 112/438 (25.57%), Postives = 208/438 (47.49%), Query Frame = 2
Query:  317 RSENGTNH-TIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGT-GKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXX-XXXESPRWLGIGGKFKKAITNLLLIAKYNGK----IFPE--NKFDSLIITKQ-KLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENN 1597
            ++EN T+  +  C   +++ +   +TI TE+NL C  K+  +L  ++  +G+  G+ +  +  D+ GR          ++I  + +  +   W   L RFL  + T G +      L EIV  K+R +    Y I + +G+  +   AY  ++WR  +  +    + ++ Y  L+PESPRWL   GK  K+I  L  IAK N      I PE    + +L   +  K G + D+F +  MR+K   +      + + Y+G +   S L  NIF++  I   +      +  +M+  L R+ ++L++    ++ L+L    S        V  T  +IG F  +  +    +Y  E+FPT +R+  + +   +  I ++ AP I  +  +  + +   + +  +++ +L   FLPET+G PLP+TLE+G    +  ++ 
Sbjct:   68 KTENVTDPCSDECSETEFDTSVFQSTIITEWNLTCESKQLASLSQSIVMLGILFGSILFGMFADRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYCLFRFLVAVATAGTMTTSFVLLMEIVGPKKREMVAILYQIPFNIGHASLALFAYFIREWRWFQFSITIFSIVFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCNKAPTETIRPEIEAAYGALAARQPVKKGTVVDLFRTPYMRIKTIFMANNWLVVCMVYYGTAQYVSALGGNIFISNAIAAGVGIPGTCLCALMTKYLGRKKTLLLSNGCSALGLILLACLS---TQAEAVRVTCATIGLFGASITFPNVYLYGGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILA-MLGTIFLPETRGTPLPETLEDGETFGRKKKDQ 501          
BLAST of slc22a-5 vs. Ensembl Fly
Match: CG8654 (gene:FBgn0034479 transcript:FBtr0305676)

HSP 1 Score: 122.094 bits (305), Expect = 2.359e-29
Identity = 112/438 (25.57%), Postives = 208/438 (47.49%), Query Frame = 2
Query:  317 RSENGTNH-TIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGT-GKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXX-XXXESPRWLGIGGKFKKAITNLLLIAKYNGK----IFPE--NKFDSLIITKQ-KLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENN 1597
            ++EN T+  +  C   +++ +   +TI TE+NL C  K+  +L  ++  +G+  G+ +  +  D+ GR          ++I  + +  +   W   L RFL  + T G +      L EIV  K+R +    Y I + +G+  +   AY  ++WR  +  +    + ++ Y  L+PESPRWL   GK  K+I  L  IAK N      I PE    + +L   +  K G + D+F +  MR+K   +      + + Y+G +   S L  NIF++  I   +      +  +M+  L R+ ++L++    ++ L+L    S        V  T  +IG F  +  +    +Y  E+FPT +R+  + +   +  I ++ AP I  +  +  + +   + +  +++ +L   FLPET+G PLP+TLE+G    +  ++ 
Sbjct:   68 KTENVTDPCSDECSETEFDTSVFQSTIITEWNLTCESKQLASLSQSIVMLGILFGSILFGMFADRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYCLFRFLVAVATAGTMTTSFVLLMEIVGPKKREMVAILYQIPFNIGHASLALFAYFIREWRWFQFSITIFSIVFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCNKAPTETIRPEIEAAYGALAARQPVKKGTVVDLFRTPYMRIKTIFMANNWLVVCMVYYGTAQYVSALGGNIFISNAIAAGVGIPGTCLCALMTKYLGRKKTLLLSNGCSALGLILLACLS---TQAEAVRVTCATIGLFGASITFPNVYLYGGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILA-MLGTIFLPETRGTPLPETLEDGETFGRKKKDQ 501          
BLAST of slc22a-5 vs. Ensembl Zebrafish
Match: slc22a13a (solute carrier family 22 member 13a [Source:ZFIN;Acc:ZDB-GENE-070912-473])

HSP 1 Score: 137.887 bits (346), Expect = 2.171e-34
Identity = 133/529 (25.14%), Postives = 232/529 (43.86%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKC-------VDP-IFNQTQLTWTVKE--------CQAI--------ARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIY-QGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLM-NXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQ-KLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLN---RRVSMLIN------FLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRK 1582
            N+ E +  I     F  L L  L     I    ++S+VF     ++ C        DP +  + QL  T+          CQ          A  E G N T  C + W +N T    TI T+F+LVC          T+FF G+ VG  +     +  GR R   + ++  +I  +    + N ++ ++ +F++G+G G      +   +E + + +RS       +L  LG ++   + Y  +DWRL + +M     +  +  + LPES RWL   G+ K A   +   A  N +  PE+  + ++  K  + G I  +FGS+++R     + F    ++++Y+ LS+N      +IFL   I GL E    PV ++    L    R+ S++++        + +V +  N+  +          + L + G+F +  A  +C++Y  E+FPT IR  +  +    A   ++ +P +N ++ F         S + L SG +  F LPET+   LP + EE    RK
Sbjct:    3 NFGEILEAIGDFGLFQKLLLFALCFPNLILPFQLSSLVFNHADTNHHCNTDWILKADPNLTKEEQLNLTLPRLSDGSFNPCQMYKPVDWNLSAIQEYGLNQTTTCTDGWVHNDTIYEATIVTDFDLVCENVNIFRGAQTVFFAGVLVGAILFGPFSESFGRKRATQIPMVLMLIFTVVTGLSPNFYVYLVSQFINGVGLGGFRINSIILASEWIGVAQRSYAACLSQVLAALGQVMFLAVVYFVRDWRLDQFIMAGPIGIVVIYIWFLPESARWLLDRGRTKDAKKLIQKAAAVNKRAVPESLVEEVLKEKPVEKGGIKILFGSRVLRKYFLAITFAWCALNLAYYSLSLNVGKFGLDIFLTQLIFGLSEI---PVHFLCMWSLEVVGRKPSLIVSLVLGGCLCLLTVAVPQNSSIAI---------AVLATCGRFLMNAAGSVCNVYFQELFPTSIRQTATGLGSTAARAGSMLSPVVNMLEIFHFSIPMVVISSLALASG-VTAFLLPETRRTELPASTEEAEGKRK 518          
BLAST of slc22a-5 vs. Ensembl Zebrafish
Match: slc22a7b.1 (solute carrier family 22 member 7b, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1311])

HSP 1 Score: 135.191 bits (339), Expect = 1.985e-33
Identity = 141/537 (26.26%), Postives = 244/537 (45.44%), Query Frame = 2
Query:  107 MNYEEAISEIQG--NERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKC------VDPIFNQTQLTWTVKECQAIARSENGTNHT-----------------------IYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICG---DKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGK------IFPENKFDSLIITK--QKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRK 1582
            M +E  ++E+ G    +F ++ALL +  +       +N+  FI   PS+ C       D IF    LT   +    +   E+GT  +                       + C+N W+++ +   +T++TEF+LVC+++       T+FF G+ +G   AI G   D+ GR R++ LA +  I   +   FA +  +  ++RF +G+G TG     +    E   I  R++      + + L  M++ G+AY   DWR L   +     L  +T+  LPES RWL   GK ++A   L   A  N +      I PE   + +I  +  +    +  +  SK+ +L M   I   G ++ +Y+G+S N S    N++L  FI G +E  +  VA++   KL RR S +   +   VC+ +         +   VI+ LG    F+  +  C+  +Y  E++PT +R   +     I  +    AP ++ +DE         +  + +++GLL    LPET    LP+T+E+  + RK
Sbjct:    1 MKFENLLAEVGGFGKYQFCLMALLVIPRVTLPCHFLLNN--FIAAIPSHHCDISSLSADGIFGN--LTQEERLTVGVPAQEDGTPASCHMFSHPQFQLLINSSSSSDLPVVECQNGWRFDNSTFKSTLATEFDLVCDRRGLNKATATIFFAGVMIGA--AIFGWLTDRFGRKRMLMLAYLISITFGVASAFAQSFIVFAIMRFFTGMGLTGISIISIVLCIEWADIAHRTIAGVMISLDWSLSCMILSGVAYLVNDWRALILTVTAPIALAMITWRWLPESARWLIANGKLEEAHFYLSKCASVNNRQHNLRDIKPETLANVIIADRGDRTYSYLDLVRSSKMRKLAMLTGITWFG-VAFTYYGISFNISGFGLNLYLTQFIYGAIELPSKLVAYVCLDKLGRRYSQVGTMITTGVCIGITVLIPRVLWVPCTVIAVLGK--GFSEASFTCVF-LYTTELYPTVLRQNGLGYSSFIGRVGVSLAPLVSLLDEVWLPLPQVLFCSVAIVAGLLA-LLLPETHNVRLPETIEDIEKTRK 526          
BLAST of slc22a-5 vs. Ensembl Zebrafish
Match: slc22a7a (solute carrier family 22 member 7a [Source:ZFIN;Acc:ZDB-GENE-050506-52])

HSP 1 Score: 131.339 bits (329), Expect = 3.827e-32
Identity = 136/541 (25.14%), Postives = 238/541 (43.99%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFN-QTQLTWTVKECQA------IARSENGT---------------------------NHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLM----NXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVL---IFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRK 1582
            M +E+ + EI G  +F  L L  L +   I  +      FI   P + C  P  + +   +   KE  A      I R+ +G+                           N ++ C+N W Y+++  T+T +TE++LVC+ KK    + T FF+G+++G  +     DK GR  +I ++ +   +  I   F+++  +  + R L G   TG     +    E   +K R+       + + +G ML+  LAY  +DW   RHL+    +  L+  + ++ +PES RWL   G+ ++A   L+  AK NGK     K D      + I +    N + +   +  +L+  VL   IF    ++ +Y+G+S N +    NI+L  FI G++E       ++   ++ RR     + +I    + LN   S      + V + +  IGK     A+ I  +Y +E++PT +R   +     IA I    AP +   ++   Y     +S   + SG ++ F LPET    LP+ + +  E R 
Sbjct:    1 MRFEDVLREIGGFNKFQFLVLYILWLPRVILPLHFLLHNFISGVPPHHCALPRLDGRFSASGAEKEELAQIVALGIPRNSDGSYSSCKMYTMPMDFDLNGDLSVLYGNRSNVSVPCQNGWVYDRSQFTSTTATEWDLVCDNKKLNQALATFFFIGVTMGAVVFGQLSDKFGRKPMIQVSFVSSAVFGIIEAFSSSYVMFAIARTLCGFALTGMSITTVALCVEWTDVKHRTFTGTIISLGWSVGNMLLALLAYLIRDW---RHLILVVTSPCLVGIIAWWWIPESARWLLANGRVEEAQKYLINCAKMNGKYSYTKKLDIENLKKITIAEDSNKNHSYLDLVRTPKLRKIVLCSGIFWFA-VAFTYYGISFNITGFGLNIYLTQFIYGVIEVPAKVGTYLTLDRIGRRNGQAWSLIIAGALIGLN---SVIPTEFAAVRTGIAVIGKGFSEAAFTIAFLYTSELYPTVLRQCGLGYTSFIARIGGSLAPMVILFEDIWHYGPPVVFSATAVFSGCVV-FLLPETTNVQLPENILDVEEGRH 533          
BLAST of slc22a-5 vs. Ensembl Zebrafish
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 129.028 bits (323), Expect = 2.166e-31
Identity = 122/442 (27.60%), Postives = 209/442 (47.29%), Query Frame = 2
Query:  326 NGTNHTIYC-RNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTM-----FFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGL-GTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-SLIITKQK---LGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSML-INFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP----SINGIDEFIPYFSCSCYSVMC-LISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENN 1597
            N + H   C   W +N+     TI TEF+LVC +  ++  +N +     FF+G  V  ++A   D+ GR      ++    +   C+ F+    L++  R L G    G        + E      R   +      Y LG +L+P LAY    WR L   +     +F + ++++PESPRWL    K K+A++ +  IAK N +  PE+  +  L+I KQ+     +  D+F +  MR   F+LI+   T +V + GL +       N+FL+  I  ++E  TG + + +  ++ RR  M  +NF+  + CL +     F +  +S +  T+  +G+ A+       +    E++PTP+RN+ + +    + I  V AP     +  I + +P      Y VM  L SGL++   LPE KG  LP+T+++   LR  ++  
Sbjct:  104 NNSTHLSACNEGWTFNEN--RTTIVTEFSLVC-EDSWLADLNQVSLAGGFFIGALVTGYLA---DRFGRKSCFIASIFGLGVSGTCIIFSPYYPLLLFFRCLQGFFAKGAWTATYVLIIEFFGSNNRKFVSVMSRTFYSLGLVLLPALAYYIPSWRNLQLAMTLPTFIFLIYHWVIPESPRWLLSQRKTKEALSIVKSIAKCNKRSLPEDFHEMDLLIEKQEEIMRPSYKDLFKTPKMRKHTFILIYAWFTGAVVFQGLVLRLGITGDNVFLDFLISAVVELPTGLIFYFLVDRIGRRPLMATVNFIGGAACLAV----PFISPNISWLRRTIAIVGRLAVAIGNETVNFANTELYPTPLRNLGVSVCSSASDIGAVVAPFILYRLASIWQELPLL---VYGVMSVLYSGLVM--LLPEMKGVDLPETVDDVENLRSRHKRK 530          
BLAST of slc22a-5 vs. Ensembl Zebrafish
Match: slc22a6l (solute carrier family 22 member 6, like [Source:NCBI gene;Acc:404609])

HSP 1 Score: 128.257 bits (321), Expect = 5.375e-31
Identity = 112/467 (23.98%), Postives = 220/467 (47.11%), Query Frame = 2
Query:  236 TPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIIT---KQKLG------NITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENN 1597
            TP ++ +    N ++  W     +++A +E     T  C + W YN T+M++TI TE++LVC+ +    +  T +  G+ VG  +     D+ GR  L+ ++ +   I   C+ F+T+  +  + R   G+  +G +      + E +  + R++        Y  G +++  +AY  +DWR L+  +     + +L  +   ES RWL +  K ++A+ NL  +A+ NG+    +K D  ++    K+++       +  D+  +  MR     L  V  + S +Y+GLS++      +I+L   I G ++     +  I  S L RR S     ++  + +++N         + ++ ++L  IGK  L  ++  C +Y  E++PT IR   +  +  +A    + AP +  + +  P+     Y    ++SG+   FFLPET   PLP T+++ ++      N+
Sbjct:   86 TPQWQILS--LNTSESLWD----ESMAETE-----TQSCEDGWFYNMTEMSSTIITEWDLVCDYRALKQMSQTTYMGGVLVGAIVFGGLSDRFGRRVLLLISNLMMAIGGTCVAFSTSFTMFCVFRVCCGMALSGLVLNSFSLIVEWIPTRVRTVVGTGTGYCYTTGQLILAAVAYCIRDWRWLTLAVSLPFYVSFLYSWWFLESARWLVLTKKPEQAVKNLKTVARINGRSAEGDKIDLEMLQESMKKEMACSKGSYSALDLLRTSTMRTITICLSAVWFSTSFAYYGLSMDLQKFGVSIYLIQIIFGAVDIPAKIIVTICMSMLGRRPSQCGALVLAGIMILINLLVP---SDLQMLRTSLAVIGKGCLAASFNCCYLYAGELYPTVIRQSGMGWVSMMARFGAMVAPMVLLLGDDYPWIPGFIYGGAPIVSGIFA-FFLPETLSQPLPDTIQDIDDRGLARTNS 537          
BLAST of slc22a-5 vs. Ensembl Xenopus
Match: emc2 (ER membrane protein complex subunit 2 [Source:Xenbase;Acc:XB-GENE-484487])

