Zinc finger MYM-type protein 1

Overview
NameZinc finger MYM-type protein 1
Smed IDSMED30024122
Length (bp)3977
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger MYM-type protein 1 (SMED30024122) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30024122) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger MYM-type protein 1 (SMED30024122) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30024122) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024122

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024122SMESG000032685.1 Contig6306newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024122SMESG000032685.1 Contig6306uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
reproductive organSMED30024122SMESG000032685.1 SMESG000002226.1 Contig43445newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024122SMESG000032685.1 SMESG000002226.1 Contig43445uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 140.969 bits (354), Expect = 5.799e-33
Identity = 167/662 (25.23%), Postives = 307/662 (46.37%), Query Frame = 1
Query: 1735 VFCFVCKLLTASNFN-----LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRK-SNYSVSDQLQ---KEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI---ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHE-NYENVMEALNAIIED----ANFYGNTR--NEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCS------SLYASLAS-----YITNLKNSFDEI--KIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLK--QHVNNVVEKYPDD---IDDSLFFELLQFHEYIRNDWPNDHP--NHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLS 3603
             FC+ C+L     F+      AT+G  +WK      + H+ S  H  +L  +   +  + +VSD L    K+I+  + Y + ++E ++     + ++ LP RG+++       GNF+ LLE+ AK      E   +  N  S    Y S  I  ++++++   +L+ I ++I  S  F +  D T + + K+QL + +RY  Q + K I   ERFL F++ E  TG +L   +++ + + IG++      Q+YD+  N+  K+  + A+  ++  +A+++ C AH L+L   S    C E       ++ + + F++       L  F N    S +KT     S+S   +H+    +V+++L  IIE     A+   NT   +E ++LL  + +FEF   + F  +VL     +SK LQ+   T+D+ S      ++   L+S     Y   + +  +EI  KI  K          KR++ +K     +        S +E ++ N++ + L+ I  NL     C+ E    F +    ++S+   K  + +N    K+  +   +D+ +  EL  +  Y + ++  D    N +S   +  +  L    P L  +L I L   I + + E SFS L  +K +L +TM Q+ L   AL++
Sbjct:  475 AFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSIHSKQIEGNKKYLKLIIENILF----LGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDK---GEETFRLMN--SQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRY-PQKSSKAILIKERFLGFVDTEEMTGTHLHR-TIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDL---SIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNK--TIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNL---KLCFSE----FDYCKIKQISELLFKWNEPLNETTAKHVQEFYKLDEDIIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMA 1113          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 140.969 bits (354), Expect = 5.799e-33
Identity = 167/662 (25.23%), Postives = 307/662 (46.37%), Query Frame = 1
Query: 1735 VFCFVCKLLTASNFN-----LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRK-SNYSVSDQLQ---KEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI---ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHE-NYENVMEALNAIIED----ANFYGNTR--NEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCS------SLYASLAS-----YITNLKNSFDEI--KIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLK--QHVNNVVEKYPDD---IDDSLFFELLQFHEYIRNDWPNDHP--NHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLS 3603
             FC+ C+L     F+      AT+G  +WK      + H+ S  H  +L  +   +  + +VSD L    K+I+  + Y + ++E ++     + ++ LP RG+++       GNF+ LLE+ AK      E   +  N  S    Y S  I  ++++++   +L+ I ++I  S  F +  D T + + K+QL + +RY  Q + K I   ERFL F++ E  TG +L   +++ + + IG++      Q+YD+  N+  K+  + A+  ++  +A+++ C AH L+L   S    C E       ++ + + F++       L  F N    S +KT     S+S   +H+    +V+++L  IIE     A+   NT   +E ++LL  + +FEF   + F  +VL     +SK LQ+   T+D+ S      ++   L+S     Y   + +  +EI  KI  K          KR++ +K     +        S +E ++ N++ + L+ I  NL     C+ E    F +    ++S+   K  + +N    K+  +   +D+ +  EL  +  Y + ++  D    N +S   +  +  L    P L  +L I L   I + + E SFS L  +K +L +TM Q+ L   AL++
Sbjct:  475 AFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSIHSKQIEGNKKYLKLIIENILF----LGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDK---GEETFRLMN--SQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRY-PQKSSKAILIKERFLGFVDTEEMTGTHLHR-TIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDL---SIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNK--TIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNL---KLCFSE----FDYCKIKQISELLFKWNEPLNETTAKHVQEFYKLDEDIIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMA 1113          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 140.969 bits (354), Expect = 5.799e-33
Identity = 167/662 (25.23%), Postives = 307/662 (46.37%), Query Frame = 1
Query: 1735 VFCFVCKLLTASNFN-----LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRK-SNYSVSDQLQ---KEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI---ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHE-NYENVMEALNAIIED----ANFYGNTR--NEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCS------SLYASLAS-----YITNLKNSFDEI--KIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLK--QHVNNVVEKYPDD---IDDSLFFELLQFHEYIRNDWPNDHP--NHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLS 3603
             FC+ C+L     F+      AT+G  +WK      + H+ S  H  +L  +   +  + +VSD L    K+I+  + Y + ++E ++     + ++ LP RG+++       GNF+ LLE+ AK      E   +  N  S    Y S  I  ++++++   +L+ I ++I  S  F +  D T + + K+QL + +RY  Q + K I   ERFL F++ E  TG +L   +++ + + IG++      Q+YD+  N+  K+  + A+  ++  +A+++ C AH L+L   S    C E       ++ + + F++       L  F N    S +KT     S+S   +H+    +V+++L  IIE     A+   NT   +E ++LL  + +FEF   + F  +VL     +SK LQ+   T+D+ S      ++   L+S     Y   + +  +EI  KI  K          KR++ +K     +        S +E ++ N++ + L+ I  NL     C+ E    F +    ++S+   K  + +N    K+  +   +D+ +  EL  +  Y + ++  D    N +S   +  +  L    P L  +L I L   I + + E SFS L  +K +L +TM Q+ L   AL++
Sbjct:  475 AFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSIHSKQIEGNKKYLKLIIENILF----LGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDK---GEETFRLMN--SQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRY-PQKSSKAILIKERFLGFVDTEEMTGTHLHR-TIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDL---SIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNK--TIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNL---KLCFSE----FDYCKIKQISELLFKWNEPLNETTAKHVQEFYKLDEDIIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMA 1113          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 140.969 bits (354), Expect = 5.799e-33
Identity = 167/662 (25.23%), Postives = 307/662 (46.37%), Query Frame = 1
Query: 1735 VFCFVCKLLTASNFN-----LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRK-SNYSVSDQLQ---KEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI---ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHE-NYENVMEALNAIIED----ANFYGNTR--NEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCS------SLYASLAS-----YITNLKNSFDEI--KIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLK--QHVNNVVEKYPDD---IDDSLFFELLQFHEYIRNDWPNDHP--NHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLS 3603
             FC+ C+L     F+      AT+G  +WK      + H+ S  H  +L  +   +  + +VSD L    K+I+  + Y + ++E ++     + ++ LP RG+++       GNF+ LLE+ AK      E   +  N  S    Y S  I  ++++++   +L+ I ++I  S  F +  D T + + K+QL + +RY  Q + K I   ERFL F++ E  TG +L   +++ + + IG++      Q+YD+  N+  K+  + A+  ++  +A+++ C AH L+L   S    C E       ++ + + F++       L  F N    S +KT     S+S   +H+    +V+++L  IIE     A+   NT   +E ++LL  + +FEF   + F  +VL     +SK LQ+   T+D+ S      ++   L+S     Y   + +  +EI  KI  K          KR++ +K     +        S +E ++ N++ + L+ I  NL     C+ E    F +    ++S+   K  + +N    K+  +   +D+ +  EL  +  Y + ++  D    N +S   +  +  L    P L  +L I L   I + + E SFS L  +K +L +TM Q+ L   AL++
Sbjct:  475 AFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSIHSKQIEGNKKYLKLIIENILF----LGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDK---GEETFRLMN--SQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRY-PQKSSKAILIKERFLGFVDTEEMTGTHLHR-TIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDL---SIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNK--TIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNL---KLCFSE----FDYCKIKQISELLFKWNEPLNETTAKHVQEFYKLDEDIIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMA 1113          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: THAP12 (THAP domain containing 12 [Source:HGNC Symbol;Acc:HGNC:9440])

