Mannose-1-phosphate guanyltransferase

Overview
NameMannose-1-phosphate guanyltransferase
Smed IDSMED30024129
Length (bp)1245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mannose-1-phosphate guanyltransferase (SMED30024129) t-SNE clustered cells

Violin plots show distribution of expression levels for Mannose-1-phosphate guanyltransferase (SMED30024129) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mannose-1-phosphate guanyltransferase (SMED30024129) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mannose-1-phosphate guanyltransferase (SMED30024129) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024129

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30024129SMESG000069929.1 SMESG000056500.1 dd_Smed_v4_3771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024129SMESG000069929.1 SMESG000056500.1 dd_Smed_v4_3771_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Human
Match: GMPPB (GDP-mannose pyrophosphorylase B [Source:HGNC Symbol;Acc:HGNC:22932])

HSP 1 Score: 415.231 bits (1066), Expect = 7.229e-144
Identity = 194/361 (53.74%), Postives = 259/361 (71.75%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLSTPKPLV FCN+PILLHQ++AL    V  +ILA+    + LE  +      L +++  S+E  PLGTAGPLA A+  +  +  + FFVLNSD+IC++PF+ M++FH  HG EG++ + +VEEP+KYG VV E  T RI +F EKP  ++SNKINAG+YI + ++L RI+    SIE ++FP M  + +LY  E +GFWMDIGQP+D+L+GM L+L  L +    +L  G  I GNV++DP+A + +N  IGPNV LGPGV +++G  IR  T+L +  I SH W++S ++GW C VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I +SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSET-ADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEVFPIMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Human
Match: GMPPB (GDP-mannose pyrophosphorylase B [Source:HGNC Symbol;Acc:HGNC:22932])

HSP 1 Score: 415.231 bits (1066), Expect = 7.229e-144
Identity = 194/361 (53.74%), Postives = 259/361 (71.75%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLSTPKPLV FCN+PILLHQ++AL    V  +ILA+    + LE  +      L +++  S+E  PLGTAGPLA A+  +  +  + FFVLNSD+IC++PF+ M++FH  HG EG++ + +VEEP+KYG VV E  T RI +F EKP  ++SNKINAG+YI + ++L RI+    SIE ++FP M  + +LY  E +GFWMDIGQP+D+L+GM L+L  L +    +L  G  I GNV++DP+A + +N  IGPNV LGPGV +++G  IR  T+L +  I SH W++S ++GW C VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I +SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSET-ADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEVFPIMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Human
Match: GMPPB (GDP-mannose pyrophosphorylase B [Source:HGNC Symbol;Acc:HGNC:22932])

HSP 1 Score: 399.823 bits (1026), Expect = 1.767e-137
Identity = 194/388 (50.00%), Postives = 259/388 (66.75%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSW---------------------------VRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLSTPKPLV FCN+PILLHQ++AL    V  +ILA+    + LE  +      L +++  S+E  PLGTAGPLA A+  +  +  + FFVLNSD+IC++PF+ M++FH  HG EG++ + +VEEP+KYG VV E  T RI +F EKP  ++SNKINAG+YI + ++L RI+    SIE ++FP M  + +LY  E +GFWMDIGQP+D+L+GM L+L  L +    +L  G  I GNV++DP+A + +N  IGPNV LGPGV +++G  IR  T+L +  I SH W++S ++GW C VG W                           VRMEN+TVLGEDV VN EL+LNGA VLPHK I +SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSET-ADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEVFPIMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVSLWAGLGGERGGECACLPDKAYPLLEVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM 387          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Human
Match: GMPPA (GDP-mannose pyrophosphorylase A [Source:HGNC Symbol;Acc:HGNC:22923])

HSP 1 Score: 191.815 bits (486), Expect = 4.324e-56
Identity = 123/414 (29.71%), Postives = 191/414 (46.14%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMG--ESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHE----GTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETT---------------------RLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMEN----------------------------ITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P++ H I+A  ++   + IL +G  +    L   +       ++ +++  E  PLGT G L   +  I     E FFVLN+D+  ++P   MLE H    H     GT A     +   YG +V  P T  +  + EKP  ++S+ IN G+Y+F+   L  +                         + +E D+F  +    ++Y     G W  I      L   RLYL    + +  +L K    G  I+GNV I PTA V  ++++GPNV +G GVT+ EG R+R S +L    ++ H  +  S++GW   VG W R+E                             IT+LG  V++ +E+ +  ++VLPHK+++ S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTA--NRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDSPGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLSRYQDTHPERLAKHTPGGPWIRGNVYIHPTAKVAPSAVLGPNVSIGKGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRS 413          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Human
Match: GMPPA (GDP-mannose pyrophosphorylase A [Source:HGNC Symbol;Acc:HGNC:22923])

HSP 1 Score: 191.815 bits (486), Expect = 4.324e-56
Identity = 123/414 (29.71%), Postives = 191/414 (46.14%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMG--ESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHE----GTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETT---------------------RLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMEN----------------------------ITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P++ H I+A  ++   + IL +G  +    L   +       ++ +++  E  PLGT G L   +  I     E FFVLN+D+  ++P   MLE H    H     GT A     +   YG +V  P T  +  + EKP  ++S+ IN G+Y+F+   L  +                         + +E D+F  +    ++Y     G W  I      L   RLYL    + +  +L K    G  I+GNV I PTA V  ++++GPNV +G GVT+ EG R+R S +L    ++ H  +  S++GW   VG W R+E                             IT+LG  V++ +E+ +  ++VLPHK+++ S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTA--NRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDSPGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLSRYQDTHPERLAKHTPGGPWIRGNVYIHPTAKVAPSAVLGPNVSIGKGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRS 413          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Celegans
Match: tag-335 (Mannose-1-phosphate guanyltransferase beta [Source:UniProtKB/Swiss-Prot;Acc:A3QMC8])

HSP 1 Score: 395.201 bits (1014), Expect = 2.577e-136
Identity = 195/360 (54.17%), Postives = 253/360 (70.28%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKN------IKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSV 1165
            MKALIL+GG+GTRLRPLTL+ PKPLV+F N+P++LHQ++AL E+ V  ++LA+      LE  +      L VKL FS E  PLGTAGPLA A+  +E      FFVLNSD+IC++PFKQM+EFH+ HG EGT+A+ +VEEP+KYG VVF+    +I  F EKP EY+ NKINAGLYIF+  IL RI     SIE +IFP+M     LY     GFWMD+GQP+D+L GM L+L +     S KL  G N      I+GNVM+DP+A+V EN +IGP+VV+GP V I+ G RI +STILS++ I ++ W+  S++G  C +GSWVR+ENI V+G+DV V  EL+LNGA VLPHK I  +V
Sbjct:    1 MKALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAEVGVDTVVLAVSYRAEQLEQEMTVHADRLGVKLIFSLEEEPLGTAGPLALARKHLEGD--APFFVLNSDVICDFPFKQMVEFHKNHGKEGTIAVTKVEEPSKYGVVVFDQDKGKIDDFVEKPQEYVGNKINAGLYIFSSKILDRIPLKPTSIEKEIFPEMAFSGNLYAFVLPGFWMDVGQPKDFLKGMSLFLNHCHTTKSDKLETGSNIHPTATIRGNVMVDPSATVGENCVIGPDVVIGPRVKIEGGVRILHSTILSDSSIGNYSWVSGSIVGRKCHIGSWVRIENICVIGDDVVVKDELYLNGASVLPHKSIAVNV 358          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Celegans
Match: tag-335 (Mannose-1-phosphate guanyltransferase beta [Source:UniProtKB/Swiss-Prot;Acc:A3QMC8])

HSP 1 Score: 395.201 bits (1014), Expect = 2.577e-136
Identity = 195/360 (54.17%), Postives = 253/360 (70.28%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKN------IKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSV 1165
            MKALIL+GG+GTRLRPLTL+ PKPLV+F N+P++LHQ++AL E+ V  ++LA+      LE  +      L VKL FS E  PLGTAGPLA A+  +E      FFVLNSD+IC++PFKQM+EFH+ HG EGT+A+ +VEEP+KYG VVF+    +I  F EKP EY+ NKINAGLYIF+  IL RI     SIE +IFP+M     LY     GFWMD+GQP+D+L GM L+L +     S KL  G N      I+GNVM+DP+A+V EN +IGP+VV+GP V I+ G RI +STILS++ I ++ W+  S++G  C +GSWVR+ENI V+G+DV V  EL+LNGA VLPHK I  +V
Sbjct:    1 MKALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAEVGVDTVVLAVSYRAEQLEQEMTVHADRLGVKLIFSLEEEPLGTAGPLALARKHLEGD--APFFVLNSDVICDFPFKQMVEFHKNHGKEGTIAVTKVEEPSKYGVVVFDQDKGKIDDFVEKPQEYVGNKINAGLYIFSSKILDRIPLKPTSIEKEIFPEMAFSGNLYAFVLPGFWMDVGQPKDFLKGMSLFLNHCHTTKSDKLETGSNIHPTATIRGNVMVDPSATVGENCVIGPDVVIGPRVKIEGGVRILHSTILSDSSIGNYSWVSGSIVGRKCHIGSWVRIENICVIGDDVVVKDELYLNGASVLPHKSIAVNV 358          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Celegans
Match: Y47D9A.1 (pep chromosome:WBcel235:I:4303930:4308244:1 gene:WBGene00021628.1 transcript:Y47D9A.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47D9A.1)

HSP 1 Score: 172.555 bits (436), Expect = 2.153e-49
Identity = 117/392 (29.85%), Postives = 185/392 (47.19%), Query Frame = 2
Query:  107 KALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEIN-VTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQM-LEFHEAHGHEGTMAIYQV--EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETT----RLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK-GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENI-----------------------------TVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            KA++L+GG   GTR RPL+L  PKPL      P++ H I  L +++ ++EI+L          D I +      V +++  E  PLGTAG L   K  I   D +  FV+N+D+  + P + M  +     G    M   +   ++   +G+VV + S  R+  + +KP  ++S  I+ G+Y+    ++ +++       + +E D+ P++ +   LY      +W         L   R YL       + +L K G  I G+V IDP+A VH  + IGPNV +GP   I +G RI+ S IL   +IE +  +  S+IGW   VG W R+E I                             T+LG DV V  E  +   +VLP+K++T S
Sbjct:    4 KAVVLVGGPQKGTRFRPLSLQLPKPLFPIAGVPLIEHHIDQLCQLSGLSEILLLGFFPSDVFTDFISRCQQTYRVSIKYLEEPNPLGTAGGLVSFKKQILAGDPDAVFVINADVCGDLPIEDMGAKLDSLSGSSMLMLTTEATRQQSINFGSVVTD-SEGRVIHYVDKPTTFVSTNISCGVYLIKAEVIRQLDLPLNGDGIWLETDVLPQLASSGNLYALHTTRWWSQTKTAAAVLYANRHYLRLYKRRYAARLCKNGAQIIGDVFIDPSAKVHPTAKIGPNVSIGPKSVIGKGVRIKESIILPEAVIEENACVLQSVIGWRSVVGMWARIEGIPLEPNPNLPFAKMDNKPLFLPDGRLTPSLTILGSDVSVAPETIILNCVVLPYKELTCS 394          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Celegans
Match: Y47D9A.1 (pep chromosome:WBcel235:I:4304041:4308244:1 gene:WBGene00021628.1 transcript:Y47D9A.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47D9A.1)

HSP 1 Score: 164.081 bits (414), Expect = 2.689e-46
Identity = 111/380 (29.21%), Postives = 176/380 (46.32%), Query Frame = 2
Query:  137 TRLRPLTLSTPKPLVKFCNEPILLHQIKALVEIN-VTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQM-LEFHEAHGHEGTMAIYQV--EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETT----RLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK-GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENI-----------------------------TVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            TR RPL+L  PKPL      P++ H I  L +++ ++EI+L          D I +      V +++  E  PLGTAG L   K  I   D +  FV+N+D+  + P + M  +     G    M   +   ++   +G+VV + S  R+  + +KP  ++S  I+ G+Y+    ++ +++       + +E D+ P++ +   LY      +W         L   R YL       + +L K G  I G+V IDP+A VH  + IGPNV +GP   I +G RI+ S IL   +IE +  +  S+IGW   VG W R+E I                             T+LG DV V  E  +   +VLP+K++T S
Sbjct:    9 TRFRPLSLQLPKPLFPIAGVPLIEHHIDQLCQLSGLSEILLLGFFPSDVFTDFISRCQQTYRVSIKYLEEPNPLGTAGGLVSFKKQILAGDPDAVFVINADVCGDLPIEDMGAKLDSLSGSSMLMLTTEATRQQSINFGSVVTD-SEGRVIHYVDKPTTFVSTNISCGVYLIKAEVIRQLDLPLNGDGIWLETDVLPQLASSGNLYALHTTRWWSQTKTAAAVLYANRHYLRLYKRRYAARLCKNGAQIIGDVFIDPSAKVHPTAKIGPNVSIGPKSVIGKGVRIKESIILPEAVIEENACVLQSVIGWRSVVGMWARIEGIPLEPNPNLPFAKMDNKPLFLPDGRLTPSLTILGSDVSVAPETIILNCVVLPYKELTCS 387          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Fly
Match: CG1129 (gene:FBgn0037279 transcript:FBtr0345174)