HSP 1 Score: 153.295 bits (386), Expect = 1.499e-39
Identity = 139/530 (26.23%), Postives = 237/530 (44.72%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN---------------------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKL-----GNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSI---FIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
            +Y++A + +     F V     LS     +     S VF+  TP ++C  P        W      +I R +   +    CR                                  W Y+K+   +TI TE+NLVC       L  ++FFVG+ +G+F++    D+ GR +++   +  +   +I   F+ N  +   L  + G+G    Y     L  EI+    R +++     I Y +GYML+P  AY  +DWR L   L    L     ++++PESPRWL   G+F++A   +   AK NG   P++ F+   + +QK          D+  ++ +R+  F+ I +   ISV YFGLS+N   L  + ++N F+  ++E     +AW++     RR S     ++  V L+   F       + I+   L  +GKF +T+A+ +  +Y  E++PT +RNM +    +   + SI + +   +   D F+P+      +V+  +  L     LPE+ G PLP T+EE
Sbjct:    3 DYDQATAFLGEWGPFQVSVFFLLSASIIPNGFTGLSAVFLAATPEHRCHVPESANLSAAW---RNASIPRQDGQDSQ---CRRYRLGTLTNYSALGLLPGRDVDVTGIEQEPCLDGWNYSKSLYLSTIVTEWNLVCENDWKGPLTTSLFFVGVLIGSFVSGQMSDRFGRKKVLFATMAVQTGFSIIQVFSVNWEMFTALFIIVGMGQISNYVAAFILGAEILDKSVRIIFSTLGVCIFYAIGYMLLPLFAYFIRDWRTLLLALTIPGLFCIPLWWIIPESPRWLISQGRFQEAEDIIRKAAKKNGITPPDSIFNFTELQEQKELTHKSHTFLDLLKTRNIRIITFLSILLWMIISVGYFGLSLNTPNLHGDPYVNCFLSAIIEVPAYVIAWLLLRSFPRRYSTASTLVLGGVVLL---FIQLVPQELGILSIVLVMLGKFGITSAFSMVYVYTAELYPTVVRNMGVGASSMASRMGSILSPYFVYLGAYDRFLPFILMGSLTVLIGMFTLC----LPESHGMPLPDTIEE 519          
BLAST of slc22a-5 vs. Ensembl Xenopus
Match: emc2 (ER membrane protein complex subunit 2 [Source:Xenbase;Acc:XB-GENE-484487])

HSP 1 Score: 153.295 bits (386), Expect = 1.539e-39
Identity = 139/530 (26.23%), Postives = 237/530 (44.72%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN---------------------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKL-----GNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSI---FIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
            +Y++A + +     F V     LS     +     S VF+  TP ++C  P        W      +I R +   +    CR                                  W Y+K+   +TI TE+NLVC       L  ++FFVG+ +G+F++    D+ GR +++   +  +   +I   F+ N  +   L  + G+G    Y     L  EI+    R +++     I Y +GYML+P  AY  +DWR L   L    L     ++++PESPRWL   G+F++A   +   AK NG   P++ F+   + +QK          D+  ++ +R+  F+ I +   ISV YFGLS+N   L  + ++N F+  ++E     +AW++     RR S     ++  V L+   F       + I+   L  +GKF +T+A+ +  +Y  E++PT +RNM +    +   + SI + +   +   D F+P+      +V+  +  L     LPE+ G PLP T+EE
Sbjct:    3 DYDQATAFLGEWGPFQVSVFFLLSASIIPNGFTGLSAVFLAATPEHRCHVPESANLSAAW---RNASIPRQDGQDSQ---CRRYRLGTLTNYSALGLLPGRDVDVTGIEQEPCLDGWNYSKSLYLSTIVTEWNLVCENDWKGPLTTSLFFVGVLIGSFVSGQMSDRFGRKKVLFATMAVQTGFSIIQVFSVNWEMFTALFIIVGMGQISNYVAAFILGAEILDKSVRIIFSTLGVCIFYAIGYMLLPLFAYFIRDWRTLLLALTIPGLFCIPLWWIIPESPRWLISQGRFQEAEDIIRKAAKKNGITPPDSIFNFTELQEQKELTHKSHTFLDLLKTRNIRIITFLSILLWMIISVGYFGLSLNTPNLHGDPYVNCFLSAIIEVPAYVIAWLLLRSFPRRYSTASTLVLGGVVLL---FIQLVPQELGILSIVLVMLGKFGITSAFSMVYVYTAELYPTVVRNMGVGASSMASRMGSILSPYFVYLGAYDRFLPFILMGSLTVLIGMFTLC----LPESHGMPLPDTIEE 519          
BLAST of slc22a-5 vs. Ensembl Xenopus
Match: bub1b (BUB1B, mitotic checkpoint serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1010857])

HSP 1 Score: 142.124 bits (357), Expect = 1.204e-35
Identity = 138/536 (25.75%), Postives = 246/536 (45.90%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQT--QLTWTV--------------KECQAI-----ARSENGTNHTI---------YCRN-WKYNKTDMTNTISTEFNLVCNKKK----YVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSG-LGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQ----KLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSI----NGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRK 1582
             ++E +  I   + F     + L  ++ + S     IVF+G  P Y+CV     +   +  WT+               +C        + S N TN ++          C++ W YN T   +++ TEFNLVC        + + +N  FF+G  +  +IA   D+ GR   +  +++   I  I + FA N  L++  RF+ G +  G    G   + E V ++ R      Y   + +G +L+ G+AY    WR L   +      F   Y+ +PESPRWL    +  +A   +  IAK NGK+ P+   +SL   ++    ++ +  D+  +  +R    +L+++  T +V Y G  ++    + NI+ + FI  L+E  +  +  +   ++ RR   L+  +I  +  ++    +F     S +I TL  + +  +T +Y +  +   E++PT IRN+ I +   +  +  V  P I      I + +P      ++V+  +SG+L+Y FLPETKG  LP+T+EE   L K
Sbjct:    3 TFDELLEHIGEFDAFQKQIFILLCFISVVFSPIYVGIVFLGFVPDYRCVSAGIPEPSNECEWTLNYTGPNGSTDSLYMSQCYQYDVDWNSTSLNCTNSSLNITSKLPITNCKDGWDYNTTG--SSLVTEFNLVCGDSWKLDFFQSCVNIGFFIGGLISGYIA---DRFGRKPFLISSILITGIFGILMAFAPNYPLVVTFRFIQGFVSKGCWLSGYILVAEFVGLEHRRTVGIVYQAAFTVGLLLLSGVAYVLPHWRWLQMTVTIPYFFFLAYYWCVPESPRWLISQNRKAEAKAIIHTIAKKNGKMVPDF-LESLTADEEAGEKQVPSFLDLVRTPQIRKHTLILMYIWFTCAVVYQGSIMHMGSTAENIYFDFFISALVEFPSAILIIVTVDRVGRRYPWLVCCIITGITCLIT---AFIPHGYSWLIITLSCVSRMGITVSYEMVCLVNAELYPTFIRNLGIMVCSSMCDLGGVITPFIVYRLAAIWQELPLI---VFAVLATVSGILVY-FLPETKGRALPETIEEAENLHK 525          
BLAST of slc22a-5 vs. Ensembl Xenopus
Match: slc22a4 (solute carrier family 22 (organic cation/zwitterion transporter), member 4 [Source:NCBI gene;Acc:394948])

HSP 1 Score: 141.739 bits (356), Expect = 1.387e-35
Identity = 129/530 (24.34%), Postives = 238/530 (44.91%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN---------------------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYN-----GKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSI---FIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
            +Y+EA S +    R+  +    LS     +  +  S++F+   P ++C  P        W      +I R +   +    CR                                  W Y+K+   +TI TE+++VC       L  ++FFVG+ +G+F++    D  GR +++ + +  +   +I   F+T+  +  +   + G+G    Y     L TEI+    R +++     I + +GYM++P  AY  +DWR L   L    L     ++++PESP+WL   G+ ++A   +   AK N       IF   + + L   +++   + D+  +  +R+   + +F+   ISV YFGLS+N   L  + ++N F+  ++E     +AW++     RR S     ++  V L+   F       + I+   L  +GKF +T+A+ +  +Y  E++PT +RNM +    +   + SI + +   +   D F+P+      +V+  +  L     LPE+ G PLP T+EE
Sbjct:    3 DYDEATSFLGEWGRYQFMIFFLLSASIIPNGFNGMSVMFLAGIPEHRCHIPESANLSAAW---RNASIPRQDGQDSQ---CRRYRLGTLTNYSALGLLPGRDVDVTGIEQEPCLDGWNYSKSLYLSTIVTEWDIVCENDWKGPLTTSLFFVGVLLGSFVSGQLSDSFGRKKILFVTMAIQTGFSIVQVFSTSWEMFAIFFLIVGMGQISNYVAAFILGTEILGKSARIIFSTLGTCIFFAIGYMMLPLFAYFIRDWRTLLLALTIPGLFCIPLWWIIPESPQWLICKGRIEEAEVIIRKAAKINRVPAPAVIFKTTELEDLAERQKRSYTLLDLVKTFNVRIITIMTVFLWMIISVGYFGLSLNTPNLHGDPYVNCFLSAIIEVPAYVIAWLLLRSFPRRYSTASTLVLGGVVLL---FIQLVPQELGILSIVLVMLGKFGITSAFSMVYVYTAELYPTVVRNMGVGASSMASRMGSILSPYFVYLGAYDRFLPFILMGSLTVLIGMFTLC----LPESHGMPLPDTIEE 519          
BLAST of slc22a-5 vs. Ensembl Xenopus
Match: slc22a4 (solute carrier family 22 (organic cation/zwitterion transporter), member 4 [Source:NCBI gene;Acc:394948])

HSP 1 Score: 136.346 bits (342), Expect = 1.150e-33
Identity = 134/537 (24.95%), Postives = 246/537 (45.81%), Query Frame = 2
Query:  104 EMNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN---------------------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYN-----GKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELR 1579
            E +Y+EA S +    R+  +    LS     +  +  S++F+   P ++C  P        W      +I R +   +    CR                                  W Y+K+   +TI TE+++VC       L  ++FFVG+ +G+F++    D  GR +++ + +  +   +I   F+T+  +  +   + G+G    Y     L TEI+    R +++     I + +GYM++P  AY  +DWR L   L    L     ++++PESP+WL   G+ ++A   +   AK N       IF   + + L   +++   + D+  +  +R+   + +F+    S+ YFG+S+N   L  + FLN F+   +E  +   AW++   ++RR SM  + L+  V L+L          + I+ + L  +GKF +T A+ +  +Y  E++PT IRN  + I    + I +V +P    +   +  +PY      +V    +G+L+ FF PET G PLP+T+E+   ++
Sbjct:    2 ERDYDEATSFLGEWGRYQFMIFFLLSASIIPNGFNGMSVMFLAGIPEHRCHIPESANLSAAW---RNASIPRQDGQDSQ---CRRYRLGTLTNYSALGLLPGRDVDVTGIEQEPCLDGWNYSKSLYLSTIVTEWDIVCENDWKGPLTTSLFFVGVLLGSFVSGQLSDSFGRKKILFVTMAIQTGFSIVQVFSTSWEMFAIFFLIVGMGQISNYVAAFILGTEILGKSARIIFSTLGTCIFFAIGYMMLPLFAYFIRDWRTLLLALTIPGLFCIPLWWIIPESPQWLICKGRIEEAEVIIRKAAKINRVPAPAVIFKTTELEDLAERQKRSYTLLDLVKTFNVRIITIMTVFLWLITSIGYFGISLNTPNLHGDPFLNCFLLAAIEVPSNIFAWLLLRYISRRYSMCGSLLLGGVVLLLIQLVPL---DLQILSTVLVMVGKFGVTAAFSMVYVYTAELYPTVIRNTGVGIGSVSSRIGSVISPYFVYLGAYNRLLPYILMGSLTVA---NGILVLFF-PETFGKPLPETIEQTQNIK 525          
BLAST of slc22a-5 vs. Ensembl Mouse
Match: Slc22a5 (solute carrier family 22 (organic cation transporter), member 5 [Source:MGI Symbol;Acc:MGI:1329012])

HSP 1 Score: 167.162 bits (422), Expect = 1.487e-44
Identity = 142/530 (26.79%), Postives = 244/530 (46.04%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN---------------------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLY-TNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
            +Y+E  + +     F  L    LS     +  +  SIVF+  TP ++C+ P  +   L+   +       +++G      CR                                  W+Y+K    +TI TE++LVC       L  ++FFVG+ +G+FI+    D+ GR  ++ L +  +   +    F+ N  +  +L  L G+G    Y     L TEI+S   R ++ T    I Y  G+M++P  AY  +DWR L   L    +L    ++ +PESPRWL   G+ K+A   +   AK NG + P   FD      L  TK +L +I D+  ++ +R+   + I +  TISV YFGLS++   L  +I++N F+   +E     +AW++   L RR S+     +    L+   F       +  + + L  +GKF +T+AY +  +Y  E++PT +RNM + +    + + ++ +P    +   D F+PY      +++  I    +  F PE+ G PLP T+++
Sbjct:    3 DYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFNGMSIVFLAGTPEHRCLVP--HTVNLSSAWRNHSIPLETKDGRQVPQKCRRYRLATIANFSELGLEPGRDVDLEQLEQESCLDGWEYDKDVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQVFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFGFMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIFDPSELQDLNSTKPQLHHIYDLIRTRNIRVITIMSIILWLTISVGYFGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQYLPRRYSISAALFLGGSVLL---FMQLVPSELFYLSTALVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAI----LTLFFPESFGVPLPDTIDQ 523          
BLAST of slc22a-5 vs. Ensembl Mouse
Match: Slc22a21 (solute carrier family 22 (organic cation transporter), member 21 [Source:MGI Symbol;Acc:MGI:1929481])

HSP 1 Score: 154.451 bits (389), Expect = 4.843e-40
Identity = 123/426 (28.87%), Postives = 211/426 (49.53%), Query Frame = 2
Query:  356 NWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLY-TNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXX---XXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPE--------NKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRK 1582
             W+Y+K    +TI TE++LVC       L  + F+VG+ +G+FI+    D+ GR  ++ L +      +    F+ N  +  LL  L G+G    Y     L TE++S   R ++ T    I +  G+M++P  AY  ++WR  R L+   L   L   L   +PESPRWL   G+ K+A   +   AK NG + P         NK       K +  +I D+  +  +R+   + I +  TISV YFGLS++   L+ NI++N F+   +E     +AW++   ++RR SM  +  +    L+L          +  + +TL  +GKF +T+AY +  +Y  E++PT +RNM + +    + + ++ +P    +   D  +PY      +++  I    I  F PE+ G  LP+T++E  +++K
Sbjct:  116 GWEYDKDIFLSTIVTEWDLVCKDDWKAPLTTSFFYVGVLLGSFISGQLSDRFGRKNILFLTMAMHTGFSFIQVFSVNFEMFTLLYTLVGMGHISNYVAAFVLGTEMLSKSVRIIFATLGVCIFFAFGFMVLPLFAYFIREWR--RLLLAITLPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIFDPSETNKLQDDSSKKPQSHHIYDLVRTPNIRILTIMSIILWLTISVGYFGLSLDTPNLNGNIYVNCFLLAAVEVPAYVLAWLLLQHVSRRYSMAGSLFLGGSVLLL---VQLVPSDLHYLSTTLVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRRLPYILMGSLTILTAI----ITLFFPESSGVSLPETIDEMQKVKK 532          
BLAST of slc22a-5 vs. Ensembl Mouse
Match: Slc22a4 (solute carrier family 22 (organic cation transporter), member 4 [Source:MGI Symbol;Acc:MGI:1353479])