HSP 1 Score: 119.398 bits (298), Expect = 1.254e-26
Identity = 145/599 (24.21%), Postives = 279/599 (46.58%), Query Frame = 1
Query: 1948 RKVLERVVAVICTIVERNLPFRG--SNEIF-GMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQI-NFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKL-----VEFSN-----RTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGN--TRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKI-------EAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQR-SDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDID--DSLFFELLQFHEYIRNDWPN---DHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQY 3657
            ++ L+ +  ++  + ++N+P  G  ++EI  G+    NF  LLE          E +RK     +  T + SKT   ++L++    + +    +++ S +F +  D   DI+ ++ L +++R+VD+  N +  E F+ F+  E    E LA        +  GLN + CR Q+Y  +   + K K + +++LEK  +AI+  CS+ +LN+           S+   G I+EV +FF  S +   +L     V F N     + +K +  ++W+ R ++ +++ E  + ++  L+ I  D N   N      A  L + + +F+F + ++    VL    A  KNLQ    T DV  +   SL + + +L    + I++       EA  L    D  +K      KF    Q   E +++++  ++  + +  +E+I   L    S+ +L+  K    + ++ + Q        +  + Y  D+   D+L  EL   H + R  W +   D     + YE +   +++  FPN+  +L++   L +     ER  +  K +K +LR+T++ +  +NLALL+ N D +K  D D +++ Y
Sbjct:  163 KEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSG---EEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLR--EEFIGFLPYEA-DAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMGVSVAL-GTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQ--TSDVFFA-AGSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMK---LPGKFRRAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSV-MGQLKFNTSEEHHADMYRSDLPNPDTLSAEL---HCW-RIKWKHRGKDIELPSTIYEALHLPDIKF-FPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFD-IKH-DLDLMVDTY 740          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 227.254 bits (578), Expect = 6.787e-61
Identity = 190/740 (25.68%), Postives = 344/740 (46.49%), Query Frame = 1
Query: 1639 VRYCSKTLFFDEKTNGEKYTREW------LVYSPKIGNVFCFVCKL-LTASNFN----LATNGLRDWKNAGSSIKSHQNSSEHRNALVTY-----LTRKSNYSVSDQLQKEIQQERIYWRK-VLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHI----RKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEF------SNRTV--KSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKL----------LPNTDYTVKRKRFKKKFPD---------EDQTTTEPEISAKENFRNNVFMKILENIENNLIQR--SDCYLEISKVFGFLTNIEL-------SQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKVL 3687
            V  C   + F +   G  + R W      L YSPK   ++CF C++ L    F       T G+  W++A   +K H ++  H  ++V +        ++ +  SD   K I++      + +L R++ +   +  +   FRG +E       GNFI L++ +A++D  +  H+     K  +    + S LS     +++  +   +   I ++IK+++ F + +D T D+SHK+Q+  ++RYV  +  K  ERFL    +E+ TG+ L ++ +   + D GL+ ++ R Q YD A NM+G YKG+++++   N+KA+++ C AH LNLV    A   I  + FF L++++Y F + ST+R    ++         R V  + LS TRW+ R  S+K +++  + +++ L  + E ++       +A   L  + +FEF L       V +     S  LQ   + L    ++   +   + NL+ S +E K   +K           +P       RKR   K P          +D  T +   + +E +R  V+   L+ I   L +R   D  +   K+     ++ +          +  Q +  +   Y  + +  L  EL  FH   ++          S   I+KE + +  FP L  +L+++  L ++  T ERSFSK++LIKN LRS  S++ L++L L++  I+K   +D   +IN +     R+ +L
Sbjct:  184 VGPCQPVMTFPKNAEGRSFQRSWYTDRPWLEYSPKNDAIYCFSCRIFLREEKFKNKTAWKTLGINTWRSATGKMKEHASTEAHMMSMVRWNIYSKKALQTAFDTSDIQGKAIRERERQRNREILTRLIDISLYLARQGQAFRGDDESSSSANQGNFIELVKTLAQYDSVMKLHLDAIQEKQASMKKPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVSFVVRYVRDMEVK--ERFLQVCTLESTTGKELENVVISLLQ-DNGLDLKNIRGQGYDGAANMSGMYKGLQSRIRAHNEKALYVHCQAHCLNLVLVESAKSSIHFVTFFSLVEKLYVFCTGSTKRHTAFLKCQQSLYPGQRVVELQKLSDTRWACRERSLKALNKVLKALIKLLTDLCE-SDPPETAAGDAKMYLRAI-DFEFLLCSEITTTVFQITGVASDALQKKDLDLSTAYTITDGVLDTVKNLR-SEEEFKTIFQKAVEKAEDVGIDIPTVPPGHGRKR---KVPTRYLHSATAAQDSHTFQ---TVEEFYRAKVYFTFLDTITEELGRRFKVDGTMPTGKILQSFQSLTVHDNWVGTPNTEAVQAIQTLCNFYSVEEEQQLKTELKVFHTTFKSS------GMKSMLSILKETSGQHVFPALVEMLKVYATLPVSTATVERSFSKMRLIKNQLRSLCSEERLSDLLLIA--IEKDIPVDHSEVINIFKHMAHRRVLL 903          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: thap12a (THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GENE-040426-2045])

HSP 1 Score: 93.9745 bits (232), Expect = 6.923e-19
Identity = 131/608 (21.55%), Postives = 274/608 (45.07%), Query Frame = 1
Query: 1948 RKVLERVVAVICTIVERNLPFRGSNEIFGMEGS---GNFIGLLEL-IAKFDPFLAEHIRKF-GNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGL------IQEVYNFFSSSTERWNKLV----------EFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAII--EDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKI-------EAKKLLPNTDYTVKRKR--FKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQR-SDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHL---SFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLAL--LSCNIDKLKAIDFDSLINQY 3657
            ++ L+ +  V+  +  +N+P  G ++      S    NF  LLE  I   D FL    +KF G+P +    + S T  +++L+++ K + + +  + K+ + F + VD+  +I  ++ + + +R+VD+ N    E F++F+  E         +  E  EK  GL+ + CR Q+Y  +   A K K M AK+ E +  A+  PCS+ SLN+       C   ++ F G+      ++++  FFS S    N+L           E     +K    ++W+ + ++ ++  +  E+++  ++++   ED  +     + A  +   + +FE+ + ++     L    A  KNLQ     +   S    SL + + +L   ++ I++       EA  L  + +  VK  R  F+K+       T+  EI  +  +++ V + ++ ++   L    S+ +L+  K    +  I + Q          V+ Y DD+ +   F   + H + +  W +   + +   + YE ++  +++  FPN+  +L++   L +   T ++  +  + +  +L+ T       ++AL  ++C I      D DS++  Y
Sbjct:  150 KEYLKSLFDVVVMMGTQNIPLHGHSDKEPRSKSFTPSNFQALLEYRINAGDEFLR---KKFEGSPVN--LEHCSSTQLQQILEVIEKCIREELLAEAKEGRCFSLVVDNLVEIEGENYVPLFVRFVDKANCLR-EEFVDFLLFEGDVEAITERLVTELTEK-CGLDMKYCRGQAYLCSGVSAMKVKAMVAKIAELHPLAVLTPCSSCSLNI-------CLANTMTFTGVHLVMSTLKKLDAFFSKSPLLQNQLESAISIYYQGNEEKANVLKEACGSKWTEQHDTFELAVDLLESLLLCMDSVHDNEDHKWSDEVAHNAFVISEALADFEYVMTLVVLKNTLSFTRAFGKNLQGETNEVFFAS---GSLTAVLHSLNEVYENIEVYHEFWFEEAVNLAASLEIPVKVPRLYFRKR------PTSGEEIQPETYYKDQVTIPVVSHVIKELSDLFSENHLKALKSLSLVPAI-MGQLKFNTTEETSVDIYKDDLLNPDTFP-AELHCW-KIKWKHGTKDVILPSTIYETLQLSDVKF-FPNVCALLKVLYNLPLFALTNDKCSTAKQRLMAYLQDTPVNHRNKSMALFYINCAIKH----DLDSMVETY 726          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: thap12b (THAP domain containing 12b [Source:ZFIN;Acc:ZDB-GENE-040718-429])

HSP 1 Score: 81.2629 bits (199), Expect = 5.210e-15
Identity = 132/617 (21.39%), Postives = 252/617 (40.84%), Query Frame = 1
Query: 1948 RKVLERVVAVICTIVERNLPFRGS---NEIFGME----GSGNFIGLLE-LIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNL-VGNSGADCCIESINFFGLIQEVYNFFSSS----TERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAII---------EDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYA--SLASYITNLKNSFDEIKI-------EAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIEN--------NLIQRSDCYLEISKVFGFL-------TNIELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQF-HEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQY 3657
            R+ L+    V+  I  ++ PF  +   +E+   E      GNF  LLE  I   D FL    R+F +    +  Y       +LLD+  K V + I   +++ ++F +      D    + L + +R+VDQ N    E F+ F+  E         +      K  GL+ + CR Q+Y  +  +  K K + A++ EK   A+  P S  +LN+ + N  +   ++ +    ++++   FF +S    TE  N +       ++  S  +  +RS     +H  +E  ++ L  ++         ED  +     ++A  +   + +FEF + ++     L    A  KNLQ    T+DV    +A  SL + + +L    D +++       EA  +    +  V+  R    F  + QT    EI A+  F+  +   ++E I          N ++   C   +  V G +       ++ ++ + DL          +PD +   L    +++ H       P+      + YE ++  +++  FPN+   L+I   L +    G    +  + ++ +L  T   +   NLA+L  NI+     D + ++  Y
Sbjct:  154 REFLKSSFEVMILIGRQSFPFSSNAREDEMRSREEWLFNPGNFQALLENRINAGDEFLR---RRFESAAVNE-EYCPAVQQRQLLDVCEKCVREEILQQVRECRFFSIVTGELVDFPEGEHLPIFLRFVDQDN-TLREEFIEFLSFEGEEVTVAERLESRLM-KGWGLSMEHCRGQAYAGSGILGTKMKVITAQLKEKYPMAVITPTSTCALNVHLANGMSLTGVQVV--MSVLKKSNAFFRASPLLQTELDNAISILCQGNLEKESILKEGSRSTWTD-LHNLFEMAVDLLEPLLLCMDSIHDNEDLKWSDQVTSDAYAISEALADFEFIVTLVILKNALSFTRAFGKNLQGE--TIDV---FFAANSLTAVLHSLHEVSDNLEVYHEFWFEEAVNMATAMEVPVRVPRL---FLRKQQTPDTIEIQAESFFKEYLTQPVMEYITQEVKDIFSENHLKALKCLSLVPAVMGQMRFNTSEESHADIYRTDL---------PHPDTLPAELHCWRIKWKHRGKEVSLPS------TIYETLQHSDVKF-FPNVNAFLKILATLPVLKLDGSHGETAQRRLQAYLTDTAVSQRCKNLAVL--NINYHIKTDLEEMVQCY 735          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: si:ch211-240b21.2 (si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526-125])