HSP 1 Score: 402.905 bits (1034), Expect = 2.937e-139
Identity = 196/360 (54.44%), Postives = 257/360 (71.39%), Query Frame = 2
Query:  107 KALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            +ALIL+GG+GTRLRPLTLSTPKPLV+F N+PILLHQ++ALV+    ++ILA+      +E  +      L V+L FS+E+ PLGTAGPLA AK  +  S  E FFVLNSD+IC++PFKQ+++FH  HG EGT+ + +VEEP+KYG V+++ +   I  F EKP E++SNKINAG+YIFN S+L RIE    SIE ++FP+M    ELY  +  GFWMDIGQP+D+L+GM LYL  L +  S KL  G  + GNV++DPTA + E   IGPNV +GP V I++G  I+ STIL   ++ SH W+DS ++GW   VG WVR+E ITVLGEDV V  EL++NG  VLPHK I  SV EP+ I+
Sbjct:   12 RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEAKKLGVELIFSHETEPLGTAGPLALAKTILAASS-EPFFVLNSDVICDFPFKQLVQFHCNHGKEGTIVVTKVEEPSKYGVVLYDENGC-IKNFIEKPQEFVSNKINAGIYIFNPSVLDRIEVKPTSIEKEVFPEMTQQQELYAMDLTGFWMDIGQPKDFLTGMCLYLSSLRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGAIVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPEPQIIM 369          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Fly
Match: CG1129 (gene:FBgn0037279 transcript:FBtr0078870)

HSP 1 Score: 402.905 bits (1034), Expect = 2.937e-139
Identity = 196/360 (54.44%), Postives = 257/360 (71.39%), Query Frame = 2
Query:  107 KALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            +ALIL+GG+GTRLRPLTLSTPKPLV+F N+PILLHQ++ALV+    ++ILA+      +E  +      L V+L FS+E+ PLGTAGPLA AK  +  S  E FFVLNSD+IC++PFKQ+++FH  HG EGT+ + +VEEP+KYG V+++ +   I  F EKP E++SNKINAG+YIFN S+L RIE    SIE ++FP+M    ELY  +  GFWMDIGQP+D+L+GM LYL  L +  S KL  G  + GNV++DPTA + E   IGPNV +GP V I++G  I+ STIL   ++ SH W+DS ++GW   VG WVR+E ITVLGEDV V  EL++NG  VLPHK I  SV EP+ I+
Sbjct:   12 RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEAKKLGVELIFSHETEPLGTAGPLALAKTILAASS-EPFFVLNSDVICDFPFKQLVQFHCNHGKEGTIVVTKVEEPSKYGVVLYDENGC-IKNFIEKPQEFVSNKINAGIYIFNPSVLDRIEVKPTSIEKEVFPEMTQQQELYAMDLTGFWMDIGQPKDFLTGMCLYLSSLRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGAIVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPEPQIIM 369          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Fly
Match: CG1129 (gene:FBgn0037279 transcript:FBtr0078871)

HSP 1 Score: 402.905 bits (1034), Expect = 2.937e-139
Identity = 196/360 (54.44%), Postives = 257/360 (71.39%), Query Frame = 2
Query:  107 KALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            +ALIL+GG+GTRLRPLTLSTPKPLV+F N+PILLHQ++ALV+    ++ILA+      +E  +      L V+L FS+E+ PLGTAGPLA AK  +  S  E FFVLNSD+IC++PFKQ+++FH  HG EGT+ + +VEEP+KYG V+++ +   I  F EKP E++SNKINAG+YIFN S+L RIE    SIE ++FP+M    ELY  +  GFWMDIGQP+D+L+GM LYL  L +  S KL  G  + GNV++DPTA + E   IGPNV +GP V I++G  I+ STIL   ++ SH W+DS ++GW   VG WVR+E ITVLGEDV V  EL++NG  VLPHK I  SV EP+ I+
Sbjct:   12 RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEAKKLGVELIFSHETEPLGTAGPLALAKTILAASS-EPFFVLNSDVICDFPFKQLVQFHCNHGKEGTIVVTKVEEPSKYGVVLYDENGC-IKNFIEKPQEFVSNKINAGIYIFNPSVLDRIEVKPTSIEKEVFPEMTQQQELYAMDLTGFWMDIGQPKDFLTGMCLYLSSLRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGAIVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPEPQIIM 369          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Fly
Match: CG1129 (gene:FBgn0037279 transcript:FBtr0345175)

HSP 1 Score: 402.905 bits (1034), Expect = 2.937e-139
Identity = 196/360 (54.44%), Postives = 257/360 (71.39%), Query Frame = 2
Query:  107 KALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            +ALIL+GG+GTRLRPLTLSTPKPLV+F N+PILLHQ++ALV+    ++ILA+      +E  +      L V+L FS+E+ PLGTAGPLA AK  +  S  E FFVLNSD+IC++PFKQ+++FH  HG EGT+ + +VEEP+KYG V+++ +   I  F EKP E++SNKINAG+YIFN S+L RIE    SIE ++FP+M    ELY  +  GFWMDIGQP+D+L+GM LYL  L +  S KL  G  + GNV++DPTA + E   IGPNV +GP V I++G  I+ STIL   ++ SH W+DS ++GW   VG WVR+E ITVLGEDV V  EL++NG  VLPHK I  SV EP+ I+
Sbjct:   12 RALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEAKKLGVELIFSHETEPLGTAGPLALAKTILAASS-EPFFVLNSDVICDFPFKQLVQFHCNHGKEGTIVVTKVEEPSKYGVVLYDENGC-IKNFIEKPQEFVSNKINAGIYIFNPSVLDRIEVKPTSIEKEVFPEMTQQQELYAMDLTGFWMDIGQPKDFLTGMCLYLSSLRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVTIGPDVVIEDGVCIKRSTILKGAIVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVIVKDELYINGGQVLPHKSIAASVPEPQIIM 369          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Fly
Match: CG8207 (gene:FBgn0034035 transcript:FBtr0087342)

HSP 1 Score: 171.785 bits (434), Expect = 1.088e-48
Identity = 114/430 (26.51%), Postives = 195/430 (45.35%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACL----DVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVE----EPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRI--------------------------ETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLV-----KGK-------NIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME-----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+L TPKPL      P++ H I+A  ++     IL +G   +   +  +     L    ++ +++  E   LGTAG +   +  I   +   FFVLN D+  ++P +++ +FHE       + I   E    +   YG +VF+ S+  ++ + EKP  Y+S  IN G+Y+ +  I + +                          E   +  E ++   +    +L+      +W  +      +   R YLG   + +  +L      +G+        +  +V + P+A+VH ++++GPNV +GPGVTI  G RIR S +L    I  H  +  S++G    +G+W R+E                             +IT+LG  V+V +E  L  ++VLPHK+++ S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSLDTPKPLFPLAGRPLIAHHIEACAQLPDIREILIIGYYPQTQMEGFVGDMQALYSSSNINIRYLQEFTALGTAGGMYHFRDQIRAGNPRAFFVLNGDVCADFPLQELCDFHEKRPASALVTIMSTEATRQQSLHYGCLVFDRSSGAVSHYVEKPSSYVSTFINCGVYVCSMDIFTVLAQIFHSRGQEYSCQAFCNGNGNGNGREQGHIKWEQEVLTPLAGTDKLFAMPVPNWWSQLKTAGSAIYANRHYLGLYKKTHPERLANVGIKRGEGDGSLICTVHPDVYVHPSATVHHSAVLGPNVAIGPGVTIGPGVRIRESIVLEQAQILDHTLVLHSIVGRGSTIGAWARVEGTPSDPDPNKPFAKMENPPLFNNEGKLNPSITILGCFVQVPAEKILLNSIVLPHKELSRS 431          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Zebrafish
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:445097])

HSP 1 Score: 415.616 bits (1067), Expect = 3.425e-144
Identity = 195/361 (54.02%), Postives = 262/361 (72.58%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTL+ PKPLV+FCN+PILLHQ++ALV+  V  +ILA+      LE  +      L +K+  S+E  PLGTAGPLA A+  + ++  E FFVLNSD+IC++PF  ML+FH+ HG EGT+ + +VEEP+KYG VV+E  + RI +F EKP  ++SNKINAG+YIF+ ++L RI+    SIE +IFP M  + +LY  E +GFWMDIGQP+D+L+GM +YL  + +    +L  G    GNV++DPTA + +N  IGPNV +G GV +++G R++  TIL    I SH W++S ++GW+  VG WVRMEN+TVLGEDV VN EL++NGA VLPHK ITDSV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLTVPKPLVEFCNKPILLHQVEALVKAGVRHVILAVSYMSELLEREMRAQEQRLGIKISLSHEKEPLGTAGPLALARELLTDNQ-EPFFVLNSDVICDFPFDDMLKFHQQHGREGTIVVTKVEEPSKYGVVVYEGDSGRIHRFVEKPQVFVSNKINAGMYIFSPAMLRRIQLQPTSIEKEIFPVMAEEGQLYAMELQGFWMDIGQPKDFLTGMCMYLQSVRQQAPERLRAGPGFLGNVLVDPTAVIGQNCTIGPNVTIGAGVVLEDGVRVKRCTILKGAHIRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYINGANVLPHKSITDSVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Zebrafish
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:445097])

HSP 1 Score: 358.607 bits (919), Expect = 5.774e-122
Identity = 169/340 (49.71%), Postives = 237/340 (69.71%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLN 1123
            MKALIL+GG+GTRLRPLTL+ PKPLV+FCN+PILLHQ++ALV+  V  +ILA+      LE  +      L +K+  S+E  PLGTAGPLA A+  + ++  E FFVLNSD+IC++PF  ML+FH+ HG EGT+ + +VEEP+KYG VV+E  + RI +F EKP  ++SNKINAG+YIF+ ++L RI+    SIE +IFP M  + +LY  E +GFWMDIGQP+D+L+GM +YL  + +    +L  G    GNV++DPTA + +N  IGPNV +G GV +++G R++  TIL    I SH W++S ++GW+  VG WV   + T+   ++KV + LF N
Sbjct:    1 MKALILVGGYGTRLRPLTLTVPKPLVEFCNKPILLHQVEALVKAGVRHVILAVSYMSELLEREMRAQEQRLGIKISLSHEKEPLGTAGPLALARELLTDNQ-EPFFVLNSDVICDFPFDDMLKFHQQHGREGTIVVTKVEEPSKYGVVVYEGDSGRIHRFVEKPQVFVSNKINAGMYIFSPAMLRRIQLQPTSIEKEIFPVMAEEGQLYAMELQGFWMDIGQPKDFLTGMCMYLQSVRQQAPERLRAGPGFLGNVLVDPTAVIGQNCTIGPNVTIGAGVVLEDGVRVKRCTILKGAHIRSHSWLESCIVGWSSSVGQWV---SFTISTTELKVRAHLFCN 336          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Zebrafish
Match: gmppab (GDP-mannose pyrophosphorylase Ab [Source:NCBI gene;Acc:393469])

HSP 1 Score: 191.045 bits (484), Expect = 5.369e-56
Identity = 125/416 (30.05%), Postives = 196/416 (47.12%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEI-NVTEIIL-AMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHG--HEGTM--AIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRI-----------------------ETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKN----IKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P+L H I+A  ++ ++ EIIL    +    L   I        + +++  E   LGT G +   +  I +     FF++N+D+   +P  +ML+FH  HG  H G +        +   YG +V    T  +  F EKP  ++S+ IN G+Y+F   I + I                       E  RL  E DIF  +    +L+  + + FW  I      +   RLYL    + +  +L   +     I G+V I PTA++  ++++GPNV +G GVTI  G R+R S IL   +++ HC + +S++GW+  VG W R+E                            +IT+LG +V + SE+ +  ++VLPHKD+  S
Sbjct:    2 LKAIILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACAQVPDMKEIILIGFYQPNDELNRFIYSAQQEFKIPIRYLQEFAALGTGGGIYHFRDQILSGGPAAFFLMNADVCSEFPLLEMLQFHRQHGENHCGVLLGTTANRTQSLNYGCIVENHETNEVLHFVEKPSTFVSDIINCGIYLFTPDIFAHIGKVFQRNQQEKIQEELTHGRQMPEVVRL--EQDIFTALAGQKKLFVYKTQHFWSQIKSAGSAIYASRLYLKQYHQTHPERLATNQGGTPKITGDVYIHPTANIDPSAVLGPNVSIGKGVTIGGGVRVRESIILHGAVLQDHCCVLNSIVGWDSTVGKWARVEGTPSDPNPNDPYAKIDSETLFRDGGLTPSITILGCNVNIPSEVIIRNSIVLPHKDLNRS 415          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Zebrafish
Match: gmppaa (GDP-mannose pyrophosphorylase Aa [Source:NCBI gene;Acc:431743])