HSP 1 Score: 144.436 bits (363), Expect = 1.352e-36
Identity = 139/542 (25.65%), Postives = 244/542 (45.02%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN---------------------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXX-XXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIIT-----KQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSML-INFLICSVCLMLN------NFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELR 1579
            +Y+E I+ +     F  L    LS     +  +  S+VF+  TP ++C+ P  +   L+ + +       +++G      CR                                  W+Y+K    +TI TE+NLVC       L  ++FFVG+  G+F++    D+ GR +++   +  +   +    F+TN  +  +L  + G+G    Y     L TEI+S   R +++       + +GYM++P  AY  +DWR+    +  P LF    ++ +PESPRWL    +F +A   +   AK N  + P   FD L +      KQ+   I D+F ++ +     + + +    SV YF LS+N   L  +++LN F+ GL+E      AW++   L RR  +  + F    V L++       NF S            L  +GKF +T+A+ +  ++  E++PT +RNM++ I    + + ++ AP    +   +  +PY      +V+  I    I  F PE+ G  LP+ LE+  ++R
Sbjct:    3 DYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCLVP--DTVNLSSSWRNHSIPLETKDGRQVPQSCRRYRLATIANFSAMGLEPGQDVDLEQLEQESCLDGWEYDKDIFLSTIVTEWNLVCEDDWKTPLTTSLFFVGVLCGSFVSGQLSDRFGRKKVLFATMAVQTGFSFVQIFSTNWEMFTVLFAIVGMGQISNYVVAFILGTEILSKSVRIIFSTLGVCTFFAIGYMVLPLFAYFIRDWRMLLLALTLPGLFCVPLWWFIPESPRWLISQRRFAEAEQIIQKAAKMNSIVAPAGIFDPLELQELNSLKQQKVIILDLFRTRNIATITVMAVMLWMLTSVGYFALSLNVPNLHGDVYLNCFLSGLIEVPAYFTAWLLLRTLPRRYIIAGVLFWGGGVLLLIQVVPEDYNFVSI----------GLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGITSMASRVGSIIAPYFVYLGAYNRLLPYILMGSLTVLIGI----ITLFFPESFGVTLPENLEQMQKVR 528          
BLAST of slc22a-5 vs. Ensembl Mouse
Match: Slc22a3 (solute carrier family 22 (organic cation transporter), member 3 [Source:MGI Symbol;Acc:MGI:1333817])

HSP 1 Score: 136.732 bits (343), Expect = 6.244e-34
Identity = 114/435 (26.21%), Postives = 217/435 (49.89%), Query Frame = 2
Query:  302 CQAIARSENGTNHTIYCR-NWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNF-IAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGL-GTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNIT--DIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP----SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNEL 1576
            C  +    N +   + C  +W+Y +T   +TI ++F+LVC+    + L   +  +G   G F +    D+ GR+ +  ++     I  + + FA N  + ++ RFL G+ G G        +TEIV  K+R +      + + LG +++PG+AY T  W+ +   +     LF L Y+++PESPRWL    + +KA+  L  +AK NGK    N +  + +T +++ N +  D+  +  MR    +L+F   T +V Y GL +    +  N++++ FI GL+E     +  +   +L RR+    + ++  V  ++    +F    +  + +T+ ++G+  +T A+ I  +  +E++PT +RN  + +  G+     + AP     +  I   +P      + ++  + G L+   LPETKG  LP+T+E+  +L
Sbjct:  106 CDPLTAFPNRSAPLVSCSGDWRYVETH--STIVSQFDLVCSNAWMLDLTQAILNLGFLAGAFTLGYAADRYGRLIIYLISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGKGAWMTCFVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFTPSWQGIQLAISLPSFLFLLYYWVVPESPRWLITRKQGEKALQILRRVAKCNGKHLSSN-YSEITVTDEEVSNPSCLDLVRTPQMRKCTLILMFAWFTSAVVYQGLVMRLGLIGGNLYIDFFISGLVELPGALLILLTIERLGRRLPFAASNIVAGVSCLVT---AFLPEGIPWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAPFLLFRLAAIWLELPLI---IFGILASVCGGLV-MLLPETKGIALPETVEDVEKL 530          
BLAST of slc22a-5 vs. Ensembl Mouse
Match: Slc22a30 (solute carrier family 22, member 30 [Source:MGI Symbol;Acc:MGI:2442750])

HSP 1 Score: 125.946 bits (315), Expect = 2.542e-30
Identity = 131/558 (23.48%), Postives = 254/558 (45.52%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLT----------------------WTVKECQAIARSE------NGT------NHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICG---DKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKI-YQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXX-XXESPRWLGIGGKFKKAITNLLLIAKYNG----------KIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTT-AYCICDMYLNEVFPTPIR--NMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE-GNELRKGNENNYCNMILK 1618
            M ++E ++++    RF +L +  +  +  +    I    F    P+++C  PI +    +                        + +C+  A+ +      NGT        T  C + W Y++++  +TI TE++LVC  +   ++    F +G+ +G  I  CG   D+ GR  ++  A++   I   C+ FA + ++  LLRFL+G+    I       + E  S K   +          +GYM++ GLA+  + WR  +  M+ P+ F+L     + ES RWL +  K +K +  L  +A  NG          ++   +  + L   K+K  +  D+F + I+R ++ VL F+    ++S FGLS++   LS+NI L  F+   L      +   + + + RR++ L+   +  + ++   F       + I+++TL +    AL++   C+ ++++NE+ PT +R   M +  + G + +F   AP    +  +        Y    ++ G  + F LPETK  PLP ++ + GN+ ++  +    + I+K
Sbjct:    1 MAFQELLNQVGSLGRFQILQISFVLFLVGLVVPHITMENFTAAIPNHRCWAPILDNDTASDNGSRILSQDDLLRISIPLDSNLRLDKCRRFAQPQWHLLHLNGTFSNETEPDTEPCVDGWVYDRSNFLSTIVTEWDLVCESQALNSVAKFSFMIGLFIGAII--CGHLSDRFGRKFILTCALLQFAITETCVAFAPSFFIYCLLRFLAGMSVEPISVNSHLLMLEWTSPKFLGMVAVLTSCAASIGYMILAGLAFLFRIWRHLQLAMSVPIFFFLILTRWMSESARWLIVTNKPQKGLKELRKVAHMNGMKNSGNTLTMEVVEASMKNELEAAKRK-SSPRDLFHTPILRKRICVLSFMRYLFTISIFGLSLHLQHLSTNIILLQFLSSALGILISVIGHFVLNHMGRRITQLVLMSLRGIFMLTAVFVPQEMQTLRIIMATLAA----ALSSLCMCVSNLHINELLPTTLRATGMGVIAMFGNSGLF--LAPLFMLLATYSANLPWIFYGGFSILYGFSV-FLLPETKNQPLPDSIHDVGNDWKESRQAKEEDSIIK 548          
BLAST of slc22a-5 vs. UniProt/SwissProt
Match: sp|Q9Z0E8|S22A5_MOUSE (Solute carrier family 22 member 5 OS=Mus musculus OX=10090 GN=Slc22a5 PE=1 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.040e-43
Identity = 142/530 (26.79%), Postives = 244/530 (46.04%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN---------------------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLY-TNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
            +Y+E  + +     F  L    LS     +  +  SIVF+  TP ++C+ P  +   L+   +       +++G      CR                                  W+Y+K    +TI TE++LVC       L  ++FFVG+ +G+FI+    D+ GR  ++ L +  +   +    F+ N  +  +L  L G+G    Y     L TEI+S   R ++ T    I Y  G+M++P  AY  +DWR L   L    +L    ++ +PESPRWL   G+ K+A   +   AK NG + P   FD      L  TK +L +I D+  ++ +R+   + I +  TISV YFGLS++   L  +I++N F+   +E     +AW++   L RR S+     +    L+   F       +  + + L  +GKF +T+AY +  +Y  E++PT +RNM + +    + + ++ +P    +   D F+PY      +++  I    +  F PE+ G PLP T+++
Sbjct:    3 DYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFNGMSIVFLAGTPEHRCLVP--HTVNLSSAWRNHSIPLETKDGRQVPQKCRRYRLATIANFSELGLEPGRDVDLEQLEQESCLDGWEYDKDVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQVFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFGFMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIFDPSELQDLNSTKPQLHHIYDLIRTRNIRVITIMSIILWLTISVGYFGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQYLPRRYSISAALFLGGSVLL---FMQLVPSELFYLSTALVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAI----LTLFFPESFGVPLPDTIDQ 523          
BLAST of slc22a-5 vs. UniProt/SwissProt
Match: sp|O76082|S22A5_HUMAN (Solute carrier family 22 member 5 OS=Homo sapiens OX=9606 GN=SLC22A5 PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.884e-43
Identity = 123/415 (29.64%), Postives = 210/415 (50.60%), Query Frame = 2
Query:  356 NWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
             W++++    +TI TE+NLVC       L  ++FFVG+ +G+FI+    D+ GR  ++ + +  +   +    F+ N  + ++L  L G+G    Y     L TEI+    R +++     I Y  GYM++P  AY  +DWR L   L    +L    ++ +PESPRWL   G+F++A   +   AK NG + P   FD      L   KQ+  NI D+  +  +R+   + I +  TISV YFGLS++   L  +IF+N F+  ++E     +AW++   L RR SM     +    L+   F       +  + + L  +GKF +T A+ +  +Y  E++PT +RNM + +    + + ++ +P    +   D F+PY      +++  I    +  FLPE+ G PLP T+++
Sbjct:  116 GWEFSQDVYLSTIVTEWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFYAFGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYFGLSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLL---FMQLVPPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAI----LTLFLPESFGTPLPDTIDQ 523          
BLAST of slc22a-5 vs. UniProt/SwissProt
Match: sp|O70594|S22A5_RAT (Solute carrier family 22 member 5 OS=Rattus norvegicus OX=10116 GN=Slc22a5 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.421e-41
Identity = 141/530 (26.60%), Postives = 243/530 (45.85%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN---------------------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLY-TNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
            +Y+E  + +     F  L    LS     +  +  SIVF+  TP ++C+ P  +   L+   +       +++G      CR                                  W+YNK    +TI TE++LVC       L  ++FFVG+ +G+FI+    D+ GR  ++ L +  +   +    F+ N  +  +L  L G+G    Y     L TEI+S   R ++ T    I Y  G+M++P  AY  +DWR L   L    +L    ++ +PESPRWL   G+ K+A   +   AK+NG + P   FD      L   K +  +I D+  ++ +R+   + I +  TISV YFGLS++   L  +I++N F+   +E     +AW++   L RR S+     +    L+   F       +  + + L  +GKF +T+AY +  +Y  E++PT +RNM + +    + + ++ +P    +   D F+PY      +++  I    +  F PE+ G PLP T+++
Sbjct:    3 DYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFNGMSIVFLAGTPEHRCLVP--HTVNLSSAWRNHSIPLETKDGRQVPQSCRRYRLATIANFSALGLEPGRDVDLEQLEQENCLDGWEYNKDVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQLFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFGFMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRVKEAEVIIRKAAKFNGIVAPSTIFDPSELQDLNSKKPQSHHIYDLVRTRNIRIITIMSIILWLTISVGYFGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQHLPRRYSISAALFLGGSVLL---FIQLVPSELFYLSTALVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAI----LTLFFPESFGAPLPDTIDQ 523          
BLAST of slc22a-5 vs. UniProt/SwissProt
Match: sp|Q9WTN6|S22AL_MOUSE (Solute carrier family 22 member 21 OS=Mus musculus OX=10090 GN=Slc22a21 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.388e-39
Identity = 123/426 (28.87%), Postives = 211/426 (49.53%), Query Frame = 2
Query:  356 NWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLY-TNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXX---XXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPE--------NKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP---SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRK 1582
             W+Y+K    +TI TE++LVC       L  + F+VG+ +G+FI+    D+ GR  ++ L +      +    F+ N  +  LL  L G+G    Y     L TE++S   R ++ T    I +  G+M++P  AY  ++WR  R L+   L   L   L   +PESPRWL   G+ K+A   +   AK NG + P         NK       K +  +I D+  +  +R+   + I +  TISV YFGLS++   L+ NI++N F+   +E     +AW++   ++RR SM  +  +    L+L          +  + +TL  +GKF +T+AY +  +Y  E++PT +RNM + +    + + ++ +P    +   D  +PY      +++  I    I  F PE+ G  LP+T++E  +++K
Sbjct:  116 GWEYDKDIFLSTIVTEWDLVCKDDWKAPLTTSFFYVGVLLGSFISGQLSDRFGRKNILFLTMAMHTGFSFIQVFSVNFEMFTLLYTLVGMGHISNYVAAFVLGTEMLSKSVRIIFATLGVCIFFAFGFMVLPLFAYFIREWR--RLLLAITLPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIFDPSETNKLQDDSSKKPQSHHIYDLVRTPNIRILTIMSIILWLTISVGYFGLSLDTPNLNGNIYVNCFLLAAVEVPAYVLAWLLLQHVSRRYSMAGSLFLGGSVLLL---VQLVPSDLHYLSTTLVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRRLPYILMGSLTILTAI----ITLFFPESSGVSLPETIDEMQKVKK 532          
BLAST of slc22a-5 vs. UniProt/SwissProt
Match: sp|Q9LHQ6|OCT4_ARATH (Organic cation/carnitine transporter 4 OS=Arabidopsis thaliana OX=3702 GN=OCT4 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.941e-36
Identity = 116/462 (25.11%), Postives = 210/462 (45.45%), Query Frame = 2
Query:  218 IVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVG--MSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKI-YQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR--LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPEN---KFDSLIITKQKL------GNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRR-VSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTL 1558
            ++F    P ++CV              +C+         N  +   +W++     ++T+S E+ L+C  K  V L+  +FF G  +  G F  +   K+GR   + +  I   I  I   F+ N W  ++LRFL+G  TG +        TE +   +R +   + +  +  G  ++ G+AY  + WR       +   L   +    + ESPRW  + GK  +A+  +  IAK NG+  P       D  +            G++ D+  S +MR+++ + + +  T+S+ Y+GLS+N   L +N++LNVF+  + E     +  ++  K  R+ +S+   +  C  CL+   F  +       V    G +G F +   Y +  +Y+ E+FPT +RN ++      A +  + AP +  + E +P+     ++V  L+ G L  F+LPET   PL  T+
Sbjct:   70 MIFADQEPEWRCVG------------SDCRV-----GSLNCELDPSSWEWTAGKGSSTVS-EWGLICGDKYKVGLVQALFFAGCMIGAGVFGHLSDSKLGRKGSLTVVCIINAIFGIATAFSPNYWTYVVLRFLTGFSTGGVGLTAFVLATEPIGPSKRGVAGMSTFYFFSAGIAVLSGIAYVFRSWRELFIVSSLPSLLFLLIVIPFISESPRWYLVRGKVDEAMKLMHSIAKTNGRHIPAGVTLALDDDVENNNGERNTAVEGSLKDVILSPLMRMRLVISVAISFTVSIVYYGLSLNVGNLKTNLYLNVFVNAVSEMPAFAITAVLLDKYGRKPLSIGTQWFSCVFCLV--GFSVWGAGPWKSVRMVSGVLGIFGMAGTYNLLFIYIAELFPTVVRNAALGCATQAAQMGAILAPFVVVLGEELPF---GVFAVCGLVGGGLA-FYLPETLNKPLYDTM 507          
BLAST of slc22a-5 vs. TrEMBL
Match: A0A0H3YK93 (Slc22a-5 OS=Schmidtea mediterranea OX=79327 GN=slc22a-5 PE=2 SV=1)