HSP 1 Score: 51.9878 bits (123), Expect = 1.353e-6
Identity = 34/89 (38.20%), Postives = 49/89 (55.06%), Query Frame = 1
Query: 3406 LSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKF 3672
            L   ++  E NLE  F    T+++I +   +     ER FS LK IK FLR++M+Q+ LN LA+LS  I+K    +     NQ  +EKF
Sbjct:  135 LDLLQLFMENNLEEVFSETVTLVKILVTTPMTTAEAERCFSTLKRIKTFLRNSMTQERLNALAMLS--IEKRLVTEMTDF-NQKVIEKF 220          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 405.216 bits (1040), Expect = 6.626e-125
Identity = 250/653 (38.28%), Postives = 381/653 (58.35%), Query Frame = 1
Query: 1780 LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQLQKEIQ-QERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNR---TVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKN-SFDEIKIEAKKL-----LPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLT-----NIELSQEDLKQHVNNVVEKYPDDIDDS-LFFELLQFHEYIRNDWPN-DHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKVL 3687
            LA  G  DWKNA   +  H+ S  H++  +    R       DQL  E Q QE  YWR VL+RVV  + T+  R LPFRG++E FG   +GN++ LLE IA+ DPFLAEHI+K+GN G+G TSYLSKT+  E +D++A +VL+ I ++ KQ+KY+ +SVDSTPD+SH DQL  II YV      P ERF+ FI    H  E L    ++   K+  ++  DCR QSYDNA NM+G Y G++A++ + N  A+++PCSAHSLNLVG S A+ C E+++FF ++Q++Y+FFS+S+ RW  L+    R    VK+LS TRWSARS++   I EN  N                ++ + A +LL ++ +F F   +  W+++L +++  ++ LQ+  +++   S +   L S    ++  S DEI   A+ +     +P T +  KRKR  K     +       +SA +NFR ++  +I + + ++L  +S   ++ S  F FL+       ELSQ  L++  +++  KY  D+D S L  E+  F   +    P+      L   ++I++ +L   +PN++T  RIFL   +   + +RSFSKLKLIKN+LRS+M Q+ L+NL++LS   +  + IDFD +I+ +A  K RK  L
Sbjct:   94 LAHEGYNDWKNASVRLNEHEESKFHKDCYLRMQNRAKISGRIDQLFLEKQNQEMEYWRNVLKRVVTAVKTLSSRGLPFRGTDEKFGSLTNGNYLMLLEAIAEHDPFLAEHIKKYGNTGTGSTSYLSKTVCFEFIDIVASSVLEVIINEAKQAKYYSISVDSTPDVSHTDQLAFIICYVKNDGI-PKERFIKFIPNVGHKAENLFSAVMDTL-KEYHIDILDCRGQSYDNASNMSGPYSGLQARIKQVNPLAVYIPCSAHSLNLVGTSAAESCREAVSFFCILQQLYHFFSASSTRWEMLISHLKRKATVVKNLSTTRWSARSDA--YIRENSSN---------------SDSVSTAQSLLLQV-DFHFLCTLFVWNKILSQVDRDNQALQAKSISILDASKIVNGLRSTFQEMRVISVDEIYFYARDVCEKLEIPAT-FPQKRKRKVKARASYESADEGASLSAGDNFRISL-NQIFDVLISDLTWKSKTLMDTSVDFEFLSCPALVTFELSQ--LQKAASDLALKYSKDLDASELCSEIESFRHQVEAILPDAKSATPLDLCQMIQDYSLADCYPNIDTAFRIFLTSPVTVASCKRSFSKLKLIKNYLRSSMEQERLSNLSILSIEHEMARKIDFDDVIDHFAAMKARKIAL 722          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: tbx18 (T-box 18 [Source:Xenbase;Acc:XB-GENE-489907])

HSP 1 Score: 149.443 bits (376), Expect = 1.493e-36
Identity = 140/570 (24.56%), Postives = 264/570 (46.32%), Query Frame = 1
Query: 1948 RKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLEL-IAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI---ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKKFP----DEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCY-LEISKVFGFLTN--IELSQEDLKQHVNNVVEKYPDDIDDS---LFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNID 3615
            RK L  V++ I      ++  RG         SGN   L +  I   D  L  H+         K + ++  + E   D++ + ++ + ++ +     F +  D + DIS  +QL + +R+VD +   P+   E FL F  ++      +A++ +E   K  GLN      Q YD    MAGK  G++AK+ EK  +AIF+ C++H LNLV N+  +   E  N  G ++ +  FF  S +R + +       V  L +TRW+A+ +S++V  EN++ + + L  ++  A+  G    EA+ LL       F   ++       R+  +++ LQ+  V +D+  + ++ +   I    N   + +   K +L N     +R   +   P     +   +  P  + +E +R  +++  L+++  +L  R DC+ +    +F    +   ++ Q++ K+ +  +   Y  D  D+    +F+L    E  + D+ N   + L + ++I         P +   + I L L +  CT ERSFS ++ +K +LRSTM+   L+ L ++S + D
Sbjct:   73 RKKLYSVLSTIVFCGTHDIALRGKTST-----SGNVQALYDFRIESGDEILKNHL---------KNAPVNALLCE---DILRERIISAANNSVG----FSVIADESADISGHEQLSLGVRFVD-LTITPVKIREEFLGFATLKAFDATSIANVIMEQCIK-FGLNIDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVHCASHKLNLVVNN-LNAVPEIRNAIGSVKAIIKFFRESPKRRSLI-----PNVPLLCETRWTAKYKSIRVFSENFDRIFQQLRDLVSTAS--GKISQEAHQLLCCSSTSTFLFCLVIMATYSARLEPLTQALQA--VEMDIAKA-HSHVQELIQMFLNHRQQAEEHFKDILVNVQNIAERTDIELSLPRRCGRQKHHSNVPGSTVEEYYRRAIYVPYLDSVIASLKTRFDCHNITNFNLFSLHPHQMAKIKQQEFKEKIKQITSIYNIDNLDAEALTWFDLWSGKE--KQDFQNGLLDLLPYTDLI---------PAVRQAILIALTLPVTTCTVERSFSSMRRVKTWLRSTMTVNRLSGLCMMSLHRD 597          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-988401])

HSP 1 Score: 113.235 bits (282), Expect = 4.968e-25
Identity = 109/437 (24.94%), Postives = 191/437 (43.71%), Query Frame = 1
Query: 1702 EWLVYSPKIGNVFCFVCKLLTAS---NFNLA--TNGLRDWKNAGSSIKSHQNSSEHRNAL---VTYLTRKSN--YSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLEL-IAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI---ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSS 2970
             W+ YSP +    C  C +        F  A  T     +++  +S + H  ++ H+ A      ++  +S+   S+  Q+   ++ +    RK L  V++ I      ++  RG         SGN   L +  I   D  L  H++    P + +  Y S  +  EL+ L                  F +  D + DIS  +QL + +R+VD +   P+   E FL F  ++      +A++ +E   K  GLN      Q YD    MAGK  G++AK+ EK  +AIF+ C++H LNLV N       +  N  G  + +  FF  S +R + +       V  L +TRW+A+ +S++V  EN++ + + L  ++  A+  G    EA+ LL       F   ++       R+  +++ LQ+  V +D+  +
Sbjct:   35 RWICYSPHLKGALCKYCVIFPQPVHRGFQGAFITAPFLKYRDFHNSARKHSLTTCHKQAYDDATNFINVRSHPEQSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRGKTST-----SGNVQALFDFCIESGDEILKNHLK--NAPVNAR--YTSVRVENELIVLSG----------------FSVIADESADISGHEQLSLGVRFVD-LTITPVKIREEFLGFATLKAVDATSIANVIMEQCIK-FGLNMDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVYCASHKLNLVVND-LKAVPDIRNAIGSGKAIIKFFRESPKRRSLI-----PNVPLLCETRWTAKYKSIRVFSENFDRIFQQLRDLVSTAS--GKISQEAHQLLCCSSTSTFLFCLVIMATYSARLEPLTQALQA--VEMDIAKA 434          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: thap12 (THAP domain containing 12 [Source:NCBI gene;Acc:394650])

HSP 1 Score: 81.6481 bits (200), Expect = 6.754e-15
Identity = 128/599 (21.37%), Postives = 260/599 (43.41%), Query Frame = 1
Query: 1957 LERVVAVICTIVERNLPFRGSNE--IFGMEGSGNFIGLLEL-IAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSST------ERWNKLVEFSNRT----VKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTR--NEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKI-------EAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQR-SDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDI--DDSLFFELLQFHEYIRNDWPN-----DHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDF--DSLINQY 3657
            L+ +  ++  + ++N+P  G N     G+    +F  LLE  I   D  L    RK     +    Y S+T    +L++    +   I  +++ + +F + ++    +  ++ + + +R++D+ N    E FL F+  E        +      EK  GLN + CR Q+Y  +  ++   K + +++LE   + +    S  +LN+           SI   G ++++Y+FF          ER  K++   N       K++ +T W +R ++ ++I    +  +  L+ I  D +F  NT+  + A  L + + +F+F +  +     L    A  KNLQ   +T D+ S+   SL + + +L    D I++       EA  L       VK      +F     T  +P+++ +  +++ + +  + +I   L    S+ +L+  K    + ++ + Q        +  + Y  D+   D+L  EL   H + R  W +     + P+++  YE +   +++  FPN+  +L++   L +     E+     K +K +L +T  +     LA+L+ N D  + +D   D+ I  Y
Sbjct:  161 LKSLFEILILMGKQNIPLEGHNSEVPTGVFIPDSFQALLEYRINSGDDLL----RKRFETTAVNLEYCSRTQQRHMLEICESCIRDEILREVRDANFFSVVMEDAVSLGGEEHMPVFVRFIDETN-NLREEFLGFLPCEGDAKALALNFHTTMTEK-WGLNMEFCRGQAYVTSSGLSANMKFVASQLLEMYPQVVHTLSSTCALNIWLAKAIPVAGVSI-VLGAMKDLYSFFQKQPQLKVELERTIKVLFQGNEEKADDYKNVIQTEWISRHDTFEIIVGLLQAFILCLDKITSDNSFKCNTKVTSRAFILSSALSDFDFIVTNVILKNALSFTRAFGKNLQG--LTSDIFSA-ANSLTAVLHSLNEVKDNIEVYHEFWFEEATNLAEKLSVQVK---LPSRFHTLQLTNLQPDLTVESFYKDALSVPTIHHIIQGLKDIFSEQHLKALKCLSLVPSV-MGQLKFSTSEEHNTDMYKCDLPNPDTLSAEL---HCW-RVKWKHRGKDVELPSNI--YESLHLSDIKF-FPNVFALLKVLCILPVIKVDNEKFEVGRKRLKAYLGNTAVEHRSCQLAMLNINYDSKQDLDLMVDTYITMY 738          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000005329.1 (uncharacterized LOC100494784 [Source:NCBI gene;Acc:100494784])