HSP 1 Score: 189.504 bits (480), Expect = 2.345e-55
Identity = 126/416 (30.29%), Postives = 191/416 (45.91%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSY--ESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV----EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILS-----------------------RIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P+L H I+A  ++   + IL +G      E +    CA  D K+   Y  E   LGT G +   +  I +   + FFV+N+D+   +P  +ML+F + HG   +  I       ++   YG +V    T  +  + EKP  ++S+ IN G+Y+F   I                         R E  RL  E DIF  +    +LY  +   FW  I      +   RLYL    + +  +L      G   +GNV I PTA++   +++GPNV +G GVTI  G R+R S IL    ++ H  + +S++GW   +G W R+E                            +IT+LG +V + SE+ +  ++VLPHKD+  S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACSKLPNMKEILLIGFYQPNEELNRFLSCAQQDFKISIRYLQEYAALGTGGGIYHFRDQILSGGPDAFFVMNADVCSEFPLPEMLDFQKEHGDTYSFVILGTTANRKQSLNYGCIVENEQTDEVLHYVEKPGTFVSDIINCGIYLFTPEIFQHIGSVFQKNQQEMLLEEQSNGWHRAEVIRL--EQDIFTALAGQGKLYVYKTDRFWSQIKSAGSAIYASRLYLNQYHKTHPERLATNTEGGAKTRGNVYIHPTANIDPTAVLGPNVSIGTGVTIGAGVRVRESIILHGATLQDHSCVLNSIVGWESTIGKWARVEGTPSDPNPNDPYAKIDSETLFRDGKLTPSITILGCNVNIPSEVIILNSIVLPHKDLNRS 415          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Zebrafish
Match: gmppaa (GDP-mannose pyrophosphorylase Aa [Source:NCBI gene;Acc:431743])

HSP 1 Score: 187.578 bits (475), Expect = 1.330e-54
Identity = 126/421 (29.93%), Postives = 191/421 (45.37%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSY--ESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV----EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILS----------------------------RIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P+L H I+A  ++   + IL +G      E +    CA  D K+   Y  E   LGT G +   +  I +   + FFV+N+D+   +P  +ML+F + HG   +  I       ++   YG +V    T  +  + EKP  ++S+ IN G+Y+F   I                              R E  RL  E DIF  +    +LY  +   FW  I      +   RLYL    + +  +L      G   +GNV I PTA++   +++GPNV +G GVTI  G R+R S IL    ++ H  + +S++GW   +G W R+E                            +IT+LG +V + SE+ +  ++VLPHKD+  S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACSKLPNMKEILLIGFYQPNEELNRFLSCAQQDFKISIRYLQEYAALGTGGGIYHFRDQILSGGPDAFFVMNADVCSEFPLPEMLDFQKEHGDTYSFVILGTTANRKQSLNYGCIVENEQTDEVLHYVEKPGTFVSDIINCGIYLFTPEIFQHIGSVFQKNQQEMLLYSYEGEEQSNGWHRAEVIRL--EQDIFTALAGQGKLYVYKTDRFWSQIKSAGSAIYASRLYLNQYHKTHPERLATNTEGGAKTRGNVYIHPTANIDPTAVLGPNVSIGTGVTIGAGVRVRESIILHGATLQDHSCVLNSIVGWESTIGKWARVEGTPSDPNPNDPYAKIDSETLFRDGKLTPSITILGCNVNIPSEVIILNSIVLPHKDLNRS 420          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Xenopus
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:493267])

HSP 1 Score: 414.075 bits (1063), Expect = 2.379e-143
Identity = 196/362 (54.14%), Postives = 268/362 (74.03%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFI-ENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLS PKPLV FCN+PILLHQ++ALV+  V  +ILA+      LE  + +    L +++  S+E  PLGTAGPLA A+  + ENSD   FFVLNSD+IC++PF++M+ FH+ HG EGT+ + +VEEP+KYG VV+E  + +I +F EKP  ++SNKIN+GLYIF+ ++L RI+    SIE +IFP M  + +L+  E +GFWMDIGQP+D+L+GM +YL  + + +   L  G    GNV++DPTA + +N  IGPNV +GPGVT+++G RI+  TI+  + + SH W++SS++GW+  VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I++SV EPR I+
Sbjct:    8 MKALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVNHVILAVSYMSDMLEKEMKEQEKRLGIRISMSHEKEPLGTAGPLALARELLTENSDP--FFVLNSDVICDFPFEEMVRFHKHHGKEGTIVVTKVEEPSKYGVVVYEAESGQIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPAMAQEGQLFAMELQGFWMDIGQPKDFLTGMCMYLQSVRQKHPEWLHVGPGFIGNVLVDPTAKIGQNCSIGPNVTIGPGVTVEDGVRIKRCTIMKGSRLHSHSWLESSIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKCISESVPEPRIIM 367          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Xenopus
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:493267])

HSP 1 Score: 413.69 bits (1062), Expect = 2.732e-143
Identity = 196/362 (54.14%), Postives = 268/362 (74.03%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFI-ENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLS PKPLV FCN+PILLHQ++ALV+  V  +ILA+      LE  + +    L +++  S+E  PLGTAGPLA A+  + ENSD   FFVLNSD+IC++PF++M+ FH+ HG EGT+ + +VEEP+KYG VV+E  + +I +F EKP  ++SNKIN+GLYIF+ ++L RI+    SIE +IFP M  + +L+  E +GFWMDIGQP+D+L+GM +YL  + + +   L  G    GNV++DPTA + +N  IGPNV +GPGVT+++G RI+  TI+  + + SH W++SS++GW+  VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I++SV EPR I+
Sbjct:    6 MKALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVNHVILAVSYMSDMLEKEMKEQEKRLGIRISMSHEKEPLGTAGPLALARELLTENSDP--FFVLNSDVICDFPFEEMVRFHKHHGKEGTIVVTKVEEPSKYGVVVYEAESGQIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPAMAQEGQLFAMELQGFWMDIGQPKDFLTGMCMYLQSVRQKHPEWLHVGPGFIGNVLVDPTAKIGQNCSIGPNVTIGPGVTVEDGVRIKRCTIMKGSRLHSHSWLESSIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKCISESVPEPRIIM 365          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Xenopus
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:493267])

HSP 1 Score: 412.535 bits (1059), Expect = 6.722e-142
Identity = 196/362 (54.14%), Postives = 268/362 (74.03%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFI-ENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLS PKPLV FCN+PILLHQ++ALV+  V  +ILA+      LE  + +    L +++  S+E  PLGTAGPLA A+  + ENSD   FFVLNSD+IC++PF++M+ FH+ HG EGT+ + +VEEP+KYG VV+E  + +I +F EKP  ++SNKIN+GLYIF+ ++L RI+    SIE +IFP M  + +L+  E +GFWMDIGQP+D+L+GM +YL  + + +   L  G    GNV++DPTA + +N  IGPNV +GPGVT+++G RI+  TI+  + + SH W++SS++GW+  VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I++SV EPR I+
Sbjct:   70 MKALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVNHVILAVSYMSDMLEKEMKEQEKRLGIRISMSHEKEPLGTAGPLALARELLTENSDP--FFVLNSDVICDFPFEEMVRFHKHHGKEGTIVVTKVEEPSKYGVVVYEAESGQIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPAMAQEGQLFAMELQGFWMDIGQPKDFLTGMCMYLQSVRQKHPEWLHVGPGFIGNVLVDPTAKIGQNCSIGPNVTIGPGVTVEDGVRIKRCTIMKGSRLHSHSWLESSIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKCISESVPEPRIIM 429          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Xenopus
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:493267])

HSP 1 Score: 357.836 bits (917), Expect = 2.630e-121
Identity = 172/350 (49.14%), Postives = 245/350 (70.00%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFI-ENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENI--TVLGEDVKVNSELFLNGALVLPH 1144
            MKALIL+GG+GTRLRPLTLS PKPLV FCN+PILLHQ++ALV+  V  +ILA+      LE  + +    L +++  S+E  PLGTAGPLA A+  + ENSD   FFVLNSD+IC++PF++M+ FH+ HG EGT+ + +VEEP+KYG VV+E  + +I +F EKP  ++SNKIN+GLYIF+ ++L RI+    SIE +IFP M  + +L+  E +GFWMDIGQP+D+L+GM +YL  + + +   L  G    GNV++DPTA + +N  IGPNV +GPGVT+++G RI+  TI+  + + SH W++SS++GW+  VG WV    +  +     V+V   L  +G L+LP+
Sbjct:    1 MKALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVNHVILAVSYMSDMLEKEMKEQEKRLGIRISMSHEKEPLGTAGPLALARELLTENSDP--FFVLNSDVICDFPFEEMVRFHKHHGKEGTIVVTKVEEPSKYGVVVYEAESGQIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPAMAQEGQLFAMELQGFWMDIGQPKDFLTGMCMYLQSVRQKHPEWLHVGPGFIGNVLVDPTAKIGQNCSIGPNVTIGPGVTVEDGVRIKRCTIMKGSRLHSHSWLESSIVGWSSSVGQWVSAFTVFSSPTSLSVRVWPALLPSGILLLPN 348          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Xenopus
Match: zbtb7c (zinc finger and BTB domain containing 7C [Source:Xenbase;Acc:XB-GENE-954049])

HSP 1 Score: 192.2 bits (487), Expect = 3.361e-56
Identity = 121/418 (28.95%), Postives = 199/418 (47.61%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEI-NVTEIIL-AMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV----EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRI-------------------------ETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P++ H I+A  ++ N+ EI+L    +    L   ++K      V +++  E   LGT G +   +  I +   + FFV+N+D+   +P   ML+FH+ HG   +  I        +   YG +V    T  +  + EKP  ++S+ IN G+Y+F+ SI   I                          T  + +E D+F  +    +LY  + +G W  I      +   RLYL      +  +L      G  I+GNV I PTA+V  ++++GPNV +G GVT+  G RIR S +L   +++ H  + ++++GW+  VG W R+E                            +IT+LG +V + +E+ +  ++VLPHK+++ S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMVQHHIEACSKVPNLKEILLIGFYQPNEALSSFLLKAQQEFKVAIRYLQEYSALGTGGGIYHFRDQILSGGPQAFFVMNADVCSAFPLVPMLDFHKQHGGSQSYVILGTTANRSQSLNYGCIVANGETQEVLHYVEKPGTFVSDIINCGIYLFSPSIFQHIAEVFQRNQQELQLFSCISEENSSWQRTEVIRLEQDVFTTLAGRGKLYVYKTEGCWSQIKSAGSAIYASRLYLSQYGSTHPERLASTKEGGPTIRGNVYIHPTANVDPSAVLGPNVSIGMGVTVGAGVRIRESIVLHGAVLQDHSCVLNTIVGWDSTVGRWARVEGTPSDPNPNDPYSKIDSETLFREGKLTPSITILGCNVSIPAEVVILNSIVLPHKELSRS 419          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Mouse
Match: Gmppb (GDP-mannose pyrophosphorylase B [Source:MGI Symbol;Acc:MGI:2660880])

HSP 1 Score: 414.846 bits (1065), Expect = 7.036e-144
Identity = 195/361 (54.02%), Postives = 260/361 (72.02%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLSTPKPLV FCN+PILLHQ++AL    V  +ILA+    + LE  +      L +++  S+E  PLGTAGPLA A+  +  +  + FFVLNSD+IC++PF+ M++FH  HG EG++ + +VEEP+KYG VV E  T RI +F EKP  ++SNKINAG+YI + ++L RI+    SIE +IFP M  + +LY  E +GFWMDIGQP+D+L+GM L+L  L + +  +L  G  I GNV++DP+A + +N  IGPNV LGPGV +++G  IR  T+L +  I SH W++S ++GW C VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I +SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQMLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSET-ADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLKPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Mouse
Match: Gmppb (GDP-mannose pyrophosphorylase B [Source:MGI Symbol;Acc:MGI:2660880])

HSP 1 Score: 414.846 bits (1065), Expect = 7.036e-144
Identity = 195/361 (54.02%), Postives = 260/361 (72.02%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLSTPKPLV FCN+PILLHQ++AL    V  +ILA+    + LE  +      L +++  S+E  PLGTAGPLA A+  +  +  + FFVLNSD+IC++PF+ M++FH  HG EG++ + +VEEP+KYG VV E  T RI +F EKP  ++SNKINAG+YI + ++L RI+    SIE +IFP M  + +LY  E +GFWMDIGQP+D+L+GM L+L  L + +  +L  G  I GNV++DP+A + +N  IGPNV LGPGV +++G  IR  T+L +  I SH W++S ++GW C VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I +SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQMLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSET-ADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLKPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Mouse
Match: Gmppa (GDP-mannose pyrophosphorylase A [Source:MGI Symbol;Acc:MGI:1916330])