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 515/515 (100.00%), Postives = 515/515 (100.00%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCNMILKHDELYNCKTKL 1651
            MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNFPLLFYLTYFLLPESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFNNIIVSIVISTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCNMILKHDELYNCKTKL
Sbjct:    1 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNFPLLFYLTYFLLPESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFNNIIVSIVISTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCNMILKHDELYNCKTKL 515          
BLAST of slc22a-5 vs. TrEMBL
Match: A0A5J4NMU2 (MFS transporter, OCT family, solute carrier family 22 (Organic cation transporter), member 4/5 OS=Paragonimus westermani OX=34504 GN=DEA37_0006863 PE=4 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.926e-77
Identity = 169/577 (29.29%), Postives = 275/577 (47.66%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVD-PIFNQTQLTW--------------------------TVKECQAI-ARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLM-NXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDS----------------------LIITK----------------QKLGNITDIFGSKI----------MRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCN 1606
            M +E  + +I G   F++L ++  S+ + I  ++I +I+F+ +TP + C D P  +   +TW                           + +C  +  R++        C NW Y++T M NT+ T+FNLVC+++ +V+ M   +    +VG  IA   D IGR        +W I+I +  PFA +  L+ LLR   GL +   Y G+  ++E+V +  R+ + N YWIL+  GY+   G+AY  +DW   R    +F +++      + ESPRWL + G+ K+A+  L  IA +N    P + FD                       L++ K                +K  N   I GS            +R +  +L F+  +I++ YFGL  + SF   NIFLNV + GL+E  T  V W  S  L RR S  I  ++  V ++           + ++ S L   GKF +T AYC+ D+Y++E++PT IRN+ +F ++ +A + +  AP +N ++E   Y  C  Y     +    +YFFLPETK CPL Q++++  E   G E  +C 
Sbjct:    1 MEFESILVDIYGTGVFHMLYMVLCSISSFIGGLEIQTIIFMNYTPDFYCQDLPDVSNVTITWINKTLYDGLVNDRSVYSMNVNISNDTAIHQCWGMWKRTDTQEKVPFKCSNWTYDQTQMVNTVVTQFNLVCDQQFWVSWMEAAYLFFNAVGFVIAFVADIIGRRTTFLAFSVWGIVICLATPFANSPPLLFLLRCCRGLSSALSYIGINLVSELVPVTHRAAFGNVYWILWAFGYITCAGIAYLLQDWITIRLWSCSFLIVYLTYPIFIYESPRWLCMHGRNKEALVILKRIAWWNKAKLPADYFDRVDQFLHAEYAHHLGQATAEPEILVLEKDTETVNEIKTCVKLRPRKRANNDVIDGSSDKCFDMLRFPNLRNRTLILCFMQSSITIVYFGLVTDSSFALENIFLNVLMMGLMEVPTSFVGWWASEHLGRRSSTSILLILTGVTVLTTKLLG---PAIPVLRSILALSGKFFITVAYCVSDLYISELYPTTIRNIGLFTVIAVAGVASTVAPFVNKLNEINYYLPCLVYGTAAFVGTFSVYFFLPETKNCPLAQSVKQSEEFVHGKEKEWCE 574          
BLAST of slc22a-5 vs. TrEMBL
Match: A0A504YHC0 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_02837 PE=4 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.452e-76
Identity = 165/551 (29.95%), Postives = 274/551 (49.73%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDP---------------------IFNQTQLTWT----VKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXX-XXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLII--------TKQKLGNIT------------------DIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCN 1606
            ++E  ++ I G   +  LA +  S+   ++ +++ +++F+ + P + C D                        N+TQ+T       ++C AI   +    H   C NW ++ T M  T+ ++FNLVC+++ ++  + + +    ++G  IA  GD +GR R   L V+ EII+ +  PF   +  ++++R L GL    +Y G+  ++E   +  RS Y N +W L+ +GY L  G+AY T+DW   R  M   LLFYL   F+L ESPRWL + G+ ++A   L  +A +NG   P+  FD + I        TK+   + +                  D+F    +R +  V  F H T++  Y+GL  + SF + NIFLNVF+ GL E  +G VAW +   + RR S  +  ++ ++C+   N           V + + + GKF L   YC+ D+Y+ EVFPT IR  S F+I+ +A +F   AP +N +           Y ++ +   +L+  FLPET+GCPL QT+ E  +L +G E  +  
Sbjct:   12 DFEIILNHIYGKGHYLRLAFIFCSITTLLAGLEVQTMIFMNYVPEHNCTDDRVVGDNATSRWVSKLSHHNGTDVNRTQMTKKQAELTEQCWAIISRQTEVTH-FPCTNWTFDTTVMLRTVVSQFNLVCDRQVWIPWLESSYLFANAIGYIIASFGDMVGRKRTFLLFVVLEIIVCLVTPFIRTVSWLLVMRILRGLSICLMYLGINLISEFAPVHLRSAYGNVFWSLWGVGYALCAGIAYLTRDWIQLRLWMCLFLLFYLPCPFVLSESPRWLCLRGQTEEAGRVLKRVAYWNGAHLPDEYFDKVDIFLHKQSYKTKENFSHSSLWKHPSDENDSGSRDTFRDLFTHPNLRFRCIVFCFAHTTVTFVYYGLITDNSFATENIFLNVFLMGLTEIPSGFVAWALCDYMGRRTSTSVLLVLTALCVGFTNLGDL---TYPDVRTVMATTGKFFLGVVYCVSDLYILEVFPTSIRTSSFFLIITVAGLFGAGAPFVNSLRRIARMLPTIIYCMLAVTGAILVLTFLPETRGCPLAQTVNESEQLVRGKERQWAE 558          
BLAST of slc22a-5 vs. TrEMBL
Match: A0A183ATJ5 (MFS domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS10280 PE=4 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 4.793e-76
Identity = 159/525 (30.29%), Postives = 273/525 (52.00%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVD---PIFNQTQLTW------------------------TVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXXXX-ESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNY 1600
            N+E  +  I G   +  +  +  SM + I+ +++ S++F+ +TP + C D   P+ N T + W                        + + C A+    +     + C NW Y    M  T+ T+FNLVC ++ +V  + ++F + +++G  +A  GD IGR +L     +++I+ ++  PF   +   ++LR L GL  G  Y G+  L+E+V I RR+ Y N YW+L+ +GY+   G+AY T+DW   R  M      Y+T+  +  ESPRWL + G+ ++A   L   ++   +    ++ +     ++K  +  ++F  + +RL++F+  FVH  I+ +Y GL  N +F + NIFLNV + GL E  +G  AW++S    RR+S+ +   +  V + L    +F   I  +  + +   GKF L+ AYC+ D+Y+ E+FPT  R  S F +  +AS+F   AP IN +  F  +     Y  +  +  +L++  LPET+ CPL QTL E   L +GNE ++
Sbjct:   23 NFETILKHIYGKAYYIRVIFVFCSMTSLITGLEMQSLIFMHYTPEHNCTDRRIPL-NDTTVYWFSERPNIDLSRVNGTQLEAASGFDSREPCWAVFAGSSDEFIQLACSNWTYATRPMQQTVVTQFNLVCERRIWVPWLESVFLLSVAIGFLMASIGDTIGRKKLFLGLALFQIVTSLITPFTHTVEFHLILRCLRGLCPGLAYIGINILSELVPIHRRAAYGNVYWLLFSVGYVTCAGMAYLTRDWVQLRLWMCVFFTGYITFPFILCESPRWLCLQGRPEEATRILKRESEAMRRNLLSDQSNDQRSVRRK-DSFLNLFTYRNLRLRLFIFCFVHVAITTAYLGLITNNAFATDNIFLNVVLMGLSEMPSGIAAWLVSEYSGRRLSITLLLALTVVSVGLTELGAF---IHPVFRAVMAIGGKFFLSVAYCVIDLYVFEIFPTSTRTSSFFFVNTVASLFGALAPFINNLTRFSQFGPTLIYCAITALGAVLVFALLPETRDCPLAQTLAESERLVRGNERDW 542          
BLAST of slc22a-5 vs. TrEMBL
Match: A0A2H1CK08 (Transporter, major facilitator family protein OS=Fasciola hepatica OX=6192 GN=D915_003087 PE=4 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 7.565e-76
Identity = 164/551 (29.76%), Postives = 271/551 (49.18%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDP---------------------IFNQTQLT----WTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXX-XXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNIT--------------------------DIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCN 1606
            ++E  ++ I G   +  L  +  S+   ++ +++ +++F+ + P + C D                        N+TQ T     + ++C A+   +    H   C NW ++ T M  T+ ++FNLVC+++ ++  + + +    ++G  IA  GD +GR R   L V+ EII+ +  PF   +  ++++R L GL T  +Y G+  ++E   +  RS Y N +W L+ +GY L  G+AY T+DW   R  M   LLFYL   F+L ESPRWL + G  ++A   L  +A +NG   P+  FD + I   K  N T                          D+F    +R +  V  F H T++  Y+GL  + SF + NIFLNVF+ GL E  +G VAW +   + RR S  +  ++ ++C+    F +   +    V + + + GKF L   YC+ D+Y+ EVFPT IR  S F I+ +A +F   AP +N +           Y ++ +   +L+  FLPET+ CPL QT+ E  +L +G E  +  
Sbjct:   12 DFEIILNHIYGKGHYLRLVFIFCSITTLLAGLEVQTMIFMNYVPEHNCTDDRVVGDNATSRWVSKLSHHNGTDVNRTQTTKKQAESTEQCWAVINRQTEVTH-FPCTNWTFDTTVMLRTVVSQFNLVCDRRVWIPWLESSYLFANAIGYIIASFGDMVGRKRTFLLFVVLEIIVCLVTPFIRTVSWLLVMRILRGLSTCLMYLGINLISEFAPVHLRSAYGNVFWSLWGVGYALCAGIAYLTRDWIQLRLWMCLFLLFYLPCPFVLSESPRWLCLRGHTEEAGRVLKRVAYWNGAHLPDEYFDKVDIFLHKQTNKTKENFSHSSLWKHLSDENDSGSRDTIWDLFTHPNLRFRCIVFCFAHTTVTFVYYGLITDNSFATENIFLNVFLMGLTEIPSGFVAWALCDYMGRRTSTSVLLVLTALCV---GFTNLGELTYPDVRTVMATTGKFFLGVVYCVSDLYILEVFPTSIRTSSFFFIITVAGLFGAGAPFVNSLRRIARMLPTVIYCMLAVTGAILVLAFLPETRDCPLAQTVNESEQLVRGKERQWAE 558          
BLAST of slc22a-5 vs. Ensembl Cavefish
Match: slc22a6l (solute carrier family 22 member 6-like [Source:NCBI gene;Acc:103025663])

HSP 1 Score: 150.214 bits (378), Expect = 1.003e-38
Identity = 104/416 (25.00%), Postives = 203/416 (48.80%), Query Frame = 2
Query:  356 NWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITK---------QKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEG 1567
             W YN ++M++TI TE+++VC  +    +  T++  G+ VG  +     D+ GR  L+ ++ +   +   C  FAT+ +L  L RF  G+  +G +      + E +  + R++        Y LG +L+  +AY  +DWR L+  +     + +L  +   ES RWL +  + ++A+ NL  +A++NG+    +K +  ++ +         QK  N  D+  +  MR     L  V  + S +Y+G++++      +I+L   I G ++  +  +  +  SKL RRVS     ++  +C+++N    +       + ++L  IGK  L  ++  C ++  E+FPT +R   +  +  +A +  + AP +    + +P+     Y    ++ G+  Y FLPET   PLP T+++ 
Sbjct:  117 GWTYNMSEMSSTIITEWDMVCESRSLKPMGQTIYMAGVFVGAMVFGGLSDRFGRRNLLLISHLMMAVGGTCASFATSFYLFCLFRFFCGMALSGLVLNSFSLVVEWIPTRIRTVVGTFTGYCYTLGQLLLAAVAYTIRDWRWLTLAVSVPFYVSFLYSWWFVESARWLVLSNRPEQAVKNLKAVARFNGRREEGDKINIEVLQQSMKKEMACSQKSHNALDLIRTPTMRTITICLSAVWFSTSFAYYGIALDLQKFGVDIYLIQVIFGAVDIPSKVIITLSMSKLGRRVSQCSALIMAGICILVNLLVPY---EQQTLRTSLAVIGKGCLGASFNCCYLFSGELFPTVVRQSGMGWVSMMARVGAMVAPMVLLTGDSLPWLPGVIYGGTPILCGMFAY-FLPETLSAPLPDTIQDA 528          
BLAST of slc22a-5 vs. Ensembl Cavefish
Match: si:dkey-119m7.4 (solute carrier family 22 member 13-like [Source:NCBI gene;Acc:103028301])

HSP 1 Score: 148.288 bits (373), Expect = 3.023e-38
Identity = 138/504 (27.38%), Postives = 233/504 (46.23%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNH------TIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLI---ITKQKLGN---ITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLN--RRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
            MN++E ++ I G  RF  +  + + +     +  +   VF G  P + C D   +     +T+ +  + A     TN       T  CR+ W+++K    +T+ TEF+LVC+      + ++++  G+ VG  +  +  D+ GR  +I + +  + +  +   FA N ++ +LLRF+ G   +G I       TE    K R L        + +GY+L+ G+AY  +DWR L   +     +F    ++LP+S RWL   GK ++A+  +   A  N K    N  +  +     +QKL     + D+  +  MR +  +L ++     + Y+GLS+N S    NI+L   I GL+E    P   I    LN  RR+S L    +  +  +L  F       + +V + L  +GKF +T +  I  +Y  EVFPT +R   I +    A    V AP I  +    P+     +  +C + G L+   LPET   PLP T+E+
Sbjct:    1 MNFDEVLARIGGFGRFQKILYVWICLPQIFLAFHMLVSVFTGAVPPHLCRDTKTHTHNFNFTLSQSASEACGSTHTNSSLSTHTTTACRDGWEFSKDVFLSTVVTEFDLVCDSATLNNIGSSIYMFGLLVGAVVFGVLADRYGRRIIILVGLALQAMFGVGAAFAPNFFIYVLLRFVVGTTVSGIIMNAFVLGTEWTGPKHRMLAGIITDYFFGVGYILLAGVAYLIRDWRKLQLAISAPGFIFIFYIWVLPKSARWLMANGKQEEAMDLICKAALINKKPLKGNDMEFQLNNCKVEQKLQRKHTVVDLVRTPQMRKQSLILFYLWFVNVLVYYGLSLNVSDFGMNIYLTQLIFGLVEM---PARTITLFTLNRSRRISQLSFLAVGGLACLLTIFIP---QNLPVVRTILAMLGKFGITASLSIVYVYSAEVFPTVVRQNGIGMGSMCARAGGVIAPIIYLLRRISPHAPMVVFG-LCPLVGALLTILLPETAHKPLPDTIED 497          
BLAST of slc22a-5 vs. Ensembl Cavefish
Match: ENSAMXT00000002313.2 (solute carrier family 22 member 7-like [Source:NCBI gene;Acc:103025489])