HSP 1 Score: 69.707 bits (169), Expect = 2.843e-11
Identity = 106/531 (19.96%), Postives = 219/531 (41.24%), Query Frame = 1
Query: 1705 WLVYSPKIGNVFCFVC------KLLTASNFN---LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQ-SKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFS---NRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNK-MEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAK--KLLPNTDYTVKRKRFKK-KFPDEDQTTTEPEISA-------KENFRNNVFMKILE----NIENNLIQRS 3213
            WL YSP++  V CF C       LL +S          G  +WK A      HQ S  H  A    +    N      L+++ +  +      L +++  +  ++ R   F+    I       +   LL+ + + +      +    N  S +  Y       E++ LM+  ++  I+ D+ Q S Y+ + VD   + +   QL + +RY+D    +  E F+ F++    TG   A++ L+  +++  L     R  +++ + +    YK   + + +K   A+F+ C     +L+    +       +    + ++++ FS S +      E +   N + ++L  ++W      V  + ++Y  +++ L    E  +  G    + + +L K ME   +A L+I    ++E +N ++       + LD  + L +S    +  +K     ++ EA    LL   +  V +        P   Q +++ + SA       K +F  N ++K+L+    ++EN  +Q+ 
Sbjct:  198 WLHYSPQLKAVLCFTCGKAESMGLLGSSRRKDSVFTAVGFSNWKKAREKFGYHQKSKSHEFATWKLMHALQNQKREAALEQQRKVRQAIPSICLNKLICAVRFLIHRGHTFQSHESI-----EESLFELLKFVGQDNEMFRYWLLTNQNFTSTEVQY-------EIISLMSHEIISLITKDVNQGSVYYSVIVDCIQN-TDSQQLSLCLRYLDS-EMQAQEEFIGFLDPVEETGTSAANLILDILDRN-SLPIDLLRGIAFEASTS----YKESCSLLKQKQSLAMFVHCGTPCGSLLAKDSSQASPLLQHTLYSVNDLFDLFSKSIKHKFLFAEVTQNFNSSTRNLGSSKWCVNLPVVNAVIQHYGLIIDGLR---EMKSSTGEGGVKVHFVLEKVMEGNTYASLLII-RSIMESLNILN-------IKLDDQNLLMSSTLKKVKLVKEILARLRQEATVVDLLRQAEEAVTKFNLMPIAIPQPHQLSSQLQQSADQLSFENKGDFFKNEYLKMLDAAISHLENRFMQQG 698          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 117.472 bits (293), Expect = 4.723e-26
Identity = 160/703 (22.76%), Postives = 296/703 (42.11%), Query Frame = 1
Query: 1642 RYC-SKTLFFDEKTNGEKYTREW------LVYSPKIGNVFCFVCKLLTASNFN-----LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSV----SDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI--ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFS----NRTVKS-LSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCS------SLYASLAS-----YITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEP--------EISAKENFRNNVFMKILENIENNL---IQRSDCYLEISKVFGFLTNI-ELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEI---IKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLS 3603
            R C SK+   ++    E     W      L  SP     FC+ C L     F+      AT G  DW+    + + H+ S  H  +L  +   +   ++    S    K+I+  + Y R ++E ++     + ++ L  +G+++       G+F+ LLEL A+      +    F    S    Y S  + EE+++++   +L+ I  +I  S  F +  +     + + QL + +RY  +     +  ERFL F+  E  TG ++    ++ + + +G++F     Q+YD+A N   K   + A+  ++  +A+++ C AH L L   S      E       +  ++N    S E    L        N+T K   S++ W A    +  + +    V+E L ++            E  +LL  + +FEF   + F  +VL     +S+  QS   T+D+ S      ++   L+S     Y  N+ +  DEI     K + +  + V++  F+K+   + Q T +P          SA E ++ N++ + L+ +  +L       D Y ++ ++   L    E   E   +H+    +   D I +  F+       +I  D        LSF ++     +  L    P +  +L I L   I +   E+SFS L  +K +L  TM Q+ L++LAL++
Sbjct:  279 RLCLSKSTLTEQNIKTEPPGEPWSPALQHLHPSPADNIAFCYSCYLFFQKKFSCRREAFATQGTADWEKMLGNFRKHEESDVHLKSLQFWRQYQFLDAIPCDNSSVYSKQIEGNKKYLRLIIENIL----FLGKQCLLLKGNDQSVSPMNKGSFLELLELRAR------DRGEVFQLMSSHVDFYSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHG-RIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAVISFCKEVKELREALHTLCSLFNTVHVSEEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLPEVVEVLASVSRRCAGTA-VAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSE--TVDIFSLFSKIEAILECLSSERNDTYFKNIWDGADEIC----KKITSKGFDVEKPSFQKR--RKVQRTVDPGNSEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSEFD-YCKMKQISELLLKWNEPLNEATAKHIQEFYKLDADIIPELRFYRQYAGFNFIAED------GSLSFIDLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIA 954          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 117.472 bits (293), Expect = 4.723e-26
Identity = 160/703 (22.76%), Postives = 296/703 (42.11%), Query Frame = 1
Query: 1642 RYC-SKTLFFDEKTNGEKYTREW------LVYSPKIGNVFCFVCKLLTASNFN-----LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSV----SDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI--ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFS----NRTVKS-LSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCS------SLYASLAS-----YITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEP--------EISAKENFRNNVFMKILENIENNL---IQRSDCYLEISKVFGFLTNI-ELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEI---IKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLS 3603
            R C SK+   ++    E     W      L  SP     FC+ C L     F+      AT G  DW+    + + H+ S  H  +L  +   +   ++    S    K+I+  + Y R ++E ++     + ++ L  +G+++       G+F+ LLEL A+      +    F    S    Y S  + EE+++++   +L+ I  +I  S  F +  +     + + QL + +RY  +     +  ERFL F+  E  TG ++    ++ + + +G++F     Q+YD+A N   K   + A+  ++  +A+++ C AH L L   S      E       +  ++N    S E    L        N+T K   S++ W A    +  + +    V+E L ++            E  +LL  + +FEF   + F  +VL     +S+  QS   T+D+ S      ++   L+S     Y  N+ +  DEI     K + +  + V++  F+K+   + Q T +P          SA E ++ N++ + L+ +  +L       D Y ++ ++   L    E   E   +H+    +   D I +  F+       +I  D        LSF ++     +  L    P +  +L I L   I +   E+SFS L  +K +L  TM Q+ L++LAL++
Sbjct:  279 RLCLSKSTLTEQNIKTEPPGEPWSPALQHLHPSPADNIAFCYSCYLFFQKKFSCRREAFATQGTADWEKMLGNFRKHEESDVHLKSLQFWRQYQFLDAIPCDNSSVYSKQIEGNKKYLRLIIENIL----FLGKQCLLLKGNDQSVSPMNKGSFLELLELRAR------DRGEVFQLMSSHVDFYSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHG-RIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAVISFCKEVKELREALHTLCSLFNTVHVSEEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLPEVVEVLASVSRRCAGTA-VAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSE--TVDIFSLFSKIEAILECLSSERNDTYFKNIWDGADEIC----KKITSKGFDVEKPSFQKR--RKVQRTVDPGNSEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSEFD-YCKMKQISELLLKWNEPLNEATAKHIQEFYKLDADIIPELRFYRQYAGFNFIAED------GSLSFIDLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIA 954          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Thap12 (THAP domain containing 12 [Source:MGI Symbol;Acc:MGI:1920231])

HSP 1 Score: 114.775 bits (286), Expect = 2.423e-25
Identity = 143/608 (23.52%), Postives = 280/608 (46.05%), Query Frame = 1
Query: 1948 RKVLERVVAVICTIVERNLPFRG--SNEIF-GMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQI-NFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLN--------LVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKL-----VEFSN-----RTVKSLSKTRWSARSESVKVIHENYENVMEALNAII-EDANFYGN--TRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKI-------EAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQR-SDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDID--DSLFFELLQFHEYIRNDWPN---DHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQY 3657
            ++ L+ +  ++  + ++N+P  G  ++E+  G+    NF  LLE          E +RK     +  T + SKT    +L++    + +    +++ S +F +  D   DI+ ++ L +++R+VD   N +  E F+ F+  E    E LA        +  GLN + CR Q+Y  +   + K K + +++LEK  +A++  CS+ +LN        ++G S A          G I+EV +FF  S +   +L     V F N     + +K +  ++W+ R ++ +++ +  + ++  L+ II  D N   N      A  L + + +F+F + ++    VL    A  KNLQ     +   +S   SL + + +L    + I++       EA  L    D  +K      KF    Q   E +++++  +++ + +  +E+I   L    S+ +L+  K    + ++ + Q        +  + Y  D+   D+L  EL   H + R  W +   D     + YE +   +++  FPN+  +L++   L +     ER  +  K +K +LR+T++ +  +NLALL+ N D +K  D D +++ Y
Sbjct:  159 KEYLKSLFEILVLMGKQNIPLDGHEADEVPEGLFAPDNFQALLECRINSG---EEVLRKRFEATAVNTLFCSKTQQRHMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDDAHNLR--EEFVGFLPYEA-DAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAVYTLCSSCALNAWLAKSVPVIGVSVA---------LGTIEEVCSFFHRSPQLLLELDSVISVLFQNSEERAKELKEICHSQWTGRHDAFEILVDLLQALVLCLDGIINSDTNVRWNNYIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAS---SLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMK---LPGKFRRAQQGNLESQLTSESYYKDTLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSV-MGQLKFNTSEEHHADMYRSDLPNPDTLSAEL---HCW-RIKWKHRGKDIELPSTIYEALHLPDIKF-FPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFD-IKH-DLDLMVDTY 737          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 109.383 bits (272), Expect = 1.606e-23
Identity = 147/648 (22.69%), Postives = 276/648 (42.59%), Query Frame = 1
Query: 1783 ATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQL--------QKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI--ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFS----NRTVKS-LSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCS------SLYASLAS-----YITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEP--------EISAKENFRNNVFMKILENIENNL---IQRSDCYLEISKVFGFLTNI-ELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEI---IKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLS 3603
            AT G  DW+    + + H+ S  H  +L  +      Y   D +         K+I+  + Y R ++E ++     + ++ L  +G+++       G+F+ LLEL A+      +    F    S    Y S  + EE+++++   +L+ I  +I  S  F +  +     + + QL + +RY  +     +  ERFL F+  E  TG ++    ++ + + +G++F     Q+YD+A N   K   + A+  ++  +A+++ C AH L L   S      E       +  ++N    S E    L        N+T K   S++ W A    +  + +    V+E L ++            E  +LL  + +FEF   + F  +VL     +S+  QS   T+D+ S      ++   L+S     Y  N+ +  DEI     K + +  + V++  F+K+   + Q T +P          SA E ++ N++ + L+ +  +L       D Y ++ ++   L    E   E   +H+    +   D I +  F+       +I  D        LSF ++     +  L    P +  +L I L   I +   E+SFS L  +K +L  TM Q+ L++LAL++
Sbjct:  240 ATQGTADWEKMLGNFRKHEESDVHLKSLQFW----RQYQFLDAIPCDNSSVYSKQIEGNKKYLRLIIENIL----FLGKQCLLLKGNDQSVSPMNKGSFLELLELRAR------DRGEVFQLMSSHVDFYSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHG-RIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAVISFCKEVKELREALHTLCSLFNTVHVSEEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLPEVVEVLASVSRRCAGTA-VAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSE--TVDIFSLFSKIEAILECLSSERNDTYFKNIWDGADEIC----KKITSKGFDVEKPSFQKR--RKVQRTVDPGNSEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSEFD-YCKMKQISELLLKWNEPLNEATAKHIQEFYKLDADIIPELRFYRQYAGFNFIAED------GSLSFIDLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIA 856          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Zmym5 (zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI:3041170])