HSP 1 Score: 194.126 bits (492), Expect = 3.603e-57
Identity = 124/414 (29.95%), Postives = 191/414 (46.14%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMG--ESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHE----GTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIE---------------------TTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMEN----------------------------ITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P++ H I+A  ++   + IL +G  +    L   +       ++ +++  E  PLGT G L   +  I     E FFVLN+D+  ++P   MLE H    H     GT A     +   YG +V  P T  +  + EKP  ++S+ IN G+Y+F+   L  +                         + +E D+F  +    ++Y     G W  I      L   RLYLG     +  +L +    G  I+GNV I PTA V  ++++GPNV +G GVTI EG R+R S +L    ++ H  +  S++GW   VG W R+E                             IT+LG  V++ +E+ +  ++VLPHK+++ S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEALTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGAPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTA--NRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEESPGSWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLGRYQITHPERLARHTPGGPRIRGNVYIHPTAKVAPSAVLGPNVSIGKGVTIGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPNDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRS 413          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Mouse
Match: Gmppa (GDP-mannose pyrophosphorylase A [Source:MGI Symbol;Acc:MGI:1916330])

HSP 1 Score: 194.126 bits (492), Expect = 3.603e-57
Identity = 124/414 (29.95%), Postives = 191/414 (46.14%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMG--ESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHE----GTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIE---------------------TTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMEN----------------------------ITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P++ H I+A  ++   + IL +G  +    L   +       ++ +++  E  PLGT G L   +  I     E FFVLN+D+  ++P   MLE H    H     GT A     +   YG +V  P T  +  + EKP  ++S+ IN G+Y+F+   L  +                         + +E D+F  +    ++Y     G W  I      L   RLYLG     +  +L +    G  I+GNV I PTA V  ++++GPNV +G GVTI EG R+R S +L    ++ H  +  S++GW   VG W R+E                             IT+LG  V++ +E+ +  ++VLPHK+++ S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEALTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGAPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTA--NRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEESPGSWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLGRYQITHPERLARHTPGGPRIRGNVYIHPTAKVAPSAVLGPNVSIGKGVTIGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPNDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRS 413          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Mouse
Match: Gmppa (GDP-mannose pyrophosphorylase A [Source:MGI Symbol;Acc:MGI:1916330])

HSP 1 Score: 104.375 bits (259), Expect = 1.653e-25
Identity = 72/229 (31.44%), Postives = 108/229 (47.16%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMG--ESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHE----GTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIG 766
            +KA+ILIGG   GTR RPL+   PKPL      P++ H I+A  ++   + IL +G  +    L   +       ++ +++  E  PLGT G L   +  I     E FFVLN+D+  ++P   MLE H    H     GT A     +   YG +V  P T  +  + EKP  ++S+ IN G+Y+F+   L  +         D+F +   D +L   E  G W   G
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEALTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGAPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTA--NRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLR--------DVFQRNQQDGQL--EESPGSWPGAG 218          
BLAST of Mannose-1-phosphate guanyltransferase vs. UniProt/SwissProt
Match: sp|Q68EY9|GMPBA_XENLA (Mannose-1-phosphate guanyltransferase beta-A OS=Xenopus laevis OX=8355 GN=gmppb-a PE=2 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 2.614e-143
Identity = 197/362 (54.42%), Postives = 268/362 (74.03%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFI-ENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLS PKPLV FCN+PILLHQ++ALV+  VT +ILA+      LE  + +    L +++  S+E  PLGTAGPLA A+  + ENS  E FFVLNSD+IC++PF+ M+ FH+ HG EGT+ + +VEEP+KYG VV+E  + +I +F EKP  ++SNKIN+GLYIF+ ++L RI+    SIE +IFP M  + +LY  E +GFWMDIGQP+D+L+GM +YL  + + +   L  G    GNV++DPTA + +N  IGPNV +GPGVT+++G RI+  T++  + + SH W++SS++GW+  VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I++SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVTHVILAVSYMSDMLEKEMKEQEKRLGIRISMSHEKEPLGTAGPLALARELLTENS--EPFFVLNSDVICDFPFEDMVRFHKHHGKEGTIVVTKVEEPSKYGVVVYETESGQIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPAMAQEGQLYAMELQGFWMDIGQPKDFLTGMCMYLQSVRQKHPEWLHAGPGFIGNVLVDPTAKIGQNCSIGPNVTIGPGVTVEDGVRIKRCTVMKGSRLHSHSWLESSIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKCISESVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. UniProt/SwissProt
Match: sp|Q6DBU5|GMPPB_DANRE (Mannose-1-phosphate guanyltransferase beta OS=Danio rerio OX=7955 GN=gmppb PE=2 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 3.216e-143
Identity = 195/361 (54.02%), Postives = 262/361 (72.58%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTL+ PKPLV+FCN+PILLHQ++ALV+  V  +ILA+      LE  +      L +K+  S+E  PLGTAGPLA A+  + ++  E FFVLNSD+IC++PF  ML+FH+ HG EGT+ + +VEEP+KYG VV+E  + RI +F EKP  ++SNKINAG+YIF+ ++L RI+    SIE +IFP M  + +LY  E +GFWMDIGQP+D+L+GM +YL  + +    +L  G    GNV++DPTA + +N  IGPNV +G GV +++G R++  TIL    I SH W++S ++GW+  VG WVRMEN+TVLGEDV VN EL++NGA VLPHK ITDSV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLTVPKPLVEFCNKPILLHQVEALVKAGVRHVILAVSYMSELLEREMRAQEQRLGIKISLSHEKEPLGTAGPLALARELLTDNQ-EPFFVLNSDVICDFPFDDMLKFHQQHGREGTIVVTKVEEPSKYGVVVYEGDSGRIHRFVEKPQVFVSNKINAGMYIFSPAMLRRIQLRPTSIEKEIFPVMAEEGQLYAMELQGFWMDIGQPKDFLTGMCMYLQSVRQQAPERLRAGPGFLGNVLVDPTAVIGQNCTIGPNVTIGAGVVLEDGVRVKRCTILKGAHIRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYINGANVLPHKSITDSVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. UniProt/SwissProt
Match: sp|Q9Y5P6|GMPPB_HUMAN (Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens OX=9606 GN=GMPPB PE=1 SV=2)

HSP 1 Score: 415.231 bits (1066), Expect = 3.471e-143
Identity = 194/361 (53.74%), Postives = 259/361 (71.75%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLSTPKPLV FCN+PILLHQ++AL    V  +ILA+    + LE  +      L +++  S+E  PLGTAGPLA A+  +  +  + FFVLNSD+IC++PF+ M++FH  HG EG++ + +VEEP+KYG VV E  T RI +F EKP  ++SNKINAG+YI + ++L RI+    SIE ++FP M  + +LY  E +GFWMDIGQP+D+L+GM L+L  L +    +L  G  I GNV++DP+A + +N  IGPNV LGPGV +++G  IR  T+L +  I SH W++S ++GW C VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I +SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSET-ADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEVFPIMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. UniProt/SwissProt
Match: sp|A2VD83|GMPBB_XENLA (Mannose-1-phosphate guanyltransferase beta-B OS=Xenopus laevis OX=8355 GN=gmppb-b PE=2 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 4.271e-143
Identity = 196/362 (54.14%), Postives = 267/362 (73.76%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFI-ENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLS PKPLV FCN+PILLHQ++ALV+  VT +ILA+      LE  + +    L +++  S+E  PLGTAGPLA A+  + ENS  E FFVLNSD+IC++PF+ M+ FH+ HG EGT+ + +VEEP+KYG V++E  + RI +F EKP  ++SNKIN+GLYIF+ ++L RI+    SIE +IFP M  + +L+  E +GFWMDIGQP+D+L+GM +YL  +   +  +L  G    GNV++DPTA + +N  IGPNV +GPGVT+++G RI+  +I+  + + SH W+ SS++GW+  VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I++SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSVPKPLVDFCNKPILLHQVEALVKAGVTHVILAVSYMSDMLEKEMKEQEKRLGIRISMSHEKEPLGTAGPLALARELLTENS--EPFFVLNSDVICDFPFEDMVRFHKHHGKEGTIVVTKVEEPSKYGVVIYEAESGRIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPVMAQEGQLFALELQGFWMDIGQPKDFLTGMCMYLQSVRHKHPERLHVGPGFTGNVLVDPTAKIGQNCSIGPNVTIGPGVTVEDGVRIKRCSIMKGSRLHSHSWLQSSIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKCISESVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. UniProt/SwissProt
Match: sp|Q8BTZ7|GMPPB_MOUSE (Mannose-1-phosphate guanyltransferase beta OS=Mus musculus OX=10090 GN=Gmppb PE=1 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 4.922e-143
Identity = 195/361 (54.02%), Postives = 260/361 (72.02%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLSTPKPLV FCN+PILLHQ++AL    V  +ILA+    + LE  +      L +++  S+E  PLGTAGPLA A+  +  +  + FFVLNSD+IC++PF+ M++FH  HG EG++ + +VEEP+KYG VV E  T RI +F EKP  ++SNKINAG+YI + ++L RI+    SIE +IFP M  + +LY  E +GFWMDIGQP+D+L+GM L+L  L + +  +L  G  I GNV++DP+A + +N  IGPNV LGPGV +++G  IR  T+L +  I SH W++S ++GW C VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I +SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQMLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSET-ADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLKPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. TrEMBL
Match: A0A3Q0KBC3 (Gdp-mannose pyrophosphorylase b, isoform 2 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.877e-155
Identity = 222/365 (60.82%), Postives = 270/365 (73.97%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACL----DVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALILIGG+GTRLRPLTLS PKPLV+F N+P+LLHQIKAL+E+++TEIILA+      LE SI + C  +    +VK+ FSYE   L T GPLAQA PF+     E FFVLNSDIICNYPFK+MLEFH +HG EGTMA+ +VEEP+KYGAVV    T  + +F EKP EY++N+INAGLYIF  +IL RIE   +SIE  +FP MV DSELYC EF GFWMDIGQP DYL+GMRLYLG+L+E  S  L    N+ GNV++  TA +     IGPNV +G GV I++G RI NS I S ++I+SH W+++ ++GW   VG WVRMEN+TVLGEDV V  ELFLNGALVLPH  I+ SV EP  I+
Sbjct:    1 MKALILIGGYGTRLRPLTLSIPKPLVEFANKPMLLHQIKALLEVDITEIILAINREAEVLESSIRESCDKVVQNTNVKIVFSYEKEALDTGGPLAQAAPFLTG---ERFFVLNSDIICNYPFKRMLEFHLSHGKEGTMAVTKVEEPSKYGAVVHNDQTGLVKRFVEKPSEYVANRINAGLYIFEPTILKRIEAKPMSIETAVFPAMVRDSELYCIEFSGFWMDIGQPADYLTGMRLYLGHLYECKSPLLTVDPNLIGNVLVHETAKIGHGCRIGPNVTIGAGVIIEDGVRISNSAIFSKSIIKSHSWLNNCIVGWRSVVGKWVRMENVTVLGEDVSVKDELFLNGALVLPHNLISKSVSEPHIIM 362          
BLAST of Mannose-1-phosphate guanyltransferase vs. TrEMBL
Match: A0A095AWY2 (Mannose-1-phosphate guanyltransferase beta OS=Schistosoma haematobium OX=6185 GN=MS3_07584 PE=4 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 6.687e-155
Identity = 222/371 (59.84%), Postives = 268/371 (72.24%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKIC----------ACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALILIGG+GTRLRPLTLS PKPLV+F N+P+LLHQIKAL+E+++TEIILA+      LE SI + C            + VK+ FSYE   L T GPLAQA PF+     E FFVLNSDIICNYPFK+MLEFH +HG EGTMA+ +VEEP+KYGAVV    T  + +F EKP EY++N+INAGLYIF  +IL RIE   +SIE  +FP MV DSELYC EF GFWMDIGQP DYL+GMRLYLG+L+E  S  L    N+ GNV +  TA +     IGPNV +G GV I++G RI NS I S ++I+SH W+++ ++GW   VG WVRMEN+TVLGEDV V  ELFLNGALVLPH  I+ SV EP  I+
Sbjct:    1 MKALILIGGYGTRLRPLTLSIPKPLVEFANKPMLLHQIKALLEVDITEIILAINREAEVLESSIRESCDKVSVNHCALVFVSVKIVFSYEKEALDTGGPLAQAAPFLAG---ERFFVLNSDIICNYPFKRMLEFHLSHGKEGTMAVTKVEEPSKYGAVVHNDQTGLVKRFVEKPSEYVANRINAGLYIFEPTILKRIEAKPMSIETAVFPAMVRDSELYCIEFSGFWMDIGQPADYLTGMRLYLGHLYECKSPLLTVDPNLIGNVFVHETAKIGHGCRIGPNVTIGAGVIIEDGVRISNSAIFSKSIIKSHSWLNNCIVGWRSVVGKWVRMENVTVLGEDVTVKDELFLNGALVLPHNSISQSVSEPHIIM 368          
BLAST of Mannose-1-phosphate guanyltransferase vs. TrEMBL
Match: A0A4S2MEJ4 (NTP_transferase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001883 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 2.661e-152
Identity = 213/365 (58.36%), Postives = 268/365 (73.42%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACL----DVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALILIGG+GTRLRPLTLS PKP+V+FCN P+LLHQ++AL+++ + EIILA+      LE  I   C  +    DVKL FSYE   L TAGPLAQA P++  S+ E FFVLNSDIICNYPFK+ML+FH  HGHEGTMA+ +VEEP+KYGAVV    T  +  F EKP EY++N+INAGLYIF  SIL R++   +SIE  +FP MV D ELYC EFKGFWMDIGQP DYL G+RLYL +L E  S  L    ++ GNV++DPTA + ++  IGPNV +G  V I++G RI NS I S +++ SH W+++ ++GW   VG WVR+EN+TVLGE+V+V  E+FLNGALVLPH  I+ SV EP  I+
Sbjct:    1 MKALILIGGYGTRLRPLTLSIPKPIVEFCNRPMLLHQVEALLQVEIDEIILAINRQAASLEPFIRDSCKSVLRERDVKLTFSYEDDALDTAGPLAQAAPYLLASE-ESFFVLNSDIICNYPFKEMLDFHLLHGHEGTMAVTKVEEPSKYGAVVHNDQTGLVKFFVEKPSEYVANRINAGLYIFRPSILRRVQNKPMSIETSVFPAMVQDGELYCMEFKGFWMDIGQPADYLEGVRLYLAHLSEQKSPALKTLPDLLGNVLVDPTAKIGKDCRIGPNVTIGAHVVIEDGVRISNSAIFSKSVVRSHAWLNNCIVGWRSTVGRWVRIENMTVLGENVRVKDEIFLNGALVLPHNAISQSVTEPHIIM 364          
BLAST of Mannose-1-phosphate guanyltransferase vs. TrEMBL
Match: A0A0X3NSR0 (Mannose-1-phosphate guanyltransferase beta OS=Schistocephalus solidus OX=70667 GN=GMPPB PE=4 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 3.876e-152
Identity = 210/367 (57.22%), Postives = 277/367 (75.48%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICAC----LDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENN--STKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALILIGG+GTRLRPLTLS  KPLV+FCN P+L+HQI+ALV + + EIILA+     C+EDSI  +C        V L FSYE   LGTAGPLAQA P+++N   E FFVLNSDIICNYPF++ML+FH +HG EGTMA+ +VEEP+++GAVV+   +  + +F EKP ++++NK+NAGLYIFN S+L+RIE    SIE++IFP+MV D +LYC EF GFWMDIG+PED++ GMRLYL +L+E+    +       + GNV+I P+A + EN  +GPNV +G GV I+ G RIR+S IL++ ++ SH WID  ++GW   VG WVRMEN+TVLGEDV+VN E+ LNGALVLPH  I++SV++P+ I+
Sbjct:    1 MKALILIGGYGTRLRPLTLSILKPLVEFCNRPMLVHQIEALVSVGINEIILAIHREAECIEDSIRSLCESSFRGHSVALHFSYEDEHLGTAGPLAQAAPWLKNLT-EPFFVLNSDIICNYPFQRMLDFHNSHGKEGTMAVTKVEEPSRFGAVVYNDHSGGVLRFVEKPCDFVANKVNAGLYIFNSSVLNRIELRPTSIEVEIFPRMVEDGQLYCIEFSGFWMDIGRPEDFIQGMRLYLSHLYESKLLMSSCPPRSKLLGNVLIHPSAKIGENCCLGPNVTIGSGVIIENGVRIRHSAILNDAVVRSHAWIDHCIVGWRSVVGRWVRMENVTVLGEDVQVNDEVALNGALVLPHNSISESVFDPQVIM 366          
BLAST of Mannose-1-phosphate guanyltransferase vs. TrEMBL
Match: A0A4E0R4B8 (GDP-mannose pyrophosphorylase OS=Fasciola hepatica OX=6192 GN=D915_006766 PE=4 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 1.631e-151
Identity = 211/365 (57.81%), Postives = 267/365 (73.15%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACL----DVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKA+ILIGG+GTRLRPLTLS PKP+V+FCN P+LLHQ++AL++I+V EIILA+      LE  I + C  +    DVK+ FSYE   L TAGPLAQA  +++ SD E F VLNSDIIC YPFK+M+EFH +HGHEGTM + +VEEP+KYGAVV    T  +  F EKP EY++N++NAGLY+F  SILSRI+    SIE  IFP MV++ ELYC E +GFWMD+GQP DYL+GMRLYL +L+E  +        + GNV++DPTA V     IGPNV +G  V I++G RI+NS I S ++I SH W+++ ++GW   VG WVRMEN TVLGE+V+V  ELFLNGALVLPH  I+DSV EP  I+
Sbjct:    1 MKAVILIGGYGTRLRPLTLSIPKPIVEFCNRPMLLHQVEALMQIDVDEIILAINRQAAALEPFIKESCKSVIRDKDVKITFSYEDEALDTAGPLAQAAEYLD-SDNESFLVLNSDIICRYPFKKMIEFHLSHGHEGTMVVTKVEEPSKYGAVVHNDQTGLVKHFVEKPSEYIANRVNAGLYMFKPSILSRIQAKPTSIETSIFPAMVSEGELYCMELEGFWMDMGQPADYLTGMRLYLAHLYETKALNTDSQYGLIGNVLVDPTAKVGNGCRIGPNVTIGAHVVIEDGVRIQNSAIFSKSVIRSHAWLNNCIVGWRSTVGRWVRMENTTVLGENVRVKDELFLNGALVLPHNAISDSVTEPHIIM 364          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Cavefish
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:103040139])