HSP 1 Score: 139.428 bits (350), Expect = 5.888e-35
Identity = 149/541 (27.54%), Postives = 256/541 (47.32%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFN-VLALLT-LSMMACISSMDINSIVFIGHTPSYKC----VDPIFNQTQLTWTVKECQAIARSENGT-------------------NHT----IYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVG-NFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSK------IMRL-KMFVLIFVHG----TISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLIS--GLLIYFFLPETKGCPLPQTLEEGNELRKGNE 1591
            M +E+ + EI+G  RF  VL LL+ +          +N+  +IG  PS+ C    +D       LTW  K   +I R E+G+                   N T    I C N W ++ +   +T+ST+++LVC+K++    + T+FF+G+ +G        D+ GR  ++ ++ +  +   +   F+T+  +  +LRF +GLG TG +      + E V IK R L      + +  GYM++P +AYG +DW+ L+    +  +L  +T+  +PES RWL   GK KKA   L   A  N     + K  +  +  + L  I    GS+      +MR  KM  L F+ G     ++ +Y+G+S N      +++LN  + G +E     + + M  ++ RR +     L+    L++N    F      IV S +G +GK   + A+    ++ +E++PT IR   +     +  +    AP I  +DE   + S     ++C I+  G +I + LPET+G  LP+T+E+    RK  +
Sbjct:    1 MKFEDILGEIKGFGRFQKVLVLLSFIGRFTLPCHFLLNN--YIGAIPSHHCNIGYLDDEGLFENLTWEQKLTVSIPRQEDGSLASCHMFAEPQFQFLGAKSNFTDVPLIKCPNGWIFDNSTFLSTLSTQWDLVCDKREMNKAIATIFFIGVMLGAALFGSLSDRYGRKPMLLVSYVLGMSFAVASVFSTSFIMFAVLRFFTGLGITGIVIVSSVLIVEWVDIKSRKLVGMIDSMSWSFGYMVLPAMAYGVRDWKWLTITATSPLILAIITWRWIPESARWLIANGKIKKAQFYLERCAIIN-----KRKEATSSLKPEVLSCIVSEGGSRKYSYLDLMRTPKMRRLAFLTGLTWYAVASTYYGISFNIKGFGLDLYLNQLLYGFVEIPAKILIYHMLDRIGRRRTEAGVLLLAGCNLIIN---VFIPKDQWIVRSVIGVLGKGFASMAFSTLVLFSSELYPTVIRQNGMGWNSFMGRMGVAIAPLILLLDEIWGHMS---QIILCAIAVIGSVIAYQLPETRGRCLPETIEDVEGTRKDQD 528          
BLAST of slc22a-5 vs. Ensembl Cavefish
Match: slc22a5 (solute carrier family 22 member 4-like [Source:NCBI gene;Acc:103026458])

HSP 1 Score: 136.346 bits (342), Expect = 7.371e-34
Identity = 137/555 (24.68%), Postives = 251/555 (45.23%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKC--------------------VDPIFNQTQLTW-----TVKECQAIARSENGTNHTIYCRN-----WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLI--ILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSL----IITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSI---NGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELR---KGN---ENNYCNMILKHDEL 1630
            +YEE  + +     F ++  L L+ +   +      IVF G +PS+ C                    ++    Q++  W      ++   A   + +  N T   R      WKY+     +TI +E++LVC ++  V   ++  ++G  +G+ ++    D+ GR +++  ++  E +I     F+ + WL+  IL  F+               TE++S   R L+T    ++ Y +GYM++P +A+  +DWR L R L    +++   ++ +PESPRWL   G+ K+A   +   AK N    P+  F  L    I    +  ++ D+  +  +R   F+ + +   I++ YFGLS+N S L  + FLN F+  + E     +A ++     RR  +L  FL      +L          +  +   L   GKF  T ++ +  +Y  E++PT +RN+ + +    A I ++ AP I       +++PY      ++   I+ +    FLPET G  LP+T E+    +   KG+   E +  +++LK  EL
Sbjct:    3 DYEEDTAFLGQKGPFFLIIFLLLNAIYISTGFHSFYIVFAGASPSHHCQVLDGNLSEEWIKASIPTEEINGKLEQSK-CWRYSLGAIQHFAAEGYNSSSVNFTDIARERCVEGWKYSTEVYHSTIVSEWDLVCEREWRVPFASSTIYMGYLLGSLVSGQLSDRFGRKKVLFASLALESVIIFAQSFSQS-WLVFCILYFFVGAFQISLYITAFVLGTEVLSTSLRVLFTTLGAFLHYCVGYMVLPWIAFVIRDWRTLLRVLSVLTVVYIPLWWFIPESPRWLISQGRVKEAEAIIKDAAKKNKVSAPDIIFRPLEGNKIPAPARKYSLIDVVKTSNIRFTTFMCLLLWMAINIGYFGLSLNTSNLIGDPFLNCFLSAVAEVPAYIIATLLLKSCPRR-PLLSGFLSIGGGFLL--LIQLIPERLHTLAVALEMAGKFGFTMSFTVVYIYTAEIYPTVLRNLGMGMCSSAARIGSITAPYIIFLGTYSKYLPYILMGSLTIGSSIANM----FLPETFGKVLPETCEQMQRCKWCQKGDVLMEEDRKHVVLKKQEL 548          
BLAST of slc22a-5 vs. Ensembl Cavefish
Match: ENSAMXT00000010878.2 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29265439:29284025:-1 gene:ENSAMXG00000010589.2 transcript:ENSAMXT00000010878.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.576 bits (340), Expect = 1.730e-33
Identity = 133/538 (24.72%), Postives = 238/538 (44.24%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFN-----------------QTQLTWTVKECQAIAR--SENGTN---------HTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFP--------ENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNN----FYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGN 1588
            +YE+AI+ +     +  L    L      +     S++F+   P++ C+ P  N                 + +L+   +  Q I R  S  G N             C + W Y+K    +TI TEF+LVC+ +      ++++F+G+  G+F +    D+ GR  ++   ++ + I      FA +  +  +L F+ GLG    Y     L TE++S   R  Y++    + +  GYM++P +AY  ++WR L   L    L++   ++ +PESPRWL   G+ ++A   +   A+ NG + P        E + ++     +   NI D+  +  +R    +L  V  T+S+ YFGLS+N S L  + ++N FI   LE      +W+    L R++S       C V ++L      F       +  +   L   GKF +     +   Y  E++PT +RN ++     ++ + +  AP    +  +  Y        +C+ S L    FLPET   PLP+T+++  +  + N
Sbjct:   21 DYEQAIAFLGHWGPYQQLIFFLLCSSTIPNGFSAFSVIFLADIPAHHCLIPGANLSEEWIRASIPLNVVNGKHELSKCRRYNQEIIRNLSAQGFNPEDVNLTSVELEKCTDGWTYSKDVYQSTIVTEFDLVCDDEWKQPFTSSIYFIGVLCGSFFSGQISDRFGRKPVLFATMMVQTIFTFIQVFAPSWEVFSILFFIVGLGQISNYVAAFVLGTELLSGGVRVFYSSLGVCLFFAFGYMMLPLIAYLIRNWRMLLVALSVPGLIYIPLWWFIPESPRWLISQGRVEEAEAIVKNAARKNGVLPPDIIFKKSEEEEKNTKPQKTKPENNILDLMRTSNIRRTTLILFLVWLTLSMGYFGLSLNTSRLHGDSYVNCFISAALEVPAYITSWLSLRYLPRKLS-------CPVSMLLGGGVLYFIQLVPPDLPALSVALEMAGKFGMAIGTALMFAYTGELYPTVLRNTAVGSCAMVSRVGSAVAPYFIHLSVYHKYLPYILLGTLCIFSSLTT-LFLPETFRRPLPETIDQMQKRERIN 550          
BLAST of slc22a-5 vs. Ensembl Sea Lamprey
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 122.094 bits (305), Expect = 9.267e-30
Identity = 110/433 (25.40%), Postives = 201/433 (46.42%), Query Frame = 2
Query:  332 TNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGN-FIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGL-GTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPEN---KFDSLIITKQKLGN--ITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAP----SINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNE 1591
            +   I C + W+++      T+ +EF+LVC     + L   +  VG+ VG   +    D+ GR   + ++++ + I  + + FA N    + +R L G+   G         TE V   +R +      + +  G +++ G+AY  + WR L   L    ++ +  Y+LLPESPRWL    + ++A   L  IA  NG+   +N    F+ +    +K GN  I D+  S  +R    VL+     + V Y GL+++   +  +++L   + GL E     +   +  ++ RR+ M +   +  +  +       +   ++I + TLG +G   LT AY +  +  NE++PT +RNM++     ++ I  + AP     +  I   +P      +  + +I G +I   LPET G PLP+T E+   + K  +
Sbjct:  121 SGRLIACDHGWEFDTEKTGLTLVSEFDLVCENAWLLDLSQALLNVGLLVGAILMGYVSDRYGRRWSLMVSIVMQTIFGVLVAFAPNYAAFVCMRTLQGIFNMGSWTTVFVTATEFVGSGQRRVVHMVLQMFFSFGVIMLSGIAYYLRTWRYLQLALTLPNVVLFSYYWLLPESPRWLISQNRKEQAFGVLKKIASVNGRELSDNIRKNFEEVTRADEKAGNPSIADLMRSAKIRKYTVVLMIYWFVVGVVYQGLAMSTGNIGDDVYLAFLMGGLAEIPGALMVIALIDRVGRRLPMCVAPGLSGLACLATALVPHDIGWLNITLVTLGRLG---LTMAYEMVTLVNNELYPTHLRNMAMSTCSSLSGIGGIVAPFVLYRLYTIWRHLPMV---IFGTLAIIGGFVI-LLLPETNGLPLPETTEDAENISKNQK 546          
BLAST of slc22a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007122.1 (pep scaffold:Pmarinus_7.0:GL476962:153150:164773:-1 gene:ENSPMAG00000006444.1 transcript:ENSPMAT00000007122.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 1.763e-18
Identity = 65/239 (27.20%), Postives = 112/239 (46.86%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACIS-SMDINSIVFIGHTPSYKCVDP------IFNQTQLTWTVKECQAIARSE--------NGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVG-NFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR 772
            MN+++ + +I G  +F ++ L T   +  IS +M +   VF G TP++ C DP      + + T    T  E  A   +E        N +        W Y+++  T+T+ TE++LVC +     + +++F +G+ VG   +    DK GR  +I +++  +    +   FA N  +  L RF+ G+  +G I       TE   I  R L        + +GYML+  +AY  +DWR
Sbjct:    1 MNFDDVLKKIGGFGKFQMI-LYTWICLPHISIAMHMLVSVFAGATPAHFCRDPPGGHAPVPSATTAPPTAGESAAANGTERPRCGSRLNESGWQPCATGWDYDRSVFTSTVVTEWDLVCTRSYLNNVGSSIFMLGLMVGAPVLGTMADKYGRKSVILVSMAIQTAFGLGAAFAPNFVMYALARFMVGVAISGVIMNAFVLATEWTGIGERMLAGIATQQAFGVGYMLLAPVAYFIRDWR 238          
BLAST of slc22a-5 vs. Ensembl Sea Lamprey
Match: slc22a6l (solute carrier family 22 member 6, like [Source:NCBI gene;Acc:404609])

HSP 1 Score: 83.1889 bits (204), Expect = 9.814e-18
Identity = 82/316 (25.95%), Postives = 144/316 (45.57%), Query Frame = 2
Query:  662 EIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXX-XXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDS-LIITKQKLGNIT---------DIFGSKIMRLKMFVLIFVH-GTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSV---CLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEE 1564
            E +++K R+LY     + Y  G +++  LAY  +DWR  +H ++     +       PES RWL + G +++A+  L  +A  NG+     +  S L   +++L   T         ++     +R +  V+  V    +   Y G  +  +   ++ FL   I G ++     V  ++ S L RR +   +  + S+   CL+     S          + L  +GK AL+ ++    +Y  E+FPT IR   + +   +A +  + AP +    E +P    S Y    L++G L+Y FLPET   PLP+T+EE
Sbjct:    2 EWIAMKDRTLYGMLSGVAYTTGQLVLVALAYYIRDWRHLQHSISAAFYVFFLCSWCTPESARWLVMRGHYERALHGLKRVAVINGRKREAAQLTSPLQYLRKELEEDTGPRRFYTMFNLLTIPALRRRTLVMSLVWCDDVFCWYAGFVVIVTRTCAHTFLLQVIYGAIDYPAKVVGLVVLSLLGRRATQAGSLAVASIASFCLLAIPAES------GTARTCLAVLGKGALSCSFNCAYLYTGEIFPTVIRQSGLGLCSTMARVGGMLAPLVIMAGESLPALPLSMYGSASLVAGSLVY-FLPETLNRPLPETIEE 310          
BLAST of slc22a-5 vs. Ensembl Sea Lamprey
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 76.2554 bits (186), Expect = 1.766e-15
Identity = 78/319 (24.45%), Postives = 137/319 (42.95%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKC-------VDPIFNQT--------QLTWTVKECQAIA----RSENGTN----------HTIYC-RNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDW-RLSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQK 964
            MN+EEA+S   G  RF +   + L +   +    +    FI  TP ++C         P+ N +        Q  W   + + ++    R   GTN            + C   W+Y++   T T+ T+++LVC  K    L  T+F  G+ +G+ +     D+ GR   +  + +   +      +A +      +RFL G+  +G I   L    E +    R+    +    +  G M +  LAY  + W +L   + +      LT++ +PESPRWL + G+ ++A  NL L A+ NG+     KF S +  + +
Sbjct:    1 MNFEEALSAAGGFSRFQLWLTVLLLVPRLVLPWHLMVNNFISATPHHRCRLPDSPTAAPLDNGSGPAETWGGQPPWRDDDEEGLSACSLREAAGTNASESPLRNSSEAVPCPSGWEYDRRQFTETVVTQWDLVCEHKALNHLSLTLFMAGVMLGSLVFGYLSDRYGRRNALLGSYVLNAVTGTAAAWAPSFSSFTAMRFLLGVSLSGIIVNTLSLSVEWLDQGHRTFAGTSGGFAWSTGNMALGLLAYLLRGWQQLQLVVTSPIYFCILTWWFIPESPRWLLVRGRAREAHRNLSLCARINGRT----KFGSEVTVEAR 315          
BLAST of slc22a-5 vs. Ensembl Sea Lamprey
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 61.2326 bits (147), Expect = 3.114e-10
Identity = 100/434 (23.04%), Postives = 172/434 (39.63%), Query Frame = 2
Query:  380 MTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICG---DKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSL---YTNNYWIL-----YVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFL---------------------------------SSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNE--VFPTPIRNMSIFIILGIASIFTVFAPSINGI--DEFIPYFSCSCYSVMCLISGLLIYFFLPETKG 1537
            ++ TI  E+ L   ++  V L+ TM F G  + +    CG   D+ GR +++ L  IW    +    F+      + LRFL G G G   QG   ++E +    R      +  +W+L      VL Y+++P L +    W L R       +  + +  +PES R+     K  KA+  L  IAK N    P+          ++ GNI D+   + +R  +       GT +++Y+GL +  S L                                  S  +  + +    E    P   +    L RR SM ++ ++C +      +Y  N     + ++ L    +   +T + I  +Y  E  V+PT IR++ +      A I  + AP +  +  D  IP   C  +  +C+I  +L +    ET G
Sbjct:   71 ISPTIQCEWRL---QQWQVALVTTMVFFGFMLSS--GPCGFLADRYGRWKVLLLVTIWSSYWSGISSFSPTYGWFVFLRFLMGCGIGGQSQGFVLMSEFMPSTARGRVLPMSQVFWVLGSLLEVVLAYLILPTLGWA---W-LIRISTIPSFVLLIAFKFIPESARYQVSAAKPDKALLTLAKIAKMNKTTLPQGTLVE--PPAERRGNIWDLLDRQYLRTTLQTWPIWFGT-TLTYYGLILVSSELLERNQMCGDDSVTAIEEHIAFSEQESPCFCKQFKSEDYKTLLLSSFGEFLAIPFTTLTIDTLGRRRSMALSMILCGLL-----YYLLNICTTRMGLTVLLFFLRAVASTNFNIIYIYTVEVKVYPTNIRSLGLGSCSSTARIGAMIAPFVAQVILDISIPLALC-LFGTVCVICSVLAFTLPIETMG 486          
BLAST of slc22a-5 vs. Ensembl Nematostella
Match: EDO46087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR13])