HSP 1 Score: 51.2174 bits (121), Expect = 8.847e-6
Identity = 30/82 (36.59%), Postives = 39/82 (47.56%), Query Frame = 1
Query: 1651 SKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLAT-NGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSN 1893
            S+T +     NGEK TR WL+YS    +VFC  C+L       L   NG +DW +    +  H  S  H N  V Y   KS+
Sbjct:  525 SETYYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGKNQLRNENGCKDWHHLSHLLSKHDESEMHINNSVKYSKLKSD 606          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q5SVZ6|ZMYM1_HUMAN (Zinc finger MYM-type protein 1 OS=Homo sapiens OX=9606 GN=ZMYM1 PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.785e-32
Identity = 167/662 (25.23%), Postives = 307/662 (46.37%), Query Frame = 1
Query: 1735 VFCFVCKLLTASNFN-----LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRK-SNYSVSDQLQ---KEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI---ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHE-NYENVMEALNAIIED----ANFYGNTR--NEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCS------SLYASLAS-----YITNLKNSFDEI--KIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLK--QHVNNVVEKYPDD---IDDSLFFELLQFHEYIRNDWPNDHP--NHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLS 3603
             FC+ C+L     F+      AT+G  +WK      + H+ S  H  +L  +   +  + +VSD L    K+I+  + Y + ++E ++     + ++ LP RG+++       GNF+ LLE+ AK      E   +  N  S    Y S  I  ++++++   +L+ I ++I  S  F +  D T + + K+QL + +RY  Q + K I   ERFL F++ E  TG +L   +++ + + IG++      Q+YD+  N+  K+  + A+  ++  +A+++ C AH L+L   S    C E       ++ + + F++       L  F N    S +KT     S+S   +H+    +V+++L  IIE     A+   NT   +E ++LL  + +FEF   + F  +VL     +SK LQ+   T+D+ S      ++   L+S     Y   + +  +EI  KI  K          KR++ +K     +        S +E ++ N++ + L+ I  NL     C+ E    F +    ++S+   K  + +N    K+  +   +D+ +  EL  +  Y + ++  D    N +S   +  +  L    P L  +L I L   I + + E SFS L  +K +L +TM Q+ L   AL++
Sbjct:  475 AFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSIHSKQIEGNKKYLKLIIENILF----LGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDK---GEETFRLMN--SQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRY-PQKSSKAILIKERFLGFVDTEEMTGTHLHR-TIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDL---SIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNK--TIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNL---KLCFSE----FDYCKIKQISELLFKWNEPLNETTAKHVQEFYKLDEDIIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMA 1113          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|O43422|P52K_HUMAN (52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 6.022e-26
Identity = 145/599 (24.21%), Postives = 279/599 (46.58%), Query Frame = 1
Query: 1948 RKVLERVVAVICTIVERNLPFRG--SNEIF-GMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQI-NFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKL-----VEFSN-----RTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGN--TRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKI-------EAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQR-SDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDID--DSLFFELLQFHEYIRNDWPN---DHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQY 3657
            ++ L+ +  ++  + ++N+P  G  ++EI  G+    NF  LLE          E +RK     +  T + SKT   ++L++    + +    +++ S +F +  D   DI+ ++ L +++R+VD+  N +  E F+ F+  E    E LA        +  GLN + CR Q+Y  +   + K K + +++LEK  +AI+  CS+ +LN+           S+   G I+EV +FF  S +   +L     V F N     + +K +  ++W+ R ++ +++ E  + ++  L+ I  D N   N      A  L + + +F+F + ++    VL    A  KNLQ    T DV  +   SL + + +L    + I++       EA  L    D  +K      KF    Q   E +++++  ++  + +  +E+I   L    S+ +L+  K    + ++ + Q        +  + Y  D+   D+L  EL   H + R  W +   D     + YE +   +++  FPN+  +L++   L +     ER  +  K +K +LR+T++ +  +NLALL+ N D +K  D D +++ Y
Sbjct:  163 KEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSG---EEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLR--EEFIGFLPYEA-DAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMGVSVAL-GTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQ--TSDVFFA-AGSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMK---LPGKFRRAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSV-MGQLKFNTSEEHHADMYRSDLPNPDTLSAEL---HCW-RIKWKHRGKDIELPSTIYEALHLPDIKF-FPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFD-IKH-DLDLMVDTY 740          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q9CUX1|P52K_MOUSE (52 kDa repressor of the inhibitor of the protein kinase OS=Mus musculus OX=10090 GN=Thap12 PE=2 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 1.695e-24
Identity = 143/608 (23.52%), Postives = 280/608 (46.05%), Query Frame = 1
Query: 1948 RKVLERVVAVICTIVERNLPFRG--SNEIF-GMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQI-NFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLN--------LVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKL-----VEFSN-----RTVKSLSKTRWSARSESVKVIHENYENVMEALNAII-EDANFYGN--TRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKI-------EAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQR-SDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDID--DSLFFELLQFHEYIRNDWPN---DHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQY 3657
            ++ L+ +  ++  + ++N+P  G  ++E+  G+    NF  LLE          E +RK     +  T + SKT    +L++    + +    +++ S +F +  D   DI+ ++ L +++R+VD   N +  E F+ F+  E    E LA        +  GLN + CR Q+Y  +   + K K + +++LEK  +A++  CS+ +LN        ++G S A          G I+EV +FF  S +   +L     V F N     + +K +  ++W+ R ++ +++ +  + ++  L+ II  D N   N      A  L + + +F+F + ++    VL    A  KNLQ     +   +S   SL + + +L    + I++       EA  L    D  +K      KF    Q   E +++++  +++ + +  +E+I   L    S+ +L+  K    + ++ + Q        +  + Y  D+   D+L  EL   H + R  W +   D     + YE +   +++  FPN+  +L++   L +     ER  +  K +K +LR+T++ +  +NLALL+ N D +K  D D +++ Y
Sbjct:  159 KEYLKSLFEILVLMGKQNIPLDGHEADEVPEGLFAPDNFQALLECRINSG---EEVLRKRFEATAVNTLFCSKTQQRHMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDDAHNLR--EEFVGFLPYEA-DAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAVYTLCSSCALNAWLAKSVPVIGVSVA---------LGTIEEVCSFFHRSPQLLLELDSVISVLFQNSEERAKELKEICHSQWTGRHDAFEILVDLLQALVLCLDGIINSDTNVRWNNYIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAS---SLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMK---LPGKFRRAQQGNLESQLTSESYYKDTLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSV-MGQLKFNTSEEHHADMYRSDLPNPDTLSAEL---HCW-RIKWKHRGKDIELPSTIYEALHLPDIKF-FPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFD-IKH-DLDLMVDTY 737          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|A6QPH9|ZMYM5_BOVIN (Zinc finger MYM-type protein 5 OS=Bos taurus OX=9913 GN=ZMYM5 PE=2 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 1.969e-8
Identity = 48/135 (35.56%), Postives = 61/135 (45.19%), Query Frame = 1
Query: 1513 DVGLWGELSS---EDTLYWIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLAT-NGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVS 1905
            D G W  + S    DTL  +E  P        NF+  K    D+T R  S+T +     NGEK TR WL+YS    +VFC  CKL       L   NG RDW++    +  H+ S  H N  V Y   KS+   S
Sbjct:  521 DPGTWPRILSIKQRDTL--VENDPPQ----VRNFNFPK----DSTGRKFSETYYTRILANGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNENGCRDWQHLSHILSKHEESEMHINNSVKYSKLKSDLKTS 645          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q9UJ78|ZMYM5_HUMAN (Zinc finger MYM-type protein 5 OS=Homo sapiens OX=9606 GN=ZMYM5 PE=1 SV=4)

HSP 1 Score: 60.8474 bits (146), Expect = 6.481e-8
Identity = 48/148 (32.43%), Postives = 66/148 (44.59%), Query Frame = 1
Query: 1513 DVGLWGEL---SSEDTLYWIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLAT-NGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQLQKEIQQERIY 1944
            D G W  +      DTL  +E  P        NF+  K    DNT R  S+T +     NGEK TR WL+YS    +VFC  CKL       L   NG +DW++    +  H+ S  H N  V Y   KS+   +  +  +  + R+Y
Sbjct:  521 DPGTWPRILNIKQRDTL--VENVPPQ----VRNFNFPK----DNTGRKFSETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNENGCKDWQHLSHILSKHEESEMHVNNSVKYSKLKSDLKKNKAI--DAAEHRLY 656          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A151J2H9 (Zinc finger MYM-type protein 1 OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_11510 PE=4 SV=1)