HSP 1 Score: 416.387 bits (1069), Expect = 1.174e-144
Identity = 198/361 (54.85%), Postives = 263/361 (72.85%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLS PKPLV+FCN+PILLHQ++ALV+  V  +ILA+      LE  +      L +K+  S+E  PLGTAGPLA A+  + +++ E FFVLNSD+IC++PF+ ML+FH+ HG EGT+ + +VEEP+KYG VV+E  + RI +F EKP  ++SNKINAG+YIF+ S+L RI+    SIE +IFP M  +  LY  E +GFWMDIGQP+D+L+GM +YL  + +    +L  G    GNV++DPTA + EN  IGPNV +G GV +++G RI+  T+L    I SH W++S ++GW+  VG WVRMEN+TVLGEDV VN EL++NGA VLPHK ITDSV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSVPKPLVEFCNKPILLHQVEALVKAGVRHVILAVSYMSDLLEREMKAQEQRLGIKISLSHEEEPLGTAGPLALARELLTDNE-EPFFVLNSDVICDFPFQDMLKFHKNHGKEGTIVVTKVEEPSKYGVVVYEGESGRIHRFVEKPQVFVSNKINAGMYIFSPSMLRRIQLRPTSIEKEIFPVMAEEGHLYAMELQGFWMDIGQPKDFLTGMCMYLQSVRQQAPERLRTGPGFLGNVLVDPTAVIGENCTIGPNVTIGAGVVLEDGVRIKRCTVLKGAHIRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYINGANVLPHKSITDSVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Cavefish
Match: gmppab (mannose-1-phosphate guanyltransferase alpha-B [Source:NCBI gene;Acc:103030670])

HSP 1 Score: 185.267 bits (469), Expect = 7.489e-54
Identity = 119/415 (28.67%), Postives = 192/415 (46.27%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEI-NVTEIIL-AMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEA--HGHEGTM--AIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETT---------------------RLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLV-----KGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P++ H I+A  ++ ++ EIIL    +    L   +        + +++  E   LGT G +   +  I +     FF++N+D+   +P + ML FH+     H G +       ++   YG +V    T  +  F EKP  ++S+ IN G+Y+F   I   I T                       + +E DIF  + A  +LY  + + FW  I      +   RLYL    + +  +L      +G  I G+V I PTA++   +++GPNV +G GVTI  G R+R   +L    ++ HC + +S++GW   +G W R+E                            +IT+LG +V + SE+ +  ++VLPHKD+  S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMVQHHIEACAKVPDMKEIILIGFYQPNEELNRFLASAQQEFKISIRYLQEFAALGTGGGIYHFRDQILSGGPSAFFLMNADVCSEFPLQDMLRFHQQLQGSHCGIILGTTANRKQSLNYGCIVENQKTNEVLHFVEKPSTFVSDIINCGVYLFTPEIFGHIGTVFQRNQEERLQDDPPCGRLMPEAIRLEKDIFTALAAQKQLYVYKTQHFWSQIKSAGSAIYASRLYLNRYHQTHPERLATNQEEEGPKIIGDVYIHPTANIDSTAVLGPNVSIGTGVTIGAGVRVRECIVLHGATLQDHCCVLNSIVGWESTIGKWARVEGTPSDPNPNDPYAKIDSETLFRDGGLTPSITILGCNVNIPSEVIIRNSIVLPHKDLNRS 416          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Cavefish
Match: gmppaa (mannose-1-phosphate guanyltransferase alpha-A [Source:NCBI gene;Acc:111197341])

HSP 1 Score: 184.111 bits (466), Expect = 1.883e-53
Identity = 122/414 (29.47%), Postives = 188/414 (45.41%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSY--ESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV----EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRI---------------------ETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILI G   GTR RPL+   PKPL      P+L H I+A  ++   + IL +G      E +     A  D K+   Y  E   LGT G +   +  I +   E FFVLN+D+   +P   ML+F + HG   +  I       ++   YG +V    +  +  + EKP  ++S+ IN G+Y+F   I   I                         + +E DIF  +    +LY  +   FW  I      +   RLYL    + +  +L +    G  I GNV + PTA++   +++GPNV +G GVTI  G R+R S IL    ++ H  + +S++GW   +G W R+E                            +IT+LG +V + SE+ +  ++VLPHKD+  S
Sbjct:    2 LKAVILIRGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACAQVPNMKEILLVGFYQPNEELNRFLSAAQQDFKVSIRYLQEYAALGTGGGIYHFRDQILSGSPEAFFVLNADVCSEFPLMDMLKFQKEHGDAHSFIILGTTANRKQSLNYGCIVENEQSCEVLHYVEKPSTFVSDIINCGIYLFTPEIFQHIGGVFQKNQQDLMLDEQSNGWQRAEAIRLEQDIFTALAGQGKLYVYKTDRFWSQIKSAGSAIYASRLYLNQYHKTHPERLAENKEGGPKICGNVYVHPTANIDPTAVLGPNVSIGTGVTIGAGVRVRESIILHGATLQDHSCVLNSIVGWESTIGKWARVEGTPSDPNPNDPYSKIDSETLFRDGKLTPSITILGCNVTIPSEVIILNSIVLPHKDLNRS 415          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Cavefish
Match: gmppaa (mannose-1-phosphate guanyltransferase alpha-A [Source:NCBI gene;Acc:111197341])

HSP 1 Score: 184.111 bits (466), Expect = 2.299e-53
Identity = 122/414 (29.47%), Postives = 188/414 (45.41%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSY--ESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV----EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRI---------------------ETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILI G   GTR RPL+   PKPL      P+L H I+A  ++   + IL +G      E +     A  D K+   Y  E   LGT G +   +  I +   E FFVLN+D+   +P   ML+F + HG   +  I       ++   YG +V    +  +  + EKP  ++S+ IN G+Y+F   I   I                         + +E DIF  +    +LY  +   FW  I      +   RLYL    + +  +L +    G  I GNV + PTA++   +++GPNV +G GVTI  G R+R S IL    ++ H  + +S++GW   +G W R+E                            +IT+LG +V + SE+ +  ++VLPHKD+  S
Sbjct:    2 LKAVILIRGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACAQVPNMKEILLVGFYQPNEELNRFLSAAQQDFKVSVRYLQEYAALGTGGGIYHFRDQILSGSPEAFFVLNADVCSEFPLMDMLKFQKEHGDAHSFIILGTTANRKQSLNYGCIVENEQSCEVLHYVEKPSTFVSDIINCGIYLFTPEIFQHIGGVFQKNQQDLMLDEQSNGWQRAEAIRLEQDIFTALAGQGKLYVYKTDRFWSQIKSAGSAIYASRLYLNQYHKTHPERLAENKEGGPKICGNVYVHPTANIDPTAVLGPNVSIGTGVTIGAGVRVRESIILHGATLQDHSCVLNSIVGWESTIGKWARVEGTPSDPNPNDPYSKIDSETLFRDGKLTPSITILGCNVTIPSEVIILNSIVLPHKDLNRS 415          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Cavefish
Match: gmppaa (mannose-1-phosphate guanyltransferase alpha-A [Source:NCBI gene;Acc:111197341])