HSP 1 Score: 133.65 bits (335), Expect = 1.100e-33
Identity = 126/497 (25.35%), Postives = 230/497 (46.28%), Query Frame = 2
Query:  140 GNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTG-KIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPEN--KFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLI-----CSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNY 1600
            G  +  +  LL LS++   +++ +  +VF+   P + C++   N+T        C           + + C   +Y  T    +I TE++LVC       L+ ++   G  +G  +     DK GR R+ H  +   ++      FA    +   LRFL+G   G +I       TE+V    R          + LG +++P +AY  +DWR LS  L     +F L +  +PES RWL I G+  +A   LL IA  NG   P++  + +       + G   D+F ++ +  + FVLIF+    ++ Y+GLS+N   L+ +I++N F+  L+E F   +  +       R   L N+++     C  C+ +    S        + +    IGKF +T ++ +  +Y  E+FPT +RN+ + +    + I  + AP +  +  ++       + +   ++GLL    LPET   PLP+T+++  ++ K N++++
Sbjct:   14 GPHQRRLYVLLCLSIVP--AAIQLLLLVFVAAQPHWICLNSSTNET--------CP---------KNKLQCTERQY--TSKYTSIITEWDLVCENAYKADLVQSLLMSGTLLGALMFGALADKYGRRRVWHTTLTGLVVFGFASSFAPTFKIYATLRFLTGFCIGGEILSAFVLATELVGPSYRGFAGIMAQCFFTLGLLILPMVAYLIQDWRTLSVVLSLPASVFILFFRYVPESARWLMIRGRVSEAENILLDIALKNGIAVPKSLLQVNHPFFVGSRYG-FFDLFCTRKIVKQTFVLIFIWFVNTLVYYGLSLNTKHLAGDIYMNFFLCSLME-FPAYLTCLFFVNWAGRRKTLFNYMVLAGLACMACMFVQPESS---PADRTLATVFAMIGKFGITASFALIYIYSAEIFPTVVRNVGLGVCSMSSRIGGICAPFVVFLGTYMRPLPMVIFGMCAFMAGLL-SLMLPETHKRPLPETMDD--KMFKANDSDF 481          
BLAST of slc22a-5 vs. Ensembl Nematostella
Match: EDO45833 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW4])

HSP 1 Score: 130.183 bits (326), Expect = 1.389e-32
Identity = 116/443 (26.19%), Postives = 206/443 (46.50%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQK---LGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNN---FYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRN-----MSIFIILG 1396
            M+ ++ +S I G   F       L ++  I++     IVF+G  P +KC      Q   T T+    +       +  ++   +W++  T    +I +E++L+C K    +L  ++ F+G   G FI     D  GR R++  ++    + ++   FA ++WL ++LR + G   G +Y  L  L TE V    RSL     W+ + L  + + GLAYG  DWR     ++ P L    ++L+PES RW  +  + K+A   L  IAK NGK  P +   ++   +++    G I D+F  +    +  +L F   T ++ Y+G++++   L  +++LN  +  L+E         +   L     M +  L+C +CL   N   F+S       ++      +GKF ++ ++C   +   E+ PT IRN     M++F  LG
Sbjct:    1 MDIDKILSSIGGFGFFQKRNSFILGLVIFIATFQTVLIVFVGMEPPWKCA-----QDSTTCTLNGTFSSGDENYDSRCSMNRSDWEF--TSGFTSIVSEWDLICGKAAMASLAQSILFIGWIPGAFIIGKLSDMFGRTRMLFPSIAVVAVASLSCSFAQHLWLYLVLRAIIGFFEGGVYIVLYVLSTEFVGPAHRSLAGTLNWVFFTLSLITLDGLAYGLHDWRHLSIAVSVPALPLFFFWLVPESCRWQLVNNRCKEARQTLEHIAKLNGKNLPSDVMPAINNVEEEKSFRGGILDLFKPRQQLKQTLILWFSWLTNAMVYYGVTLSAGVLGGSLYLNFLLASLVE---------LPGNLFSIWFMNLLGLVCMLCLASANITLFFSQGPGHYQVIKIISAVLGKFCISISFCTIYVTSTELLPTVIRNIGMGSMAVFDQLG 427          
BLAST of slc22a-5 vs. Ensembl Nematostella
Match: EDO27829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T865])

HSP 1 Score: 128.642 bits (322), Expect = 1.810e-31
Identity = 129/503 (25.65%), Postives = 228/503 (45.33%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQ--GLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRR----VSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNE 1573
            +  ++A+ +  G   + +     +S      S  +  + F    P ++CV    +    T T K   A     N     +  R+ W++      ++I TE++LVC+K  Y T+ N++ F+    G    +I GDK GR  ++   VI+  +  +   FA   W+  L R L G G G  Y   G   + E + I+ RS+     W  ++L   ++  L Y    WR LS       LLF++ ++  P+S RW  + GKF  A   L+ +AK  G  + +  F+     +  I  ++LG+I D+F S+ M  +  V  +      + Y+G+S++ + +  +++LN F+  L E     +   +  +  R+     SM +  L   V  +L+ +   +  ++   I +   I KF +T A+    +Y +E+FPT +RN ++      A I +  AP      +  P       ++  LI G+L    LPETK  PLP T+++  E
Sbjct:    3 LTADQAVEKAGGFGWYQLRVFAVISYAVIFCSCVLMVMTFSTAEPPWQCVAN--SSCNFTGTFKPGDA-----NYEKRCLMARDQWEFAIDAGFDSIVTEWDLVCSKSMYATIANSITFILWIFGAMAGSIIGDKFGRKIVVFPCVIFASLCGLASAFANKYWVFALFRALLGAGIGG-YSICGFVLVMEYIGIRHRSIVGFCVWYPWILALFMLALLGYLIPSWRTLSIITSAPGLLFFVFWWFTPDSLRWYLVKGKFDDAKKVLVDVAKGCGNNYTKQDFEFEEEHTFNIEHERLGDIRDLFHSRSMAHRTLVSWYCWLVSGLVYYGISLSSTTIGGDMYLNFFLSALFEGIGMAIGIPLLDRFGRKKTIVASMYVAALAAIVAALLSQYDDGSQAMLVGKIISAMVIAKFFVTIAFDGVYVYSSELFPTVVRNTAMGTSTSAARIGSFAAPFTVYSQKVHPMMPFGIMALNALICGILC-MTLPETKDKPLPDTVKQTEE 496          
BLAST of slc22a-5 vs. Ensembl Nematostella
Match: EDO47316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMR6])

HSP 1 Score: 125.176 bits (313), Expect = 7.828e-31
Identity = 124/499 (24.85%), Postives = 229/499 (45.89%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFV----GMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQ--GLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGS--IGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTL 1558
            +  ++A+ +  G   + +     +S      S  +  + F    P ++CV    +    T T K   A     N     +  R+ W++      ++I TE++LVC+K  Y T+ N++ F+    G   G+ I+   DK GR  ++   VI+  +  +   FA   W+  L R L G G G  Y   G   + E + I+ RS+     W  ++L   ++  L Y    WR LS       LLF++ ++  P+S RW  + GKF  A   L+ +AK  G  + +  F+     +  I  ++LG+I D+F S+ M  +  V  +      + Y+G+S++ + +  +++LN F+  L E     +   +  +  R+ +++ +  + ++  ++    S  +    +V   + +  I KF +T A+    +Y +E+FPT +RN ++      A I +  AP    +   +P+      ++  LI G+L    LPETK  PLP T+
Sbjct:    3 LTADQAVEKAGGFGWYQLRVFAVISYAVIFCSCVLMVMTFSTAEPPWQCVAN--SSCNFTGTFKPGDA-----NYEKRCMMARDQWEFAIDAGFDSIVTEWDLVCSKSMYATIANSITFILWIFGAMAGSIIS---DKFGRKIVVFPCVIFASLCGLASAFANKYWVFALFRALLGAGIGG-YSICGFVLVMEYIGIRHRSIVGFCVWYPWILALFMLALLGYLIPSWRTLSIITSAPGLLFFVFWWFTPDSLRWYLVKGKFDDAKKVLVDVAKGCGNNYTKQDFEFEEEHTFNIEHERLGDIRDLFHSRSMAHRTLVSWYCWLVSGLVYYGISLSSTTIGGDMYLNFFLSALFEGIGMAIGIPLLDRFGRKKTIVASMYVAALAAIVAALLSQYDDGTMLVGKIISAMVIAKFFVTIAFDGVYVYSSELFPTVVRNTAMGTSTSAARIGSFAAPFTQKVHPMMPF---GIMALNALICGILC-MTLPETKDKPLPDTV 486          
BLAST of slc22a-5 vs. Ensembl Nematostella
Match: EDO36597 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI67])

HSP 1 Score: 122.094 bits (305), Expect = 8.035e-30
Identity = 120/485 (24.74%), Postives = 224/485 (46.19%), Query Frame = 2
Query:  140 GNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLC---YLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFD-----SLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGS--IGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTL 1558
            G  +  V A+++ + + C  S  +  + F    P ++CV    +    T T K   A     N     +  R+ W++      ++I TE++LVC+K  Y T+ N++ F+    G    +I GDK GR  ++   VI+  +  +   FA   W+  L R L G G G     +C    + E + I+ RS+     +  ++L   ++  L Y    WR    + + P L +  ++  P+S RW  + GKF  A   L+ +AK  G  + +  F+     +  I  ++LG+I D+F S+ M  +  V  +      + Y+G+S++ + +  +++LN F+  L E     +   +  +  R+ ++  +  + ++  ++    S  +    +V   + +  I KF +T A+    +Y +E+FPT +RN ++      A I +  AP    +   +P+      ++  LI G+L    LPETK  PLP T+
Sbjct:   16 GWYQLRVFAVISYAKIFC--SCVLMVMTFSTAEPPWQCVAN--SSCNFTGTFKPGDA-----NYEKRCLMARDQWEFAIDAGFDSIVTEWDLVCSKSMYATIANSITFILWIFGAMAGSIIGDKFGRKIVVFPCVIFASLCGLASAFANKYWVFALFRALLGAGIGG--YSICSFVLVMEYIGIRHRSIVGFCVFYPWILALFMLALLGYLIPSWRTLSIITSAPGLLFFVFWFTPDSLRWYLVKGKFDDAKKVLVDVAKGCGNNYTKQDFEFEEEHTFNIEHERLGDIRDLFHSRSMAHRTLVSWYCWLVSGLVYYGISLSSTTIGGDMYLNFFLSALFEGIGMAIGIPLLDRFGRKKTIAASMCVAALAAIVAALLSQYDDGTMLVGKIISAMVIAKFFVTIAFDGVYVYSSELFPTVVRNTAMGTSTSAARIGSFAAPFTQKVHPMMPF---GIMALNALICGILC-MTLPETKDKPLPDTV 485          
BLAST of slc22a-5 vs. Ensembl Medaka
Match: si:dkey-166k12.1 (solute carrier family 22 member 13 [Source:NCBI gene;Acc:101165571])

HSP 1 Score: 147.132 bits (370), Expect = 9.344e-38
Identity = 138/510 (27.06%), Postives = 240/510 (47.06%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIF----NQT-QLTWTVKEC-QAIARSENGTNHTIYC-RNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPE----NKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSM----LINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFT----VFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGN 1570
            MN+++ ++ I G  ++  +  + + +   + +  +   +F G TP ++C D       NQT  L+     C  A A         + C R W Y+     ++  TE++LVCN+    +L ++++  G+ VG+ +     D+ GR  ++ L++  + +  + + FA N  + +LLRF  G   +G I       TE    KRR L        + LGYML+ G+AY  +DWR L   +     L      +LP+S RWL    + ++AI  L   A  NG++ P      K++ L  +K+    + D+  +  MR +  +L ++     + Y+GLS+  S L +N+++  F+ GL+E     +  I     +RR+S+     +  L C + L +   +         V++ L  +GKF +T ++ I  +Y  E+FPT +R   I    G++S+F     V AP IN +D   P      +    L+   L+   LPET   PLP TLE+  
Sbjct:    1 MNFDQILAAIGGFGKYQKILYIWICLPQILLAFHMMVSIFTGATPPHQCRDSFSTGAGNQTLNLSLPDASCFSADALPPGNRTERVPCGRGWVYSSEVFESSTVTEWDLVCNRAGLNSLGSSVYMSGLLVGSVVFGAMADRYGRRFVLLLSIALQTVFGVAVAFAPNFPVYVLLRFAVGTTISGVIINAFVLGTEWTCTKRRMLAGIITDYTFGLGYMLLAGVAYLIRDWRKLQLAISAPGFLLIFYIRVLPQSARWLLANDRTEEAIALLRKAALVNGRVLPPAVQVEKWEILGGSKRSHSAV-DLVRTPQMRKRTVILFYIWFVNVLVYYGLSLGVSRLGTNLYMTQFVFGLIEIPARSLVLIFL-PFSRRLSLSGFLAVGGLACLLMLTVPEDHP-------NVLTGLAMVGKFGITASFAIIYVYTAEIFPTVVRQTGI----GVSSMFARMGGVLAPIINMLDSHSPATPLIIFGTSPLLG-ALLALALPETADRPLPDTLEDAE 496          
BLAST of slc22a-5 vs. Ensembl Medaka
Match: ENSORLT00000024218.2 (solute carrier family 22 member 7 [Source:NCBI gene;Acc:101170147])

HSP 1 Score: 144.05 bits (362), Expect = 1.223e-36
Identity = 137/533 (25.70%), Postives = 242/533 (45.40%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNV--LALLTLSMMACISSMDINSIVFIGHTPSYKC-VDPIFN-----------------QTQLTWTVKECQAIARSE-----NGTNHT----IYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFI-AICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLG-TGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGK------IFPENKFDSLIITKQ--KLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRK 1582
            M +E  ++E+ G  RF +  + LL +  M       +N+  FI   PS+ C + P+ +                   Q   +   CQ  A  +     NGTN T    I C N W Y+ T   +T++++++LVC+KK       T+FF+G+ +G  I     D+ GR R + ++ I          F+ N  + + +RFL+G+G +G     +    E V IK R+       + +    +++P LAY   DWR L+  +    L   +T+  LPES RWL   GK  +A   L   A  N +      + PE     +++  +  K   +  +   ++ RL +   I   G ++ +Y+G+S+N +    NI+L  FI G+ E           +K+ RR++ +   L+  +C+  N    F         +T+G++GK     A+    +Y  E++PT +R   +     +A I    +P +  ++E   +   + +S +  I+GL    FLPET+   LP+T+E+  + R+
Sbjct:    1 MKFENVLAEVNGFGRFQIRTILLLVIPRMTLPFHFLLNN--FIAAVPSHHCDISPLDDGDLFRNLSELEKLVVSIPAQQDGSSHSCQMFAEPQYHLVWNGTNSTDPLKIPCTNGWWYDNTTFKSTLASQWDLVCDKKSMNRATATIFFMGVMLGAAIFGYLSDRFGRKRTLLVSYIATTTFGFASAFSYNFPMFVAMRFLTGVGISGISIVSIVLCVEWVDIKHRTYVGVLMSLDWSFSTVVLPALAYFVNDWRSLTATVTAPLLAAMITWRWLPESARWLISTGKVDRAHFYLHQCATVNHREDFMADLKPEVLSKVILVEDENRKYSYVDLVKTPRMRRLALLTGIVWFG-VACTYYGISLNVTGFGVNIYLTQFIYGVTEVPAKAFIVFFLNKIGRRLTQVGTLLLTGLCIFCN---IFIPQDQVAARTTVGALGKMLAEAAFTTVFLYTTELYPTVMRQNGLGYSSFMARIGVSVSPLMMILEETWIHLPNTIFSAVAFIAGLSAS-FLPETRNIRLPETIEDVEQKRR 526          
BLAST of slc22a-5 vs. Ensembl Medaka
Match: ENSORLT00000027238.1 (solute carrier family 22 member 5 [Source:NCBI gene;Acc:101164738])