HSP 1 Score: 549.666 bits (1415), Expect = 3.363e-176
Identity = 295/719 (41.03%), Postives = 447/719 (62.17%), Query Frame = 1
Query: 1558 WIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFN---LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSD-QLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKLLPNT--DYTVKRKR-FKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIE-LSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPN-DHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKVL 3687
            +++ G    Q+   N+ SS ++Y     R  S ++F     NGEK+ R+WL+YS   G VFC+VCKL + +N         G  DWK A  SI SH+NS EH++ L+ +++R S  ++ D +L   IQ E  YW ++L RV+AVI  + ER L FRG NE+ G   +GN++G LELIA+FDPFL +H++   N G G  SYLSKTI EE + ++A  V  +I  +IK++KYFG+ VDSTPD+SH DQL +++RY   +    IERFL FI I +HTGE L+   L   E +  ++  DCR+Q+YDNA NM+GKY G +A + EKN+ A ++PC AHSLNL+G    D C  +INFF  +Q++Y FFS+ST RW+ L++++  +VK+LS TRWS R ++V  +  N++ V  ALN +  + +    TRN+A +L +KM + E A++++ W +VL+R +AVS+ LQ   + L    ++  SLA +I  L+N FD+I+  AKKL  N    YT + KR   KK+PD  Q      ++++++FR + F+ I++ +   + +RS  Y  I+ +FGFLT +  L  E+L+ ++  V+E Y  D D+ LF E+  F   ++  +    HP  L  + ++++  +   FPN+  +LRI+L + + NC GERSFSKL  IKN  R++M +  L++LALL    +  + IDF  +I+ +A EK RKK L
Sbjct:    9 YLQLGCNYFQNKHANYTSSLRIYKTQN-RSFSSSMFVRVLANGEKHDRKWLMYSESTGCVFCYVCKLFSNANSRESKFVKGGFSDWKKATESITSHENSKEHKDCLIIWISRTSATNLIDKELATTIQNETRYWTEILNRVLAVIRFLAERGLAFRGKNEVVGASNNGNYLGALELIAQFDPFLEKHLQMHANKGRGHVSYLSKTICEEFIKILAAKVFTTILSEIKEAKYFGLIVDSTPDLSHIDQLTIVMRYC--LKGSIIERFLCFIPIYSHTGESLSTEVLNLLENN-SIDICDCRAQTYDNASNMSGKYNGCQALIKEKNELAYYVPCVAHSLNLIGECSVDSCFYAINFFSFLQKLYAFFSASTHRWDVLMQYTTTSVKNLSATRWSCRYDAVSTLKNNFDCVYNALNKLSSNEDENAVTRNKAKSLQDKMVKLETAIMLVLWYRVLQRFDAVSRYLQKVNIDLVSAKNMLKSLAEFIRTLRNDFDDIEECAKKLSNNIIQHYTAETKRKIIKKYPDASQNEMNTAVASRDSFRTSTFLIIIDKLYVEIEKRSVAYNHIASLFGFLTKLHILDVEELRDNITTVIETYSQDFDEGLFDEMKAFISLLKISFHEIPHPPELLKWMLLQD--ITEVFPNVYILLRIYLTIPVTNCEGERSFSKLAYIKNKYRTSMDELRLSSLALLCIESELTRKIDFSDVIHTFAQEKARKKAL 721          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2S2QLG5 (Zinc finger MYM-type protein 1 OS=Sipha flava OX=143950 GN=ZMYM1_132 PE=4 SV=1)

HSP 1 Score: 548.125 bits (1411), Expect = 3.859e-174
Identity = 303/760 (39.87%), Postives = 471/760 (61.97%), Query Frame = 1
Query: 1456 NENLVESLIESSPNANRENDVGLWGELSSEDTLYWIEKGPESCQHSTENFHSSKQLYNDNT----VRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLAT-NGLRDWKNAGSSIKSHQNSSEHRNALVTYLTR-KSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKD-IGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWN--KLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKK-----FPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIE-LSQEDLKQHVNNVVEKYPDDIDDS-LFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKVL 3687
            N+  V+S      N+   ND G W  L+ E    +I+KG +  Q+   +F +S + Y ++     VR+ +K++F  +  NGE   R WL+YSP    +FCFVC+L +++    +   G  DWK+  + +  H+NS  HR +++T+  R K+N  +  ++  +I  E  YW++VL+R+VAVI  +  R + FRG N+I G + +GN++G LELI++FDPFL EH+ K+GN G G  SYLS  I  E +++M + VL +I  ++K +KY+ +SVDSTPD+SH DQ+  IIRYV+  +  P+ERFL FI I+ H  EYL  + L F EK+ I LN  +CR QSYDNA NM+G+Y G++A++ EK + AIF+PC+AHSLNLVG   A+C +E++++F  +Q++YNFFSSST RW+  K    S+  +KSLS+TRWSAR+++V  +   Y+ +++AL  I  D     N +NE + L+ KM++ E  +L   W ++L R+N  +KNLQ   +T+DV S L+ SLA +++ ++++F   +  A++  P++DY    +R KK+      P E  T      S  E F+   +  I++ +   L  R+  Y  I+K+FGF +N++ L  ++++ H     E Y  DI+++ L  E +    Y+ ++      +  S Y+ +K   LE  FPN+    RIFL +MI NC+GERSFSKL LIK  LRSTMSQK LN+L+L+S   + L ++D++++I  +A EK RKK L
Sbjct:   74 NKYFVDSPETVEDNSLVSNDPGNWNTLTEEKRNMYIKKGSKFFQNKDSDFSNSTRNYTESNGKIKVRHLTKSIFTRQLKNGENVDRSWLLYSPSKKALFCFVCRLFSSTKTGFSCEQGFNDWKHVHTVVLEHENSLMHRESVMTFSVRTKNNGRIDQEISYQINLEVNYWKEVLKRIVAVIKFLSSRGIAFRGENQIIGSQHNGNYLGCLELISQFDPFLLEHLNKYGNQGKGNPSYLSANICNEFINIMGRQVLNAILSELKVAKYYSISVDSTPDLSHIDQMTFIIRYVN--DDTPVERFLEFIPIDEHGSEYLFKVILSFLEKNQISLN--NCRGQSYDNAANMSGQYAGLQARIKEKCNFAIFIPCAAHSLNLVGVRAAECVMEAVSYFQFVQKLYNFFSSSTYRWSIMKKCLGSHHVLKSLSETRWSARADAVTALCNGYKEILDALKTIEIDDKTSPNVKNETHGLIKKMKKLENIVLTEIWSKILSRINETNKNLQKENLTIDVGSKLFDSLAGFLSEIRDNFYSYESSAREKFPDSDYKDLHQRTKKRSIHLTLPGE-LTNKSTSFSGSEKFKIETYFPIIDTLITQLKIRAKSYNTINKLFGFFSNLKNLETKEVQVHCKTFAEFYHVDINENELILECIHLKAYL-SELDISEFSISSTYKCLKSNRLEETFPNIIISFRIFLSMMITNCSGERSFSKLNLIKEELRSTMSQKRLNSLSLMSIEHELLSSLDYENVIEDFANEKARKKPL 827          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2S2Q4F2 (Zinc finger MYM-type protein 1 OS=Sipha flava OX=143950 GN=ZMYM1_44 PE=4 SV=1)

HSP 1 Score: 536.569 bits (1381), Expect = 7.344e-170
Identity = 291/709 (41.04%), Postives = 437/709 (61.64%), Query Frame = 1
Query: 1585 QHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFN-LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTR-KSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEF--SNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEI-SAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNI-ELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQF--HEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKVL 3687
            Q+  ++F  SK+ Y D   R+ +K+LF   + NGE  +R WLV+S   G VFC  C+L  +++ + L T G  DWKNA   +  H+NS  H+ + V  + R K+   ++ ++  +++QE  YWR +L+R+VA + ++V R LP RGS E FG   SGNFI  LEL+A+FDPFL+EHIR +G  GSG TSYLS   + E + +MA+ + K I +++K SKYF +SVDSTPD+SH DQL  IIRY+ + +  PIERFL FI    H  E LAD   +   +   L+ ++CR QSYDNA NMAGKY G++A++ E    AI++PCSAHSLNLVG S  DCC +S  +F  +QE+YNFF++ST RW  L+ +   ++ VKSLS+TRWSAR E+ K +  ++  +  AL AII+DAN    T+ +A+ LL      E   + +FW++VLER + V+K LQS  + L +   LY SL  YI+ ++N+F+E + +A ++     Y   ++R  K+    D+T  E    + KE+FR NVF  IL+ +   L++R   Y  +   F FLTNI    +E + +    ++E+YP+DI++S   E L    H + ++D      N     +++   +L   +PN+ T LR++LC    NCT ERSFS LK +K+ LRST+    LN  ++L    + L++I++D +I+ +A +K R+K+L
Sbjct:  115 QNLNDDFTCSKREYPDKN-RFLNKSLFVRTRINGEVQSRPWLVFSKSTGTVFCAPCRLFGSAHLSTLVTIGFNDWKNAVRKLNDHENSIPHKTSTVALIERGKTAGKINQEIVLQLEQETNYWRNILKRIVATVRSLVIRGLPLRGSEEKFGSYHSGNFIMTLELLAEFDPFLSEHIRHYGKIGSGNTSYLSSQTYGEFIQIMAEKITKQIVEEVKVSKYFSISVDSTPDVSHVDQLSFIIRYISK-DGTPIERFLKFIANTGHKSEQLADAVFDTLNQ-YNLDIKNCRGQSYDNASNMAGKYTGLQARIKEVIPLAIYVPCSAHSLNLVGISAVDCCEKSTTYFRYLQELYNFFTASTHRWEILLFYLKKSKCVKSLSQTRWSARYEAGKSLCTSWSEIKNALQAIIDDANEKPVTKFDASVLLKPFNTIEMCFMTVFWNEVLERFHIVNKKLQSVNIELGMIVELYGSLEQYISRIRNNFEEYEGKAIQICGEMQYKKDKRRTVKRKRQFDETMNEVITETGKEDFRINVFFVILDKLNAELVRRGSSYKNLCVKFDFLTNICSFDEEIISEKTRALIEQYPNDIEESFTNECLHLRDHLFFKSD---KKRNAQELCKMLYTNDLIDIYPNVTTALRMYLCTFATNCTAERSFSALKRVKSHLRSTLESDRLNATSILHIESEMLRSINYDDIIDDFASKKVRRKML 817          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: H3A5Q3 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1)