HSP 1 Score: 182.57 bits (462), Expect = 1.072e-52
Identity = 122/419 (29.12%), Postives = 188/419 (44.87%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSY--ESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV----EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRI--------------------------ETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILI G   GTR RPL+   PKPL      P+L H I+A  ++   + IL +G      E +     A  D K+   Y  E   LGT G +   +  I +   E FFVLN+D+   +P   ML+F + HG   +  I       ++   YG +V    +  +  + EKP  ++S+ IN G+Y+F   I   I                              + +E DIF  +    +LY  +   FW  I      +   RLYL    + +  +L +    G  I GNV + PTA++   +++GPNV +G GVTI  G R+R S IL    ++ H  + +S++GW   +G W R+E                            +IT+LG +V + SE+ +  ++VLPHKD+  S
Sbjct:    2 LKAVILIRGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACAQVPNMKEILLVGFYQPNEELNRFLSAAQQDFKVSVRYLQEYAALGTGGGIYHFRDQILSGSPEAFFVLNADVCSEFPLMDMLKFQKEHGDAHSFIILGTTANRKQSLNYGCIVENEQSCEVLHYVEKPSTFVSDIINCGIYLFTPEIFQHIGGVFQKNQQDLMLYPYDGDEQSNGWQRAEAIRLEQDIFTALAGQGKLYVYKTDRFWSQIKSAGSAIYASRLYLNQYHKTHPERLAENKEGGPKICGNVYVHPTANIDPTAVLGPNVSIGTGVTIGAGVRVRESIILHGATLQDHSCVLNSIVGWESTIGKWARVEGTPSDPNPNDPYSKIDSETLFRDGKLTPSITILGCNVTIPSEVIILNSIVLPHKDLNRS 420          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Sea Lamprey
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:445097])

HSP 1 Score: 378.252 bits (970), Expect = 2.602e-130
Identity = 198/361 (54.85%), Postives = 259/361 (71.75%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLS PKPLV FCN+PIL HQ++ALV+  V  +ILA+      LE  + +    L +++  S+E+ PLGTAGPLA A+  ++  D E FFVLNSD+IC +PF  M++FH+ +  EGT+ + +VEEP+KYG VV+     RI +F EKP  ++SNKINAG+YIF+  IL RI+    SIE +IFP M    ELY  E +GFWMDIGQP+D+L+GM LYL  +      +L     I GNV++DP+A + +N  IGPNVV+GPGV I++G RI+  T+L ++ I+SH W+DS LIGW+  VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I DSV EP+ I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSLPKPLVDFCNKPILFHQVEALVKAGVNHVILAVSYMSELLEKELKQEEKKLGIRISMSHETEPLGTAGPLALARDILK-EDNEPFFVLNSDVICEFPFADMIKFHKQNNREGTIVVTKVEEPSKYGVVVYNSEDGRIHRFVEKPQVFVSNKINAGMYIFSPRILDRIQLRPTSIEKEIFPAMAQAGELYALELQGFWMDIGQPKDFLTGMCLYLHAVRLKAPERLHHAPGILGNVLVDPSAKIGQNCRIGPNVVVGPGVVIEDGVRIQRCTVLRDSRIKSHSWLDSCLIGWSSVVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKAIADSVPEPKIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Sea Lamprey
Match: gmppab (GDP-mannose pyrophosphorylase Ab [Source:NCBI gene;Acc:393469])

HSP 1 Score: 179.104 bits (453), Expect = 3.936e-52
Identity = 124/417 (29.74%), Postives = 191/417 (45.80%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEI-NVTEIIL-AMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV--EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIF-------------------------NKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIK----GNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME-----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+L  PKPL      PI+ H I+A  ++ N+ E++L    +    L   I++      V +++  E   LGTAG L   +  I       FFVLN D+  ++P   ML   +A  H  T+       ++   YG +V    T  +  + EKP  ++S  IN G+Y+F                         N +  +R E  RL  E D+F  +     LY     GFW  I      +   RLYLG     +  +L +  + K    G+V I  TA+V   +++GPNV +G  V I  G R+R S IL  + ++ HC + +S++GW+  VG W R+E                             +IT+LG +V + +E+ +  ++VLPHK++  S
Sbjct:    2 IKAVILIGGPQKGTRFRPLSLDVPKPLFPVAGFPIIQHHIEACSQVPNLKEVLLIGFYQPSEVLSRFIVQAQQEFKVSIRYLQEYTGLGTAGGLYHFRDQILAGGPRAFFVLNGDVCADFPLVGMLGARDAAMHNFTVMCTNANRKQSLNYGCIVENTETHEVLHYVEKPSTFVSELINCGVYLFCPEIFQHIATVFQQNQQELLSEEVANGTSWARAEVVRL--EQDVFTALAGQRSLYTFHTDGFWSQIKSAGSAIYANRLYLGSYHNTHPERLSENGSGKPKVIGDVYIHSTANVDPTAVLGPNVTVGMDVVIGPGVRVRESIILQGSTLQDHCCVLNSIVGWDSVVGRWARVEGTPSDPNPNDPLAKMDSESLFNTDGRLNPSITILGCNVSIPAEVVILNSIVLPHKELQHS 416          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Sea Lamprey
Match: eif2b5 (eukaryotic translation initiation factor 2B, subunit 5 epsilon [Source:ZFIN;Acc:ZDB-GENE-030131-5364])

HSP 1 Score: 55.0694 bits (131), Expect = 1.879e-8
Identity = 75/325 (23.08%), Postives = 134/325 (41.23%), Query Frame = 2
Query:  320 VKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEG------TMAIYQVEEPAKYG-------AVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNK-SILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGM---------RLYLGYL---FENNSTKLVKGKNIKGNVM------IDPTASVHEN--SLIGPNVVLGPGVTIKEGSRIRNSTIL-SNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYE-PRTII 1186
            V++  S   R LG       AK  + +     F ++++D++CN   K  L+ H+            TM +++   P            V  +  T R+  +Q         KI   L+IF   S    +    L   I I    VA  EL+   F     D    +D++ G+         ++++  L   +   ++ L     +  +++        P A+ H +  +L   NV   PGV++  GS +   +++  +T I + C I  ++IG  C +GS VR+E+  VL +DV +   + + G+LV     I  +V   PR +I
Sbjct:  100 VRVLSSETFRSLGDVLRDVDAKTLVRSD----FLLVHADLVCNASLKSALQQHKQRRERERNVSVMTM-VFRECRPGHRARTRHDDVVVAADACTGRVLHYQRAA----PGKIRLPLHIFQGGSGEVEVRHDLLDCHISICSPQVA--ELFTDNF-----DYQTRDDFVRGILVNEEILGNQIHMVCLRDSYAARASSLYAYHAVSCDIVRRWPCPFTPEAAPHRDGYALARHNVYRAPGVSLGPGSLVEGDSVMGQDTTIGAGCHITRTVIGRRCSIGSNVRLED-AVLWDDVTIADGVVVCGSLVCSGASIRHNVRVLPRCVI 407          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Yeast
Match: PSA1 (GDP-mannose pyrophosphorylase (mannose-1-phosphate guanyltransferase); synthesizes GDP-mannose from GTP and mannose-1-phosphate in cell wall biosynthesis; required for normal cell wall structure [Source:SGD;Acc:S000002213])

HSP 1 Score: 370.933 bits (951), Expect = 1.212e-127
Identity = 176/355 (49.58%), Postives = 247/355 (69.58%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFR-ITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSV 1165
            MK LIL+GG+GTRLRPLTL+ PKPLV+F N P++LHQI+AL    VT+I+LA+      + +++ K      V + FS E+ PLGTAGPL  A+  ++  D   FFVLNSD+IC YPFK++ +FH+AHG +GT+   +V+EP+KYG +V + +T   I +F EKP E++ N+INAGLYI N  ++  IE    SIE + FP +V + +LY  + +GFWMD+GQP+D+LSG  LYL  L +    KL  G NI GN +IDPTA +   + IGP+VV+GP VTI +G RI  S +L N+ I++H  + S+++GWN  VG W R+E +TVLG+DV+V  E+++NG  VLPHK I+D+V
Sbjct:    1 MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVMVETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLK-KDNSPFFVLNSDVICEYPFKELADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRFVEKPKEFVGNRINAGLYILNPEVIDLIEMKPTSIEKETFPILVEEKQLYSFDLEGFWMDVGQPKDFLSGTVLYLNSLAKRQPKKLATGANIVGNALIDPTAKISSTAKIGPDVVIGPNVTIGDGVRITRSVVLCNSTIKNHSLVKSTIVGWNSTVGQWCRLEGVTVLGDDVEVKDEIYINGGKVLPHKSISDNV 354          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Yeast
Match: GCD6 (Catalytic epsilon subunit of the translation initiation factor eIF2B; eIF2B is the guanine-nucleotide exchange factor for eIF2; activity subsequently regulated by phosphorylated eIF2; first identified as a negative regulator of GCN4 expression; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000002619])

HSP 1 Score: 50.8322 bits (120), Expect = 2.451e-7
Identity = 75/300 (25.00%), Postives = 129/300 (43.00%), Query Frame = 2
Query:  416 FFVLNSDIICNYPFKQMLEFH-----EAHGHEGTMAIYQVE--------EPAKYGAVVFEPSTFRITKFQEKP----DEYLSNKINAGLY-------IFNKSILSRIE--TTRL-----------SIEIDIFPKMVADSEL-------YCTEFKGFWMDIGQPEDYLSG-------MRLYLGYLFENNSTKLVKGKNI--KGNVMIDPTASVHENSLIGP-----------NVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLN 1123
            F +++ D++ N  F +MLEFH     +   H  TM + +          EPA   A V + ST R   +Q+ P     E  S +I+  L        I N  I  RI+  T+ +           S+  D F K V  S++       Y T+     ++  Q  D +S          L L    +++ T   + ++I  + +V++  +  + + + IG            N V+G    I E  RI+NS I  + +I ++  ID SLI  N  +GS VR+ +  ++G +VK++  + L+
Sbjct:  132 FILVSGDVLTNIDFSKMLEFHKKMHLQDKDHISTMCLSKASTYPKTRTIEPA---AFVLDKSTSRCIYYQDLPLPSSREKTSIQIDPELLDNVDEFVIRNDLIDCRIDICTSHVPLIFQENFDYQSLRTD-FVKGVISSDILGKHIYAYLTDEYAVRVESWQTYDTISQDFLGRWCYPLVLDSNIQDDQTYSYESRHIYKEKDVVLAQSCKIGKCTAIGSGTKIGEGTKIENSVIGRNCQIGENIRIKNSFIWDDCIIGNNSIIDHSLIASNATLGSNVRLNDGCIIGFNVKIDDNMDLD 427          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Nematostella
Match: EDO45402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT58])

HSP 1 Score: 395.586 bits (1015), Expect = 6.422e-137
Identity = 189/361 (52.35%), Postives = 260/361 (72.02%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLS PKPLV+FCN+P+LLHQ++ALV+  V  IILA+      LE  + +    L +K+  S E  PLGTAGPLA A  ++  ++ E FFVLNSD+IC++PF++M+EFH+ HG EGT+ + +VEEP+KYG VV+   T  I +F EKP+ ++SNKINAG+YIFN SIL+RIE    SIE ++FP M  DS+L+  + +GFWMD+GQP+D+L+GM +YL  L + +   L +G  I GNV++ PT+ + ++  IGPNVV+GPGV +++G+ +    +L +  I SH WI SS+IGW   VG WVRME ++VLGEDV V  EL++NG  +LPHK I  S  EP+ I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSKPKPLVEFCNKPMLLHQVEALVQAGVKHIILAVSYRAELLEKEMKEQEQKLGIKITISQEKEPLGTAGPLALAHDYLTVNN-EPFFVLNSDVICDFPFREMVEFHKKHGKEGTIVVTKVEEPSKYGVVVYNSETGCIERFVEKPEVFVSNKINAGMYIFNPSILNRIEMRPTSIEKEVFPFMAKDSQLFAFDLQGFWMDVGQPKDFLTGMCMYLNSLRKKSPELLHEGPGIIGNVLVCPTSKIGDHCRIGPNVVIGPGVVVQDGACLSRCVVLKDATIRSHSWIQSSIIGWKSVVGQWVRMEGVSVLGEDVIVKDELYINGGRILPHKSIGASSPEPQIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Nematostella
Match: EDO44783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUP7])