HSP 1 Score: 144.05 bits (362), Expect = 1.229e-36
Identity = 147/535 (27.48%), Postives = 251/535 (46.92%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFN--VLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQ--LTWTV--------KECQAIARSENGTNHTIYCRN--------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATN-IWLIILLRFLSGLGT-GKIYQGLCYLTEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLII----TKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIA---SIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRK 1582
            NY +A++ +    RF   V  LL  S+M   +     ++VF+   PS+ C  P  N T+  LT  +        +E    +R        +  R                     W Y+K    +TI TEF+LVC ++      +T+FFVG+ +G+F +    D+ GR  ++   +  + I      F T  IW IILL F++GLG        L    EI +   R LY++      + +GYML+P  AY  +DW+ L   L    + +   +++LPESPRWL   G+  +A   + + AK+N    P N F+   +    T+++  N+ D+     +R    +L FV  T+   Y+ LS N S L ++ +++ FI  L+E      ++I      RR+S++++ +  +V L L          +S +  TL  + K++ TT   +   Y  E++PT +RN +      I+   S  T F  S++   +++PY   +  +V+  IS     +FLPE+   PLP+T+E+ +E ++
Sbjct:    3 NYGDAVAFLGQWGRFQQAVFFLLCASIMP--NGFGAFTLVFMNDIPSHHCRVPESNLTEEWLTSVIPLTEVNGKQELSKCSRYRLDVVRNLSARGFIPHKDINLSDIELEGCVDGWVYSKDIYQSTIVTEFDLVCTEQWKQPFTSTIFFVGVLLGSFFSGPLSDRFGRKPVLFATMAAQTIFTFLSVFTTTWIWFIILL-FINGLGQISNFVAALVLGAEIFTGNVRVLYSSMGTCCGFAVGYMLLPLCAYFLRDWKSLLLALSVPCVAYIPLWWILPESPRWLLSQGRIAEAEAVVKMAAKWNKVQAPSNIFECNSVEKTDTQKEHYNVFDLLRHSRIRTTTLLLCFVLFTLITGYYCLSFNTSQLHTDPYISCFISALVEIPAYASSFIALRYFPRRLSIIVSLIAGAVPLYL---IPLVPEHLSSLSLTLEMVSKYSFTTGASLMFAYTTELYPTVLRNTATGTTTTISRMGSCITPFLLSLSVHYKYLPYVILATLAVVTAISA----YFLPESFKLPLPETIEQMHERQR 527          
BLAST of slc22a-5 vs. Ensembl Medaka
Match: ENSORLT00000001522.2 (solute carrier family 22 member 5 [Source:NCBI gene;Acc:101164738])

HSP 1 Score: 142.895 bits (359), Expect = 2.659e-36
Identity = 147/532 (27.63%), Postives = 249/532 (46.80%), Query Frame = 2
Query:  110 NYEEAISEIQGNERFN--VLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQ--LTWTV--------KECQAIARSENGTNHTIYCRN--------------------WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATN-IWLIILLRFLSGLGT-GKIYQGLCYLTEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLII----TKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIA---SIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNE 1573
            NY +A++ +    RF   V  LL  S+M   +     ++VF+   PS+ C  P  N T+  LT  +        +E    +R        +  R                     W Y+K    +TI TEF+LVC ++      +T+FFVG+ +G+F +    D+ GR  ++   +  + I      F T  IW IILL F++GLG        L    EI +   R LY++      + +GYML+P  AY  +DW+ L   L    + +   +++LPESPRWL   G+  +A   + + AK+N    P N F+   +    T+++  N+ D+     +R    +L FV  T+   Y+ LS N S L ++ +++ FI  L+E      ++I      RR+S++++ +  +V L L          +S +  TL  + K++ TT   +   Y  E++PT +RN +      I+   S  T F  S++   +++PY   +  +V+  IS     +FLPE+   PLP+T+E+ +E
Sbjct:    3 NYGDAVAFLGQWGRFQQAVFFLLCASIMP--NGFGAFTLVFMNDIPSHHCRVPESNLTEEWLTSVIPLTEVNGKQELSKCSRYRLDVVRNLSARGFIPHKDINLSDIELEGCVDGWVYSKDIYQSTIVTEFDLVCTEQWKQPFTSTIFFVGVLLGSFFSGPLSDRFGRKPVLFATMAAQTIFTFLSVFTTTWIWFIILL-FINGLGQISNFVAALVLGAEIFTGNVRVLYSSMGTCCGFAVGYMLLPLCAYFLRDWKSLLLALSVPCVAYIPLWWILPESPRWLLSQGRIAEAEAVVKMAAKWNKVQAPSNIFECNSVEKTDTQKEHYNVFDLLRHSRIRTTTLLLCFVLFTLITGYYCLSFNTSQLHTDPYISCFISALVEIPAYASSFIALRYFPRRLSIIVSLIAGAVPLYL---IPLVPEHLSSLSLTLEMVSKYSFTTGASLMFAYTTELYPTVLRNTATGTTTTISRMGSCITPFLLSLSVHYKYLPYVILATLAVVTAISA----YFLPESFKLPLPETIEQMHE 524          
BLAST of slc22a-5 vs. Ensembl Medaka
Match: slc22a5 (solute carrier family 22 member 5 [Source:NCBI gene;Acc:101165246])

HSP 1 Score: 132.88 bits (333), Expect = 1.023e-32
Identity = 137/522 (26.25%), Postives = 232/522 (44.44%), Query Frame = 2
Query:  218 IVFIGHTPSYKCVDPIFNQTQ------LTWTVKECQAI----------------------ARSENGTN-HTIYCRN-WKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIA-ICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYL-TEIVSIKRRSLYTN-NYWILYVLGYMLIPGLAYGTKDWR-LSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGN---ITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINF-LICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSI---NGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNE----LRKGNENNYCNMILKHDELYNCKTK 1648
            I+F G TP + C+ P  N T+      + +T  + + I                       R  N T+     C + W Y+K    +TI TE+NLVC+ +  V   ++  FVG   G+ I+    D+ GR +++ +++  + +  +   F+ +  +  ++    G     IY     L TE++S   R L+T    ++ Y +GYM +P +A+G +DWR L   L    +++   ++ + ESPRWL   G+  +A   +   A+ N    P   F    I +   G    + DI   K +R    + + +  +I++ YFGLS+N S LS N F+N F+  + E      A+I+S+ L R     I   +   +   +     F    V  V   L   GKF  T A+ I  +Y  E++PT +RN+ + +    A I ++ AP I      D+ +PY      +    IS  ++  FLPET    LP+T+E+  E     R+  +         H+ L   + K
Sbjct:   39 IIFAGATPKHHCLIPDVNLTEEWRNAIIPFTEVDGEDIKSQCSRYKLDVVKNLSSEGYVPGRDVNLTSLQQEECLDGWTYSKEIYQSTIVTEWNLVCDNQWKVPFASSSLFVGYLFGSLISGQLSDRFGRKKVVFMSLAVQCLSVLLQSFSQSWKMFCIIFLFVGASQISIYISAFVLGTEVLSKTMRVLFTTLGAFLFYCIGYMTLPWIAFGIRDWRTLLAVLSATSVVYIPLWWFISESPRWLVTQGRVVEAEAIVRDAARRNKVAAPPVIFKESEIQEMPAGRKYTMLDILKFKKLRCITLMCLLLWMSINIGYFGLSLNTSNLSGNPFMNCFLSAISEV----PAYIVSTLLLRVSPRRILLSVFLFLGGGVLLLIQFIPESVQQVALALEMTGKFGFTMAFSIVYIYTAELYPTVLRNVGMGVCSSAARIGSITAPYIIYLGTYDKVLPYILMGSLT----ISSSMVNLFLPETLHKDLPETVEQMQECQGLCRRSKKRKCIQNGATHNSLSQLEAK 552          
BLAST of slc22a-5 vs. Planmine SMEST
Match: SMESG000064528.1 (SMESG000064528.1)

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 515/515 (100.00%), Postives = 515/515 (100.00%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCNMILKHDELYNCKTKL 1651
            MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNFPLLFYLTYFLLPESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFNNIIVSIVISTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCNMILKHDELYNCKTKL
Sbjct:    1 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNFPLLFYLTYFLLPESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFYSFNNIIVSIVISTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCNMILKHDELYNCKTKL 515          
BLAST of slc22a-5 vs. Planmine SMEST
Match: SMESG000004219.1 (SMESG000004219.1)

HSP 1 Score: 186.422 bits (472), Expect = 6.735e-52
Identity = 152/526 (28.90%), Postives = 261/526 (49.62%), Query Frame = 2
Query:  107 MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCV-----DPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLT--EIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHL-MNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINFLICSVCLMLNNFY---SFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMS---IFIILGIASIFTVFAPSINGIDEFIPYFSCSCY---SVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNY-CNMILKHDEL 1630
            M+YE   ++I G   F+ ++ +TLS+      ++   + F  + P + C+       I N T L  +  +CQ      +  N    C  W + K  M NT+  E NLVC++  Y  L+ T FFVG       +I  D IG+  L+ +++    II I    +  IW  ++L F+SG+    +Y  L Y T  EI+ +    L   N+W LY  GYML+   AY  + WR    L +   + + L ++ +PE+PRWL +  +  +A   +  IAK N     + +F+     +Q  G   ++   K M  +  +L F     S +Y G + + +F S NIF+  F+ GL+E  TGP++ IM++KL R+ S+     +  +CL++  F    S  ++    +   L    K   ++A+ I D+  NE+ PT  RN +   ++I +G+ SI   FAP I+ +   + ++    +   S++ LI+ +L++ F+PET   P+PQT+E+   L    E  +  +MI + ++L
Sbjct:    1 MDYEHLNAKIGGCGLFHYISFMTLSITTFKYVVEFQGLTFALYEPKFSCLVKNISSTIRNSTNLI-SKDQCQYRLSVNDSWNK---CDQWTFEKRFMRNTLINELNLVCDRAFYRELIFTTFFVGCLFSFPFSILSDSIGKRLLLIVSIFLSTIITIGQMVSYQIWQQLVLSFVSGV-CKSVYVSLAYTTLIEIIPVSHIDLAATNFWNLYSFGYMLVALFAYIFRSWRQIYILSLITSIFYVLYFWFVPETPRWLMLNKRRNEAFKTMSFIAKINKCTLNKEEFNKWKPIQQVTGKFWNLLKHKTMIYRFLILNFAGWAFSFAYIGSATDLTFASENIFITTFVMGLIELPTGPLSGIMANKLGRKKSVSALSGLGIICLIIMPFIEADSLKSVWQPWLKVCLAMGAKLGFSSAWLIFDIITNELIPTTDRNTAMSLVYITVGLGSI---FAPMIHSV--LLQFYFAGPFLLYSLLLLITVVLVFAFIPETHHLPVPQTIEQAVSLLIHKEQEWKMDMIQQAEKL 516          
BLAST of slc22a-5 vs. Planmine SMEST
Match: SMESG000025822.1 (SMESG000025822.1)

HSP 1 Score: 151.369 bits (381), Expect = 2.065e-39
Identity = 140/519 (26.97%), Postives = 253/519 (48.75%), Query Frame = 2
Query:  116 EEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQT--QLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQK-LGNITDIFGSKIMRLKM---FVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRR-VSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASI-------FTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCNMILKHDEL 1630
            E+ + +      F  LA   LS+ +   S  + +I+   +TP Y C   ++N +  +++ +  +C  I    +G+  TI C  W ++   +  T+ ++F+LVCN K    ++  +++     G  +    DK GR ++    +  E I    + F  ++   I+ R L G+     Y    +L E+V  + R    +  W    L YM+ P  AY TKDWR+++ +   P + Y    L PESPRWL +  +  + I +L  IA+ N KI     ++ + + K K   N       K   L+M   F+L+F   +I++ Y  +++N   LS+N+++++F+ GL+E F G +   +S +  RR  S ++   I S+ ++++ F+S N +   ++    G I K A+TT      +Y++E+ PT  R+      LG ASI       FT  A  IN +   + +     Y ++  ++  +IY +LPETK  P+P+TL +   L+   E  + + + K  E+
Sbjct:    4 EDILKDYNKRNTFKFLAFFILSLPSFQFSSQMQNILISTYTPKYTC---LYNSSFSKISISADQCNMII---DGS--TIVCNKWNFSYEPVGRTMMSDFSLVCNYKNLGDIILIVWYSTSITGPIMGWFSDKFGRKKVAIFNLCLETISTFFVSFTPDVTSNIICRLLIGISANGFYTCYVWLMEMVDNEFREFSGSFIWTYGCLAYMVFPLTAYFTKDWRITQLISLIPNILYFLILLFPESPRWLCVTNRKSELIKSLNKIAEIN-KIDTNINYEQIFVPKTKDEHNTWKALKDKTFSLRMTLSFLLVF---SINLIYAAIAVNLQILSNNMYISMFLLGLME-FPGILFSYVSLRFFRRKTSFILIGGIGSIFILISVFFSRNILWQGVIRIIFGCIAKIAVTTCNQSTMVYVSELCPTSHRS------LGFASIQLANLCSFTA-AIYINKLSTVLFFLPMVIYFILMFLTSCIIYLYLPETKNLPIPETLLDQKMLKVNKEKEFLDYMNKKREM 502          
BLAST of slc22a-5 vs. Planmine SMEST
Match: SMESG000025819.1 (SMESG000025819.1)

HSP 1 Score: 148.673 bits (374), Expect = 2.293e-38
Identity = 139/519 (26.78%), Postives = 252/519 (48.55%), Query Frame = 2
Query:  116 EEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQT--QLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQK-LGNITDIFGSKIMRLKM---FVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRR-VSMLINFLICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASI-------FTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCNMILKHDEL 1630
            E+ + +      F  LA   LS+ +   S  + +I+   +TP Y C   ++N +  +++ +  +C  I    +G+  TI C  W +    +  T+ ++F+LVC+ K    ++  +++     G  +    DK GR ++    +  E I    + F  ++   I+ R L G+     Y    +L E+V  + R    +  W    L YM+ P  AY TKDWR+++ +   P + Y    L PESPRWL +  +  + I +L  IA+ N KI     ++ + + K K   N       K   L+M   F+L+F   +I++ Y  +++N   LS+N+++++F+ GL+E F G +   +S +  RR  S ++   I S+ ++++ F+S N +   ++    G I K A+TT      +Y++E+ PT  R+      LG ASI       FT  A  IN +   + +     Y ++  ++  +IY +LPETK  P+P+TL +   L+   E  + + + K  E+
Sbjct:    4 EDILKDYNKRNTFKFLAFFILSLPSFQFSSQMQNILISTYTPKYTC---LYNSSFSKISISADQCNMII---DGS--TIVCNKWNFLYEPVGRTMMSDFSLVCDYKNLGDIILIVWYSTSITGPIMGWFSDKFGRKKVAIFNLCLETISTFFVSFTPDVTSNIICRLLIGISANGFYTCYVWLMEMVDNEFREFSGSFIWTYGCLAYMVFPLTAYFTKDWRITQLISLIPNILYFLILLFPESPRWLCVTNRKSELIKSLNKIAEIN-KIDTNINYEQIFVPKTKDEHNTWKALKDKTFSLRMTLSFLLVF---SINLIYAAIAVNLQILSNNMYISMFLLGLME-FPGILFSYVSLRFFRRKTSFILIGGIGSIFILISVFFSRNILWQGVIRIIFGCIAKIAVTTCNQSTMVYVSELCPTSHRS------LGFASIQLANLCSFTA-AIYINKLSTVLFFLPMVIYFILMFLTSCIIYLYLPETKNLPIPETLLDQKMLKVNKEKEFLDYMNKKREM 502          
BLAST of slc22a-5 vs. Planmine SMEST
Match: SMESG000025785.1 (SMESG000025785.1)