HSP 1 Score: 532.332 bits (1370), Expect = 1.886e-169
Identity = 284/743 (38.22%), Postives = 445/743 (59.89%), Query Frame = 1
Query: 1513 DVGLWGELSSEDTLYWIEKGPESCQHSTENFHSSKQLY-NDNTVRYCSKTLFFDEKT-NGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATN-GLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQ-LQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRT------VKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKLLPNTDY---TVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNI-ELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWP----NDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKVL 3687
            D G+W  ++ E   YW+ KG + CQH+  +F +S++ Y ++   R C++++F    T +GE   R+WL+YSP  G+V+CF CKL +    N   N G +DWK+A  ++  H+NS  HR A+V+  T        D+ L  + + E+ YW  VL R++ V+  + ER L   G NEIFG   +GNF+G++ELI K+D FLA+HI K GN G G   YLS TI E  + L+ + V + I  ++K++KYF + VDS PDIS+ DQL  ++RYV  +   P+ERFL F++ E H+G+ +A   L+FFEK IG+N  DC+ QSYDNA N++GKY+GM+A + E+++ A+++PC AHSLNLVG    DCC  +I+FF  +Q++Y FF++ST+RW  L+E    T      VK+LS+TRWS  +++V  + + Y+ +   L+ +  D +   +TR E       ME+ E +++   W  +LER +  S  LQ PK+  +    L  SL ++I +L++ F   + + K      DY    + R+R + +  D D  + E ++   E+FR   ++ I++ + + L QR D Y E+   FGFL+ +  +S  ++      +++ Y   ++D +  EL+ F E+++ ++      D P  +  Y ++ +  L+  FPN+  IL ++LCLMI NC+GE SFSK+ LIKN LRSTM Q+ LN L L+S   + L+ IDF  LIN +A  K RK+ L
Sbjct:    1 DPGMWSPVTEELRSYWVTKGTDECQHADGDFSASERKYEHEQHPRRCTRSMFQRVYTKSGEVSERKWLIYSPTTGSVYCFACKLFSNDQKNHFGNAGFQDWKHADRALSMHENSECHRRAMVSLTTHMDTEGRIDKCLVTQYRAEKQYWCDVLHRILKVVRFLAERGLALHGENEIFGSPHNGNFLGIVELIVKYDAFLAQHINKHGNMGRGHVPYLSSTICEVFIALLEEKVFEHIVKELKEAKYFSVLVDSIPDISNLDQLTCVVRYV--LPNGPVERFLTFLDFETHSGQDIAKSLLQFFEK-IGVNIADCQGQSYDNASNLSGKYQGMQAWIRERSENAVYIPCCAHSLNLVGQCAVDCCFTAISFFSFVQKLY-FFAASTKRWKVLLERLAETNEKLPVVKNLSETRWSVHTDAVTALRKGYDRIKATLDHLSCDDSQKPDTRIEKT-----MEKLEISIMTEIWHTILERFHKTSAKLQDPKMDFNTAPVLLESLHAFINSLRSQFSHFEEQGKNHKSCVDYYRNELHRRRKRNRQYD-DGESEETQLLPCESFRIETYLVIMDKLSSALAQRLDAYKEVCSRFGFLSKLTSMSVGEIHDTAKKLLQYYSTYLEDCVIEELVHFSEFVKTEFARKSSGDGPE-IQMYRLLVQNGLQDTFPNIHIILHMYLCLMILNCSGEHSFSKMVLIKNRLRSTMHQERLNMLTLMSIEHEILRTIDFSDLINDFAERKARKRPL 732          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2S2P9T6 (Zinc finger MYM-type protein 1 OS=Schizaphis graminum OX=13262 GN=ZMYM1_2 PE=4 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 2.002e-169
Identity = 291/709 (41.04%), Postives = 436/709 (61.50%), Query Frame = 1
Query: 1585 QHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFN-LATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTR-KSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEF--SNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEI-SAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNI-ELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQF--HEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKVL 3687
            Q+  ++F  SK+ Y D   R+ +K+LF   + NGE  +R WLV+S   G VFC  C+L  +++ + L T G  DWKNA   +  H+NS  H+ + V  + R K+   ++ ++  +++QE  YWR +L+R+VA + ++V R LP RGS E FG   SGNFI  LEL+A+FDPFL+EHIR +G  GSG TSYLS   + E + +MA+ + K I +++K SKYF +SVDSTPD+SH DQL  IIRY+ + +  PIERFL FI    H  E LAD   +   +   L+ ++CR QSYDNA NMAGKY G++A++ E    AI++PCSAHSLNLVG S  DCC +S  +F  +QE+YNFF++ST RW  L+ +   ++ VKSLS+TRWSAR E+ K +  ++  +  AL AII+DAN    T+ +A+ LL      E   + +FW++VLER + V+K LQS  + L +   LY SL  YI+ ++N+F+E + +A ++     Y   ++R  K+    D+T  E    + KE+FR NVF  IL+ +   L++R   Y  +   F FLTNI    +E + +    ++E+YP+DI++S   E L    H + ++D      N     +++   +L   +PN+ T LR++LC    NCT ERSFS LK +K+ LRST+    LN  ++L    + L++I++D +I+ +A +K R K+L
Sbjct:  115 QNLNDDFTCSKREYPDKN-RFLNKSLFVRTRINGEVQSRPWLVFSKSTGTVFCAPCRLFGSAHLSTLVTIGFNDWKNAVRKLNEHENSIPHKTSTVALIERGKTAGKINQEIVLQLEQETNYWRNILKRIVATVRSLVIRGLPLRGSEEKFGSYHSGNFIMTLELLAEFDPFLSEHIRHYGKIGSGNTSYLSSQTYGEFIQIMAEKITKQIVEEVKVSKYFSISVDSTPDVSHVDQLSFIIRYISK-DGTPIERFLKFIANTGHKSEQLADAVFDTLNQ-YNLDIKNCRGQSYDNASNMAGKYTGLQARIKEVIPLAIYVPCSAHSLNLVGISAVDCCEKSTTYFRYLQELYNFFTASTHRWEILLFYLKKSKCVKSLSQTRWSARYEAGKSLCTSWSEIKNALQAIIDDANEKPVTKFDASVLLKPFNTIEMCFMTVFWNEVLERFHIVNKKLQSVNIELGMIVELYGSLEQYISRIRNNFEEYEGKAIQICGEMQYKKDKRRTVKRKRQFDETMNEVITETGKEDFRINVFFVILDKLNAELVRRGSSYKNLCVKFDFLTNICSFDEEIISEKTRALIEQYPNDIEESFTNECLHLRDHLFFKSD---KKRNAQELCKMLYTNDLIDIYPNVTTALRMYLCTFATNCTAERSFSALKRVKSHLRSTLESDRLNATSILHIESEMLRSINYDDIIDDFASKKVRHKML 817          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000035531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6285841:6288423:1 gene:ENSAMXG00000041958.1 transcript:ENSAMXT00000035531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 470.315 bits (1209), Expect = 8.765e-148
Identity = 275/736 (37.36%), Postives = 429/736 (58.29%), Query Frame = 1
Query: 1510 NDVGLW-GELSSEDTLYWIEKGPESCQHSTENFHSS-KQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTR-KSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSN--RTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSS--LYASLASYITNLKNSFDEIKIEAKKLLP--NTDYTVKRKRFKKKFPDEDQTTTEPEIS--AKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIE-LSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKK 3681
            ND  LW   ++ +     + +G  + Q+ +  + +S +      T R  +  L      NG+  TR+WL+YSP  G V+CF CKL + S  N   +G  DWK++   I  H+ S EHR  ++    R +   ++   + K+I  ER YWR VL+RVVAVI  + ER L     +E+ G   +GNF+G++EL++KFDPFLAEH+++FG  G G  SYLS T+ EE + LM +   ++I + IK+SKYF + VDSTPD++H DQ   I R+V+  +   +ERFL F  IENH+G+ LA+  +   E ++GL+  +CR QSYDNA NM+GKY G++A + ++N    ++PC+AHSLNLVG +  D   E+  FF  +Q ++ F +SST RW K+   ++   T+KSLS TRWSAR+ES K + + Y  + EALN + +D      TR+EA+ L +K++  E A +  FWD +L+R  A S  LQ  K  +D+C++  L  SL  ++   +++F+  +  A  +    + +Y    +R KK+    D  + EP ++   K+ FR   F  +++ + + L  R + Y  ++++F  L   + +S  +L    N +   YP D++ SL  EL+Q+  +I       HP+ +   + +   NL+  FPN+   LR+FL + I NC GERSFSKL  IKN LR  M Q  LN+L+LL+   D ++ ++FD L++ +A +K RKK
Sbjct:  139 NDPALWPSTITDQARSILVSRGETAFQNRSAKYPASVRDRGIGGTSRSFTNALLSCSLPNGQTVTRQWLLYSPSTGCVYCFACKLFS-SKHNTFVHGFSDWKHS-ERIGEHEGSVEHRACMLALYNRSRGTATIDSDIVKQIDAERQYWRDVLKRVVAVIQFLGERGL-----DELLGSAHNGNFLGIIELLSKFDPFLAEHLQRFGGKGKGSVSYLSSTVCEEFIHLMGQRTKQAIVNKIKESKYFSVIVDSTPDLAHVDQPTFIFRFVNN-DAHVVERFLAFEPIENHSGDSLAECVVAMVE-NLGLDLSNCRGQSYDNASNMSGKYNGVQAHLKQRNSLICYVPCAAHSLNLVGVNAVDSSPEAGRFFDFVQAMFTFCASSTHRWRKVFRDTDIKLTLKSLSGTRWSARAESTKALWKYYAQLREALNDMSKDMEEKCVTRSEASALCDKLDTLETAFMAYFWDTILQRFQASSLQLQ--KHDIDICTAPQLLLSLRDFVAAQRDNFEVFEGAALNVTTAVSQEYRHDLQRTKKRKIMSDD-SAEPGVAFNGKDKFRIETFNVVIDKLVSCLNHRLNAYTHLTELFDVLFMPDNMSNSELILKANLLAAAYPSDLNMSLADELIQYKSFITEK--EKHPSKM--LKTMINLNLQSTFPNVYIALRLFLTVPITNCEGERSFSKLARIKNELRIRMRQNRLNSLSLLAIESDLVRQLNFDELVDDFARKKSRKK 858          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000042715.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11855083:11857132:-1 gene:ENSAMXG00000035113.1 transcript:ENSAMXT00000042715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 444.121 bits (1141), Expect = 2.136e-140