HSP 1 Score: 188.348 bits (477), Expect = 1.897e-55
Identity = 118/411 (28.71%), Postives = 202/411 (49.15%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEI-NVTEIIL-AMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV--EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTR-------------------LSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIK----GNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME-----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
             K +ILIGG   GTR RPL+L  PKPL      PI+ H I+A  +I ++ E+IL    +S   L   I        +++++  E +PLGT G +   +  I   + +   V+N+DI C++PF+++LEFH+ H  + T+   +   ++   YG +V +  +  +  + EKP+ ++S+ IN G+YIF+ ++   +                       L +  D+   +    EL+  +   FW  I      +   R +L    +++  +L    + K    G+V + P+A V  ++++GPNV +G GV I  G+RIR S +L    ++ HC I  S+IGWNC VG W R+E                             +IT+LG +V + +E+ +  ++VLPHK+++ S
Sbjct:    2 FKVVILIGGPMKGTRFRPLSLELPKPLFPVAGFPIIHHHIEACKKIPDLKEVILIGFYQSSEPLSKFITSAQQEFGLQIRYLQEYQPLGTVGGIYHFRDQISFGNPDGLVVINADISCDFPFQELLEFHQQHPGKHTIMTTEANRKQAYNYGCLVEKEGSHEVVHYVEKPETFVSSLINCGVYIFSLTVFQTLSELMQHTYNIARDDHVGFVGPEVLRMGEDLLTHLAGTGELFAYKTDRFWTTIKSAGSAIYANRNFLNLYQQSHPKRLATNAHGKPMIIGDVYVHPSAVVDTSAVLGPNVSVGSGVVIGPGARIRESIVLDGAELKDHCCILYSIIGWNCTVGQWARIEGHRCDPNPNDQFARPDGESLFGTNGKLTPSITILGRNVSIPAEVVVLNSIVLPHKELSQS 412          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Nematostella
Match: EDO25546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW63])

HSP 1 Score: 78.9518 bits (193), Expect = 2.825e-16
Identity = 59/230 (25.65%), Postives = 108/230 (46.96%), Query Frame = 2
Query:  113 LILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRP-----LGTAGPLAQAK-PFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETT-RLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDY 781
             ++ GGFGTRL PLT + PKPL+K  + P+L   + + ++       +++      ++ +     +  +V + + YE  P          P +  K P I         ++N D++ N  ++++LEFHE +    TM + + E    YG +  E S  RIT   EKP       INAG+Y+ ++ ++  +    R+ +   +  KM     +       +W+DIG+ +D+
Sbjct:  122 FLMAGGFGTRLAPLTDTCPKPLLKVGDRPLLETLLLSFIKQGFVNFYISLHYKPEMIK-AHFGDGSKWNVNITYVYEESPLGTGGALGLLPKSMPKLPII---------MMNGDVLTNVNYQRLLEFHENNMAAATMCVREYEYQIPYGVIKGEGS--RITAMVEKPVHRFF--INAGIYVISQDVVRSVPPNHRIDLPSLLEEKMADRQNVMMFPIHEYWLDIGRMDDF 337          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Nematostella
Match: EDO40578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6S6])

HSP 1 Score: 50.0618 bits (118), Expect = 9.408e-7
Identity = 37/145 (25.52%), Postives = 68/145 (46.90%), Query Frame = 2
Query:  107 KALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRC-LEDSIIKICACLDVKLQFSYESRP----LGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEE 526
            +A+I+  G G+R+ P++   PK L+   N P++ + I  L +    EII+   E+    +  ++   C   + KL+F  ++ P    +GTA  L   K  IE        V++ D+I + P  ++ + H  +    T  +  V E
Sbjct:    5 QAVIMAAGSGSRMYPISEDIPKALLPVGNLPLIWYPINTLEKAGFEEIIVVTLEAEAAEVSHALTMYC---NPKLKFELKTIPDDIDMGTADSLRHIKDVIEKD----VIVISCDLITDLPLHRLADIHRTYDASVTALLAPVPE 142          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Nematostella
Match: EDO28292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6W5])

HSP 1 Score: 42.743 bits (99), Expect = 6.727e-6
Identity = 20/51 (39.22%), Postives = 32/51 (62.75%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIIL 256
            MK +IL GG G+RL P+TL   K L+   ++P++ + I  L+   V EI++
Sbjct:    1 MKGIILAGGSGSRLHPITLGVSKQLLPIYDKPMIYYPISVLMLAGVREILI 51          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Medaka
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:101163000])

HSP 1 Score: 421.009 bits (1081), Expect = 2.103e-146
Identity = 198/361 (54.85%), Postives = 266/361 (73.68%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GG+GTRLRPLTLS PKPLV+FCN+PILLHQ++ALV+  V  +ILA+      LE  +      L +++  S+E+ PLGTAGPLA A+  + N D E FFVLNSD+IC++PF+ +L+FH  HG EGT+ + +VEEP+KYG VVFE  + +I +F EKP  ++SNKINAG+YIFN S+LSRI+    SIE +IFP M  +S+LY  E +GFWMDIGQP+D+L+GM +YL  L ++   +L  G    GNV++DP+A + +N  IGPNV +G GV +++G RI+  T+L  + + SH W++S ++GW+  VG WVRMEN+TVLGEDV VN EL+LNGA VLPHK I +SV EPR I+
Sbjct:    1 MKALILVGGYGTRLRPLTLSVPKPLVEFCNKPILLHQVEALVKAGVNHVILAVSYMSELLEREMRVQEQRLGIRISLSHETEPLGTAGPLALARELL-NIDDEPFFVLNSDVICDFPFQDLLQFHRNHGKEGTIVVTRVEEPSKYGVVVFEAESGKIHRFVEKPQVFVSNKINAGMYIFNPSMLSRIQLRPTSIEKEIFPVMAEESQLYAMELQGFWMDIGQPKDFLTGMCMYLQSLRQHAPDRLHTGPGFLGNVLVDPSAQIGQNCTIGPNVTIGAGVVVEDGVRIKRCTVLKGSRVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSINESVPEPRIIM 360          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Medaka
Match: gmppb (GDP-mannose pyrophosphorylase B [Source:NCBI gene;Acc:101163000])

HSP 1 Score: 353.599 bits (906), Expect = 1.345e-119
Identity = 167/329 (50.76%), Postives = 232/329 (70.52%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKG------FWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMEN 1072
            MKALIL+GG+GTRLRPLTLS PKPLV+FCN+PILLHQ++ALV+  V  +ILA+      LE  +      L +++  S+E+ PLGTAGPLA A+  + N D E FFVLNSD+IC++PF+ +L+FH  HG EGT+ + +VEEP+KYG VVFE  + +I +F EKP  ++SNKINAG+YIFN S+LSRI+    SIE +IFP M  +S+LY  E +       FWMDIGQP+D+L+GM +YL  L ++   +L  G    GNV++DP+A + +N  IGPNV +G GV +++G RI+  T+L  + + SH W++S ++GW+  VG WV  E+
Sbjct:    1 MKALILVGGYGTRLRPLTLSVPKPLVEFCNKPILLHQVEALVKAGVNHVILAVSYMSELLEREMRVQEQRLGIRISLSHETEPLGTAGPLALARELL-NIDDEPFFVLNSDVICDFPFQDLLQFHRNHGKEGTIVVTRVEEPSKYGVVVFEAESGKIHRFVEKPQVFVSNKINAGMYIFNPSMLSRIQLRPTSIEKEIFPVMAEESQLYAMELQAHASVRRFWMDIGQPKDFLTGMCMYLQSLRQHAPDRLHTGPGFLGNVLVDPSAQIGQNCTIGPNVTIGAGVVVEDGVRIKRCTVLKGSRVRSHSWLESCIVGWSSSVGQWVSTES 328          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Medaka
Match: gmppaa (GDP-mannose pyrophosphorylase A [Source:NCBI gene;Acc:101154855])

HSP 1 Score: 198.749 bits (504), Expect = 6.806e-59
Identity = 128/416 (30.77%), Postives = 196/416 (47.12%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEI-NVTEIIL-AMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV----EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILS-----------------------RIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P+L H I+A V++ N+ EI+L    +    L   +        + +++  E   LGT G +   +  I +   E FFVLN+D+   +P  +ML F + HG  G+  I       ++   YG +V +  T  +  + EKP  ++S+ IN G+Y+F+  I                         R E  RL  E DIF  +    +LY  +  GFW  I      +   RLYL      +  +L      G  I GNV I PTA++   +++GPNV +G GV+I  G R+R S IL    ++ HC + +S++GW+  +G W R+E                            +IT+LG +V + SE+ +  ++VLPHKD+  S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACVKVPNLKEILLIGFYQPNEELNRFLFSAQQEFKISIRYLQEYAALGTGGGIYHFRDQIVSGSPEAFFVLNADVCSAFPLAEMLRFQKEHGDPGSSVILGTTANRKQSMNYGCIVAKEETSEVLHYVEKPSTFVSDIINCGIYLFHPEIFQHIGAVFQKNQQDMLLEEPTNGWHRAEVIRL--EQDIFTALAGQGKLYVYKTLGFWSQIKSAGSAIYASRLYLDQYHITHPERLASNKAGGPKISGNVYIHPTANIDPTAVLGPNVSIGTGVSIGAGVRVRESIILHGATLQDHCCVLNSIVGWDSTIGKWSRVEGSPSDPNPNDPFAKMDSETLFRDGKLTPSITILGCNVSIPSEVIVLNSIVLPHKDLNRS 415          
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Medaka
Match: gmppaa (GDP-mannose pyrophosphorylase A [Source:NCBI gene;Acc:101154855])

HSP 1 Score: 196.438 bits (498), Expect = 4.819e-58
Identity = 128/421 (30.40%), Postives = 196/421 (46.56%), Query Frame = 2
Query:  104 MKALILIGG--FGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEI-NVTEIIL-AMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQV----EEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILS----------------------------RIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVK----GKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDS 1162
            +KA+ILIGG   GTR RPL+   PKPL      P+L H I+A V++ N+ EI+L    +    L   +        + +++  E   LGT G +   +  I +   E FFVLN+D+   +P  +ML F + HG  G+  I       ++   YG +V +  T  +  + EKP  ++S+ IN G+Y+F+  I                              R E  RL  E DIF  +    +LY  +  GFW  I      +   RLYL      +  +L      G  I GNV I PTA++   +++GPNV +G GV+I  G R+R S IL    ++ HC + +S++GW+  +G W R+E                            +IT+LG +V + SE+ +  ++VLPHKD+  S
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACVKVPNLKEILLIGFYQPNEELNRFLFSAQQEFKISIRYLQEYAALGTGGGIYHFRDQIVSGSPEAFFVLNADVCSAFPLAEMLRFQKEHGDPGSSVILGTTANRKQSMNYGCIVAKEETSEVLHYVEKPSTFVSDIINCGIYLFHPEIFQHIGAVFQKNQQDMLLFPFDGEEPTNGWHRAEVIRL--EQDIFTALAGQGKLYVYKTLGFWSQIKSAGSAIYASRLYLDQYHITHPERLASNKAGGPKISGNVYIHPTANIDPTAVLGPNVSIGTGVSIGAGVRVRESIILHGATLQDHCCVLNSIVGWDSTIGKWSRVEGSPSDPNPNDPFAKMDSETLFRDGKLTPSITILGCNVSIPSEVIVLNSIVLPHKDLNRS 420          
BLAST of Mannose-1-phosphate guanyltransferase vs. Planmine SMEST
Match: SMESG000069929.1 (SMESG000069929.1)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII
Sbjct:    1 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 361          
BLAST of Mannose-1-phosphate guanyltransferase vs. Planmine SMEST
Match: SMESG000056500.1 (SMESG000056500.1)

HSP 1 Score: 424.861 bits (1091), Expect = 5.068e-148
Identity = 208/364 (57.14%), Postives = 268/364 (73.63%), Query Frame = 2
Query:  104 MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEIILAMGESG--RCLEDSIIKICA-CLDVKLQFSYESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDITDSVYEPRTII 1186
            MKALIL+GGFGTRLRPLTL+ PKP+V+FCN+P+LLHQI+ALVE  V  IILA+  S     L +S +KI    L + + FSYE +P+GT GP+A AK ++ + D   FFVLNSD+ICN+PFK+M+ FH  HG EGT+ + +V EP+KYG V++      + +F EKP E++SNKINAGLY+FN+SIL RI    +SIE + FP+M AD ELYCTE +GFWMDIGQP+D+L+GM  YL  L E NST    G     NV++DPTA + EN  IGPNVV+GP V +K G RI+ STIL N++I  H WIDSS+IGW C +G W R+EN+TVLGEDV+V  EL++NG  VLPHK I++SV EP+ I+
Sbjct:    1 MKALILVGGFGTRLRPLTLTLPKPIVEFCNKPMLLHQIEALVEAGVCHIILAVSRSADRTDLLESELKIHEERLHITISFSYEYQPMGTGGPIALAKQYLSD-DNSPFFVLNSDVICNFPFKEMIAFHLKHGKEGTIVVTKVSEPSKYGVVIYNKDGL-VDRFVEKPQEFVSNKINAGLYLFNESILKRIPLKNVSIEKETFPEMAADHELYCTELEGFWMDIGQPKDFLTGMCFYLENLKEKNSTVFKTGLGYLNNVLVDPTAVIGENCEIGPNVVIGPHVIVKNGVRIKRSTILGNSVINDHSWIDSSIIGWKCTIGRWARIENVTVLGEDVQVKDELYVNGGRVLPHKSISESVLEPQIIM 362          
BLAST of Mannose-1-phosphate guanyltransferase vs. Planmine SMEST
Match: SMESG000016171.1 (SMESG000016171.1)