HSP 1 Score: 134.42 bits (337), Expect = 1.717e-33
Identity = 132/520 (25.38%), Postives = 245/520 (47.12%), Query Frame = 2
Query:  116 EEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCVDPIFNQT--QLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEFNLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGR--MRLIHLAVIWEIIINICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNYWILYVLGYMLIPGLAYGTKDWRLSRHLMNXXXXXXXXXXXXXESPRWLGIGGKFKKAITNLLLIA---KYNGKIFPEN-KFDSLIITKQKLGNITDIFGSKIMRLKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAWIMSSKLNRRVSMLINF-LICSVCLMLNNFYSFXXXXXXXXXXTLGSIGKFALTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIPYFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCNMILKHDELYNCKTK 1648
            E  IS     + F V+A L LS+ A        +++    TP++ C    +N+T  Q+  +  +C     + NG+N  + C++W ++      TI ++++LVC+ K    L+  +++    +        DK GR  + +I L++  E +    L F  N++  I  R   G      +    +L E+V+   R++  + +W+   +   + P   Y T++WRL++ +   P + Y+    +PESPRWL +  K ++ + +L  IA   K + ++ PE  K +       K     D+    +    +F +  +   IS     L++    LSSNI++++F+ GL+E F G +   +S    +R  M+  F +  S+ + L+   S  +   SI     GSIGK  + T+     +Y  E+FPT  R++   ++  I  +    A  IN +++F  +     Y ++ +IS  LI+ F+PETKG P+P+T+ +   L K  E  Y   +    ++ N   +
Sbjct:    4 ENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIRTPNFTCQ---YNETSHQIQISKDQC---TMTINGSN--VKCQHWTFSSEPFGETIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSI--ETVATFILAFTPNLYSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPEEIKIEKTTKEWNKWNAFKDMNFLFLASTSLFAVFSISILISAILIDLNL----LSSNIYISMFVLGLME-FPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVMTSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDRE 508          
The following BLAST results are available for this feature:
BLAST of slc22a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC22A56.005e-4429.64solute carrier family 22 member 5 [Source:HGNC Sym... [more]
SLC22A52.148e-4029.28solute carrier family 22 member 5 [Source:HGNC Sym... [more]
SLC22A44.350e-3324.72solute carrier family 22 member 4 [Source:HGNC Sym... [more]
SLC22A34.385e-3226.67solute carrier family 22 member 3 [Source:HGNC Sym... [more]
SLC22A242.647e-3026.59solute carrier family 22 member 24 [Source:HGNC Sy... [more]
back to top
BLAST of slc22a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oct-13.336e-3225.32Organic cation transporter 1 [Source:UniProtKB/Sw... [more]
oct-13.336e-3225.32Organic cation transporter 1 [Source:UniProtKB/Sw... [more]
oct-14.166e-3225.32Organic cation transporter 1 [Source:UniProtKB/Sw... [more]
Y82E9BR.168.909e-2623.72pep chromosome:WBcel235:III:1419867:1427226:-1 gen... [more]
K05F1.62.243e-1924.30pep chromosome:WBcel235:II:5782942:5787658:1 gene:... [more]
back to top
BLAST of slc22a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Balat1.450e-3327.99gene:FBgn0033778 transcript:FBtr0087815[more]
CG61264.546e-3222.50gene:FBgn0038407 transcript:FBtr0083278[more]
CG74581.668e-2926.45gene:FBgn0037144 transcript:FBtr0078475[more]
CG86542.359e-2925.57gene:FBgn0034479 transcript:FBtr0086340[more]
CG86542.359e-2925.57gene:FBgn0034479 transcript:FBtr0305676[more]
back to top
BLAST of slc22a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc22a13a2.171e-3425.14solute carrier family 22 member 13a [Source:ZFIN;A... [more]
slc22a7b.11.985e-3326.26solute carrier family 22 member 7b, tandem duplica... [more]
slc22a7a3.827e-3225.14solute carrier family 22 member 7a [Source:ZFIN;Ac... [more]
oct22.166e-3127.60organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
slc22a6l5.375e-3123.98solute carrier family 22 member 6, like [Source:NC... [more]
back to top
BLAST of slc22a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
emc21.499e-3926.23ER membrane protein complex subunit 2 [Source:Xenb... [more]
emc21.539e-3926.23ER membrane protein complex subunit 2 [Source:Xenb... [more]
bub1b1.204e-3525.75BUB1B, mitotic checkpoint serine/threonine kinase ... [more]
slc22a41.387e-3524.34solute carrier family 22 (organic cation/zwitterio... [more]
slc22a41.150e-3324.95solute carrier family 22 (organic cation/zwitterio... [more]
back to top
BLAST of slc22a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc22a51.487e-4426.79solute carrier family 22 (organic cation transport... [more]
Slc22a214.843e-4028.87solute carrier family 22 (organic cation transport... [more]
Slc22a41.352e-3625.65solute carrier family 22 (organic cation transport... [more]
Slc22a36.244e-3426.21solute carrier family 22 (organic cation transport... [more]
Slc22a302.542e-3023.48solute carrier family 22, member 30 [Source:MGI Sy... [more]
back to top
BLAST of slc22a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z0E8|S22A5_MOUSE1.040e-4326.79Solute carrier family 22 member 5 OS=Mus musculus ... [more]
sp|O76082|S22A5_HUMAN2.884e-4329.64Solute carrier family 22 member 5 OS=Homo sapiens ... [more]
sp|O70594|S22A5_RAT1.421e-4126.60Solute carrier family 22 member 5 OS=Rattus norveg... [more]
sp|Q9WTN6|S22AL_MOUSE3.388e-3928.87Solute carrier family 22 member 21 OS=Mus musculus... [more]
sp|Q9LHQ6|OCT4_ARATH1.941e-3625.11Organic cation/carnitine transporter 4 OS=Arabidop... [more]
back to top
BLAST of slc22a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK930.000e+0100.00Slc22a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A5J4NMU24.926e-7729.29MFS transporter, OCT family, solute carrier family... [more]
A0A504YHC01.452e-7629.95Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A183ATJ54.793e-7630.29MFS domain-containing protein OS=Echinostoma capro... [more]
A0A2H1CK087.565e-7629.76Transporter, major facilitator family protein OS=F... [more]
back to top
BLAST of slc22a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc22a6l1.003e-3825.00solute carrier family 22 member 6-like [Source:NCB... [more]
si:dkey-119m7.43.023e-3827.38solute carrier family 22 member 13-like [Source:NC... [more]
ENSAMXT00000002313.25.888e-3527.54solute carrier family 22 member 7-like [Source:NCB... [more]
slc22a57.371e-3424.68solute carrier family 22 member 4-like [Source:NCB... [more]
ENSAMXT00000010878.21.730e-3324.72pep primary_assembly:Astyanax_mexicanus-2.0:14:292... [more]
back to top
BLAST of slc22a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oct29.267e-3025.40organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000007122.11.763e-1827.20pep scaffold:Pmarinus_7.0:GL476962:153150:164773:-... [more]
slc22a6l9.814e-1825.95solute carrier family 22 member 6, like [Source:NC... [more]
SLC22A71.766e-1524.45solute carrier family 22 member 7 [Source:HGNC Sym... [more]
svopl3.114e-1023.04SVOP-like [Source:NCBI gene;Acc:492766][more]
back to top
BLAST of slc22a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc22a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460871.100e-3325.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458331.389e-3226.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278291.810e-3125.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473167.828e-3124.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365978.035e-3024.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc22a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-166k12.19.344e-3827.06solute carrier family 22 member 13 [Source:NCBI ge... [more]
ENSORLT00000024218.21.223e-3625.70solute carrier family 22 member 7 [Source:NCBI gen... [more]
ENSORLT00000027238.11.229e-3627.48solute carrier family 22 member 5 [Source:NCBI gen... [more]
ENSORLT00000001522.22.659e-3627.63solute carrier family 22 member 5 [Source:NCBI gen... [more]
slc22a51.023e-3226.25solute carrier family 22 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc22a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064528.10.000e+0100.00SMESG000064528.1[more]
SMESG000004219.16.735e-5228.90SMESG000004219.1[more]
SMESG000025822.12.065e-3926.97SMESG000025822.1[more]
SMESG000025819.12.293e-3826.78SMESG000025819.1[more]
SMESG000025785.11.717e-3325.38SMESG000025785.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30024134
GenBankAKN21553.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024134 ID=SMED30024134|Name=slc22a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1698bp
CATTAATCATTTAAACTGGAACTTGGCTTAATTAATTATTCGAAGATTTA
ATTTATAAGTAGTATATAATTTTGAATGCTTTTTATTTGATAAACTATTT
ACTGAAATGAATTATGAAGAAGCTATCTCGGAGATTCAAGGCAACGAAAG
ATTTAACGTATTGGCACTTCTTACTCTTAGCATGATGGCATGCATTTCTT
CAATGGACATTAACAGTATTGTTTTTATTGGTCATACCCCATCATATAAA
TGCGTTGATCCGATTTTCAATCAAACCCAATTGACTTGGACAGTGAAAGA
ATGTCAAGCAATCGCGAGGTCTGAAAATGGCACTAATCACACTATTTATT
GCCGGAACTGGAAGTACAATAAAACTGACATGACCAATACCATTTCTACG
GAATTCAATTTAGTTTGTAATAAAAAGAAATACGTAACTTTGATGAATAC
CATGTTTTTTGTTGGAATGTCGGTGGGAAATTTCATTGCAATTTGTGGCG
ATAAAATCGGTCGAATGAGACTTATACATCTCGCTGTGATATGGGAAATT
ATCATAAACATATGTTTACCTTTCGCAACAAATATATGGCTGATAATTTT
ACTAAGATTTCTTTCAGGTTTAGGGACAGGGAAAATATATCAAGGCTTGT
GCTATTTGACTGAGATCGTATCCATTAAAAGGCGTTCTTTGTATACAAAT
AACTATTGGATCCTTTATGTATTGGGATACATGCTCATTCCTGGACTAGC
GTATGGAACTAAAGATTGGAGGCTCTCGAGACATTTAATGAACTTTCCAT
TGTTATTTTACTTGACTTATTTTCTCCTTCCAGAATCACCACGATGGTTG
GGAATCGGTGGCAAATTTAAAAAAGCTATAACTAATTTATTGCTCATTGC
TAAATACAACGGTAAGATATTTCCTGAAAATAAATTCGATTCTTTAATTA
TTACGAAACAAAAACTCGGAAATATTACAGATATTTTCGGTTCAAAAATT
ATGAGACTGAAAATGTTTGTTTTGATATTTGTTCATGGAACAATTTCTGT
CAGTTATTTTGGATTGTCTATCAATGAATCTTTTCTTAGTTCCAATATAT
TTCTGAATGTTTTTATTCAAGGTCTTCTAGAAACCTTTACCGGTCCTGTT
GCTTGGATTATGTCTTCAAAATTAAACAGAAGGGTTTCAATGCTAATCAA
TTTTCTAATTTGTTCGGTTTGTCTAATGTTGAATAATTTTTATTCTTTCA
ACAATATTATCGTTTCGATTGTAATTTCAACACTAGGATCCATTGGGAAA
TTTGCCCTTACTACGGCATACTGCATCTGTGACATGTATTTGAATGAAGT
CTTTCCAACTCCGATTCGTAATATGTCTATTTTTATCATTTTGGGAATTG
CATCTATTTTCACAGTTTTCGCGCCTTCAATAAACGGAATAGATGAATTT
ATACCGTATTTCTCGTGCTCTTGCTACTCGGTAATGTGCCTTATTTCTGG
ATTACTTATATACTTTTTCTTGCCTGAAACAAAAGGTTGCCCATTACCAC
AAACCTTGGAAGAAGGCAATGAACTAAGAAAGGGAAACGAGAACAATTAT
TGTAATATGATTCTCAAGCATGACGAGTTATATAATTGCAAAACAAAGCT
TTAAGGCTTTATATATTATTATAATTTTTTATTAATATAAAGAACTAG
back to top

protein sequence of SMED30024134-orf-1

>SMED30024134-orf-1 ID=SMED30024134-orf-1|Name=SMED30024134-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=516bp
MNYEEAISEIQGNERFNVLALLTLSMMACISSMDINSIVFIGHTPSYKCV
DPIFNQTQLTWTVKECQAIARSENGTNHTIYCRNWKYNKTDMTNTISTEF
NLVCNKKKYVTLMNTMFFVGMSVGNFIAICGDKIGRMRLIHLAVIWEIII
NICLPFATNIWLIILLRFLSGLGTGKIYQGLCYLTEIVSIKRRSLYTNNY
WILYVLGYMLIPGLAYGTKDWRLSRHLMNFPLLFYLTYFLLPESPRWLGI
GGKFKKAITNLLLIAKYNGKIFPENKFDSLIITKQKLGNITDIFGSKIMR
LKMFVLIFVHGTISVSYFGLSINESFLSSNIFLNVFIQGLLETFTGPVAW
IMSSKLNRRVSMLINFLICSVCLMLNNFYSFNNIIVSIVISTLGSIGKFA
LTTAYCICDMYLNEVFPTPIRNMSIFIILGIASIFTVFAPSINGIDEFIP
YFSCSCYSVMCLISGLLIYFFLPETKGCPLPQTLEEGNELRKGNENNYCN
MILKHDELYNCKTKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000087proximal tubule
PLANA:0000418head
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR005828MFS_sugar_transport-like
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 85..486
e-value: 1.5E-51
score: 177.6
NoneNo IPR availablePANTHERPTHR24064FAMILY NOT NAMEDcoord: 33..490
NoneNo IPR availablePANTHERPTHR24064:SF411coord: 33..490
NoneNo IPR availableCDDcd17317MFS_SLC22coord: 85..473
e-value: 5.36695E-46
score: 161.594
NoneNo IPR availableTMHMMTMhelixcoord: 331..353
NoneNo IPR availableTMHMMTMhelixcoord: 110..129
NoneNo IPR availableTMHMMTMhelixcoord: 200..218
NoneNo IPR availableTMHMMTMhelixcoord: 360..381
NoneNo IPR availableTMHMMTMhelixcoord: 420..439
NoneNo IPR availableTMHMMTMhelixcoord: 449..471
NoneNo IPR availableTMHMMTMhelixcoord: 304..321
NoneNo IPR availableTMHMMTMhelixcoord: 228..250
NoneNo IPR availableTMHMMTMhelixcoord: 385..407
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 89..480
e-value: 6.8E-25
score: 87.8
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 20..476
score: 13.079
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 110..482