HSP 1 Score: 145.206 bits (365), Expect = 8.305e-39
Identity = 111/401 (27.68%), Postives = 180/401 (44.89%), Query Frame = 2
Query:  143 LRPL-TLSTPKPLVKFCNEPILLHQIKALVEIN-VTEIILAMGESGRCLEDSIIKICACLDVKLQFSY--ESRPLGTAGPLAQAKPFIENSDCEWFFVLNSDIICNYPFKQMLEFH---EAHGHEGTMAIYQVEEPA-KYGAVVFEPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLS-------------------IEIDIFPKMVADSELYCTEFKGFWMDIGQPEDYLSGMR--LYLGYLFENN--STKLVKGKNIKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIESHCWIDSSLIGWNCEVGSWVRME-----------------------------NITVLGEDVKVNSELFLNGALVLPHKDITDSV 1165
             RPL +L  P+PL      PIL H I+   ++  + EIIL +G   +  + S +   A L  K+Q  Y  E  PLGTAG L   +  I++ + ++FFV+NSD+   +   QML +H   +A  H   M      + +  YG +V +  T  I  + EKP  ++S  IN G+Y+F  +I + +    L                    +E ++F  +    +LY   F  FW  I      +   R  L L +    N  S     G    G+V I P+ ++  +++IGPNV +    ++  G R+R   IL    I     + +++IGWN  +G W R+E                             +IT++G  V V SE+ +  ++VLPHK++ +S+
Sbjct:   31 FRPLLSLELPQPLFPIAGFPILYHHIETCCKLKGIVEIIL-IGFYHQDEQLSQLIYEAKLKFKIQIRYLQEFTPLGTAGGLYHFRDQIQSGNPDYFFVINSDVCGAFNLNQMLNYHLKLKARDHFSIMTTEATRQQSINYGCIVHDKETNEILHYVEKPSTFVSTTINCGVYLFCPAIFTFLRIAFLKHQEENYSFDILRQCNESICMEKEVFQVLAGSGKLYMFPFSNFWSQIKSVGALIYSNRHMLQLYHTIHPNRLSISAPGGPRFIGDVYIHPSVTIDPSAVIGPNVSISKHCSVGAGVRLRECIILQGVTIRDRACVLNAVIGWNVVIGEWTRIEGTPNDPNPNKPFAKMDVIPLFNEKGQLNPSITLVGSYVDVPSEIVILNSIVLPHKELNESI 430          
The following BLAST results are available for this feature:
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GMPPB7.229e-14453.74GDP-mannose pyrophosphorylase B [Source:HGNC Symbo... [more]
GMPPB7.229e-14453.74GDP-mannose pyrophosphorylase B [Source:HGNC Symbo... [more]
GMPPB1.767e-13750.00GDP-mannose pyrophosphorylase B [Source:HGNC Symbo... [more]
GMPPA4.324e-5629.71GDP-mannose pyrophosphorylase A [Source:HGNC Symbo... [more]
GMPPA4.324e-5629.71GDP-mannose pyrophosphorylase A [Source:HGNC Symbo... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tag-3352.577e-13654.17Mannose-1-phosphate guanyltransferase beta [Sourc... [more]
tag-3352.577e-13654.17Mannose-1-phosphate guanyltransferase beta [Sourc... [more]
Y47D9A.12.153e-4929.85pep chromosome:WBcel235:I:4303930:4308244:1 gene:W... [more]
Y47D9A.12.689e-4629.21pep chromosome:WBcel235:I:4304041:4308244:1 gene:W... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG11292.937e-13954.44gene:FBgn0037279 transcript:FBtr0345174[more]
CG11292.937e-13954.44gene:FBgn0037279 transcript:FBtr0078870[more]
CG11292.937e-13954.44gene:FBgn0037279 transcript:FBtr0078871[more]
CG11292.937e-13954.44gene:FBgn0037279 transcript:FBtr0345175[more]
CG82071.088e-4826.51gene:FBgn0034035 transcript:FBtr0087342[more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gmppb3.425e-14454.02GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
gmppb5.774e-12249.71GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
gmppab5.369e-5630.05GDP-mannose pyrophosphorylase Ab [Source:NCBI gene... [more]
gmppaa2.345e-5530.29GDP-mannose pyrophosphorylase Aa [Source:NCBI gene... [more]
gmppaa1.330e-5429.93GDP-mannose pyrophosphorylase Aa [Source:NCBI gene... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gmppb2.379e-14354.14GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
gmppb2.732e-14354.14GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
gmppb6.722e-14254.14GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
gmppb2.630e-12149.14GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
zbtb7c3.361e-5628.95zinc finger and BTB domain containing 7C [Source:X... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gmppb7.036e-14454.02GDP-mannose pyrophosphorylase B [Source:MGI Symbol... [more]
Gmppb7.036e-14454.02GDP-mannose pyrophosphorylase B [Source:MGI Symbol... [more]
Gmppa3.603e-5729.95GDP-mannose pyrophosphorylase A [Source:MGI Symbol... [more]
Gmppa3.603e-5729.95GDP-mannose pyrophosphorylase A [Source:MGI Symbol... [more]
Gmppa1.653e-2531.44GDP-mannose pyrophosphorylase A [Source:MGI Symbol... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q68EY9|GMPBA_XENLA2.614e-14354.42Mannose-1-phosphate guanyltransferase beta-A OS=Xe... [more]
sp|Q6DBU5|GMPPB_DANRE3.216e-14354.02Mannose-1-phosphate guanyltransferase beta OS=Dani... [more]
sp|Q9Y5P6|GMPPB_HUMAN3.471e-14353.74Mannose-1-phosphate guanyltransferase beta OS=Homo... [more]
sp|A2VD83|GMPBB_XENLA4.271e-14354.14Mannose-1-phosphate guanyltransferase beta-B OS=Xe... [more]
sp|Q8BTZ7|GMPPB_MOUSE4.922e-14354.02Mannose-1-phosphate guanyltransferase beta OS=Mus ... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KBC31.877e-15560.82Gdp-mannose pyrophosphorylase b, isoform 2 OS=Schi... [more]
A0A095AWY26.687e-15559.84Mannose-1-phosphate guanyltransferase beta OS=Schi... [more]
A0A4S2MEJ42.661e-15258.36NTP_transferase domain-containing protein OS=Opist... [more]
A0A0X3NSR03.876e-15257.22Mannose-1-phosphate guanyltransferase beta OS=Schi... [more]
A0A4E0R4B81.631e-15157.81GDP-mannose pyrophosphorylase OS=Fasciola hepatica... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gmppb1.174e-14454.85GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
gmppab7.489e-5428.67mannose-1-phosphate guanyltransferase alpha-B [Sou... [more]
gmppaa1.883e-5329.47mannose-1-phosphate guanyltransferase alpha-A [Sou... [more]
gmppaa2.299e-5329.47mannose-1-phosphate guanyltransferase alpha-A [Sou... [more]
gmppaa1.072e-5229.12mannose-1-phosphate guanyltransferase alpha-A [Sou... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gmppb2.602e-13054.85GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
gmppab3.936e-5229.74GDP-mannose pyrophosphorylase Ab [Source:NCBI gene... [more]
eif2b51.879e-823.08eukaryotic translation initiation factor 2B, subun... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PSA11.212e-12749.58GDP-mannose pyrophosphorylase (mannose-1-phosphate... [more]
GCD62.451e-725.00Catalytic epsilon subunit of the translation initi... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454026.422e-13752.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447831.897e-5528.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255462.825e-1625.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO405789.408e-725.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282926.727e-639.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gmppb2.103e-14654.85GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
gmppb1.345e-11950.76GDP-mannose pyrophosphorylase B [Source:NCBI gene;... [more]
gmppaa6.806e-5930.77GDP-mannose pyrophosphorylase A [Source:NCBI gene;... [more]
gmppaa4.819e-5830.40GDP-mannose pyrophosphorylase A [Source:NCBI gene;... [more]
back to top
BLAST of Mannose-1-phosphate guanyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000069929.10.000e+0100.00SMESG000069929.1[more]
SMESG000056500.15.068e-14857.14SMESG000056500.1[more]
SMESG000016171.18.305e-3927.68SMESG000016171.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024129 ID=SMED30024129|Name=Mannose-1-phosphate guanyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1245bp
TAAAATGATGTTTATAATATATTAATATTGAATATTAATACTTTTTATTT
CAATTTTTTTTTAATTTTGAAATCTCGAGATTATATTACGAACTGCATTT
TAAATGAAAGCTCTTATATTAATTGGTGGATTTGGCACACGCCTAAGACC
ACTGACATTATCAACACCAAAACCGTTAGTAAAATTTTGCAATGAACCGA
TCTTACTGCATCAAATCAAAGCTTTGGTTGAAATTAATGTTACCGAAATT
ATTCTTGCAATGGGTGAATCAGGTCGATGTTTAGAGGATTCAATTATAAA
GATCTGTGCTTGCTTGGATGTCAAATTGCAATTTTCCTATGAATCAAGAC
CTTTAGGCACAGCGGGTCCGTTAGCTCAAGCTAAACCGTTTATTGAAAAC
AGCGACTGTGAATGGTTCTTCGTCTTAAACAGTGACATTATTTGTAATTA
TCCTTTCAAACAAATGCTAGAGTTTCATGAAGCGCACGGACACGAAGGCA
CAATGGCGATCTATCAAGTCGAGGAGCCAGCTAAATACGGCGCAGTAGTT
TTCGAGCCAAGTACTTTCCGAATAACCAAATTTCAAGAGAAACCAGATGA
ATATTTATCAAATAAAATAAATGCCGGGCTTTACATATTCAATAAATCTA
TTCTAAGCCGCATTGAAACAACAAGATTATCTATAGAAATCGATATTTTC
CCCAAAATGGTGGCAGATTCAGAATTATATTGCACAGAATTTAAGGGATT
CTGGATGGATATTGGTCAACCAGAAGACTATTTATCAGGCATGAGGCTCT
ATCTTGGTTATTTATTCGAGAATAATTCTACAAAGTTAGTGAAAGGCAAG
AATATAAAAGGAAATGTGATGATTGATCCAACAGCTTCAGTTCATGAGAA
TAGTCTCATCGGTCCGAATGTAGTGCTCGGTCCTGGAGTCACAATCAAAG
AAGGATCTAGAATACGCAATAGTACAATACTTTCCAATACCCTCATAGAA
TCACATTGTTGGATTGATTCTTCACTCATTGGTTGGAATTGCGAAGTCGG
ATCATGGGTGCGAATGGAAAACATAACCGTTCTGGGAGAAGATGTAAAAG
TTAATTCGGAATTATTTTTAAACGGAGCTTTAGTATTGCCTCACAAGGAT
ATAACCGATTCGGTTTATGAGCCTCGTACGATTATCTGATCTGAAATATT
TCGTTTTGTCTTTTGAATTTTTACAAATAAATTATTTTATTTTTA
back to top

protein sequence of SMED30024129-orf-1

>SMED30024129-orf-1 ID=SMED30024129-orf-1|Name=SMED30024129-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MKALILIGGFGTRLRPLTLSTPKPLVKFCNEPILLHQIKALVEINVTEII
LAMGESGRCLEDSIIKICACLDVKLQFSYESRPLGTAGPLAQAKPFIENS
DCEWFFVLNSDIICNYPFKQMLEFHEAHGHEGTMAIYQVEEPAKYGAVVF
EPSTFRITKFQEKPDEYLSNKINAGLYIFNKSILSRIETTRLSIEIDIFP
KMVADSELYCTEFKGFWMDIGQPEDYLSGMRLYLGYLFENNSTKLVKGKN
IKGNVMIDPTASVHENSLIGPNVVLGPGVTIKEGSRIRNSTILSNTLIES
HCWIDSSLIGWNCEVGSWVRMENITVLGEDVKVNSELFLNGALVLPHKDI
TDSVYEPRTII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004475mannose-1-phosphate guanylyltransferase activity
GO:0005525GTP binding
GO:0016779nucleotidyltransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0009298GDP-mannose biosynthetic process
GO:0009058biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR029044Nucleotide-diphossugar_trans
IPR001451Hexapep
IPR005835NTP_transferase_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.160.10.10coord: 238..361
e-value: 9.8E-18
score: 66.2
NoneNo IPR availablePANTHERPTHR22572SUGAR-1-PHOSPHATE GUANYL TRANSFERASEcoord: 1..361
NoneNo IPR availableCDDcd06425M1P_guanylylT_B_like_Ncoord: 1..234
e-value: 3.7811E-123
score: 352.283
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 1..233
e-value: 9.4E-66
score: 223.9
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 1..313
IPR005835Nucleotidyl transferase domainPFAMPF00483NTP_transferasecoord: 2..230
e-value: 1.2E-48
score: 165.9
IPR001451Hexapeptide repeatPFAMPF00132Hexapepcoord: 261..292
e-value: 9.9E-7
score: 28.3