Identity = 249/673 (37.00%), Postives = 383/673 (56.91%), Query Frame = 1
Query: 1681 NGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTR-KSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKLLP--NTDYTVKRKRFKKKFPDEDQTTTEPEIS--AKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIE-LSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKK 3681
            NG+  TR+WL+YSP  G V+CF CKL + S  N   +G  DWK++   I  H+ S EHR  ++    R +   ++   + K+I  ER YWR+VL+RVVAVI  + ER L FRG +E+ G   +GNF+G++EL+AKFDPFLAEH+++FG  G G  SYLS T+ EE + LM +   ++I ++IK+SKYF + VDSTPD++H DQL  I R+V+  +   +ERFL F  IENH+G+ LA+  +   E ++GL+  +CR QSYDNA NM+GKY G++A + ++N    ++PC+AHSLNLVG +  D   E+  FF  +Q +Y F +SST RW K+     + V                                         TR+EA+ L +K++  E A +  FWD +L+R  A S  LQ   + +   + L  SL  ++   +++F+  +  A  +    + +Y    +R KK+    D +  EP ++   K+ FR   F  +++ + + L  R + Y  ++++F  L   + +S  +L    N++   YP D++ SL  EL+Q+  +I       HP+ +   + +   NL+  FPN+   LR+FL + I NC GERSFSKL  IKN LR  M Q  LN+L+LL+   D ++ ++FD L++ +A +K RKK
Sbjct:   34 NGQTVTRQWLLYSPSTGCVYCFACKLFS-SKHNTFVHGFSDWKHS-ERIGEHEGSVEHRACMLALYNRSRGTATIDSDIVKQIDAERQYWREVLKRVVAVIQFLGERGLAFRGDDELLGSAHNGNFLGIIELLAKFDPFLAEHLQRFGGKGKGSVSYLSSTVCEEFIHLMGQRTKQAIVNEIKESKYFSVIVDSTPDLAHVDQLTFIFRFVNN-DGHVVERFLAFEPIENHSGDSLAECVVAMVE-NLGLDLSNCRGQSYDNASNMSGKYNGIQAHLKQRNPLICYVPCAAHSLNLVGVNAVDSSPEAGRFFDFVQAMYTFCASSTHRWGKVFHMEEKCV-----------------------------------------TRSEASALCDKLDTLEMAFMAYFWDTILQRFQASSLQLQKHDIDICTATQLLLSLRDFVAAQRDNFEVFEGAALNVTTAVSQEYRHDLQRTKKRKIMSDDSA-EPGVAFNGKDKFRIETFNVVIDKLVSCLNHRLNAYTHLTELFDVLFMPDNMSNSELTLKANSLAAAYPSDLNMSLADELIQYKSFITE--KEKHPSKM--LKTMINLNLQSTFPNVYIALRLFLTVPITNCEGERSFSKLARIKNELRIRMRQNRLNSLSLLAIESDLVRQLNFDELVDDFARKKSRKK 656          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 385.571 bits (989), Expect = 1.038e-116
Identity = 245/765 (32.03%), Postives = 408/765 (53.33%), Query Frame = 1
Query: 1489 SPNANRE------NDVGLWG-ELSSEDTLYWIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTY--LTRK--SNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI-ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEAL----NAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNS-FDEIKIEAKKLLP--NTDYTVKRKRF---KKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIE----LSQEDLKQHVNNVVEKYPD----DIDDSLFFELLQFHEYIRNDWPNDHPNHLSF--YEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKVL 3687
            SPN + E       D  LW   +S  D +  +  GP       + F    Q       R     L +    N EK  R W+VYS +   VFCF CKL    +  L   G  DW N    ++SH+ S +H   ++ +  L R+   N ++  Q    ++ ER  W  VL+R+ ++  ++  RNLPFRGS++   ++ +GNF+  +EL+A+FD     H+ +  +  S +T YL +    E+++++    +++I   IKQ+KY+ + +D TPDISHK+Q+ +++R V+ +    I E FL ++ +   TG  L+++ LE   + +G+ F+DCR Q+YDN  NM GK +G++A++L+ N +A F+PC+AH++NLV +  A    ++I++FG +Q ++ FFS++T+RW+ L++    T+KS S  RW +R +SV  +    + V EAL     A+ E        R+EA  L  ++  F F +  + W +VL   + V+K LQS  + LD+ + L  +    +T  + S F E    AK+L    N +  +K+KR    K++F  E     EP   A++      F  ++++   +L +R +   ++   FG L + +    +S++DL  H  +V +K  D    DID     E++Q  E I  + P   P   +F     + + +L+  +PNL   LRI L L +   + ERSFSKLKLIK +LRSTM Q+ L+ LA++S N +   ++  D LI+ +A  K R+ +L
Sbjct:   80 SPNDDGEVNVPSSKDPALWPVHISDSDRVELVRGGPLMV---PDTF----QFPRGPDGRAFHAGLQYKSLPNKEKIKRSWMVYSAQSNAVFCFPCKLFGTKSTRLTKTGYSDWSNINICLRSHEGSPDHTKCMLQWRELDRRLRKNLAIDQQELSLMEAERKRWHDVLKRLFSITLSLATRNLPFRGSSQSLYVQDNGNFLKEVELLAQFDSVTEGHVARIKDDAS-RTHYLGQQTQNEIIEIICSQTIQTIVAKIKQAKYYAIILDCTPDISHKEQMSLVVRIVELVPEPHIREYFLGYMNVVETTGLNLSNVVLEKL-RALGIPFEDCRGQAYDNGANMKGKRQGVQARLLQLNPRAAFVPCAAHTMNLVISDAAKSSTDAISYFGYLQRLFCFFSAATQRWDILLKHVKLTLKSWSDVRWESRLQSVVAVRSQVKEVREALLEARQAVTEPV-----ARSEAQGLAEEVGSFRFLICTVVWAEVLSVTSQVNKVLQSSSMQLDIAARLIKTAKESLTKYRQSGFSEAIESAKELCEALNIEPELKQKRLRSTKRQFGYE--APDEPFSDAQKRLEVEFFNHVVDSALTSLQERFETMSQVRDTFGVLLDFQKVHGISKQDLHNHCMDVEKKLTDKGEADIDGQ---EMMQ--EII--NLPQLSPQTTAFELLTYLHDNSLQEVYPNLWIALRIALTLPVTVASAERSFSKLKLIKTYLRSTMGQERLSGLAVISINAEVAHSLSLDDLISDFAARKARRALL 821          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000025204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:7364240:7371214:-1 gene:ENSAMXG00000024490.2 transcript:ENSAMXT00000025204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 363.999 bits (933), Expect = 8.510e-110
Identity = 241/716 (33.66%), Postives = 386/716 (53.91%), Query Frame = 1
Query: 1627 NDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTY--LTRK-SNYSVSDQLQKEIQQERI-YWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVD-QINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNR-TVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLK-NSFDEIKIEAKKL---------LPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLKQHVNN--------VVEKYPDDID-DSLFFELLQFHEYIRNDWPNDHPNHLS------FYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKK 3681
            ++N  R  +K  +     NGEK  R WLVYS    +VFCF C +L   +  L+  G   WKN    +K H+ S  H + +  +  L R+  N +  DQ Q+ + Q  I +W+ V+ RV+A+IC + ERN   RG+  +     +GNF+  +EL+AKFDP + EHIR+  N    K  YLS TI  E++ L+   VL+ I   I Q  Y  + +D TPDISHK+QL +++R V+   +    E F  FI++E+ +G+ L ++ L+  +K   L+  DCR QSYDN  NM G+ +G+RA++L+ N+KA+ +PCS+H LNLV    A   + S +FFG++Q +YN FSSS +RW  L +   + T+K LS TRW AR +SVKV+      ++EAL+A+      +G  + ++  + +      F L  I W  VL ++N VSK LQSP V++    +    +  Y+ + + N     + +AK +         LP      K+++F+ +  +E Q+T +      E FR + F+ +++    +L  R      +  ++ FL     S++++KQ + N         +E+   DID D L FE+        N   +  P+H++         I  EK L++ +  L   LR+ L L ++  +GERSFS LKLIK ++RSTM Q+ L  LAL+S   +  +++D + ++  +A  K  K+
Sbjct:   50 SENPPRRFTKENYRRTMKNGEKILRSWLVYSMSTDSVFCFPCTVLGKRDNALSNCGFHKWKNLTYHLKEHEYSKGHCDNMRNWHELQRRLQNKTTIDQRQQTLMQIEIEHWKAVIRRVIAIICHLAERNQALRGTTSVLYDPHNGNFLAQVELMAKFDPVMNEHIRRRQNQ-EAKVHYLSGTIQNEIIALIGNKVLEEI---ITQRDY-SVIMDCTPDISHKEQLSVVLRLVNCDPSVSIAEHFFGFIDVEDTSGKGLTEVLLDHLQKH-NLSISDCRGQSYDNGSNMMGQKQGVRARILQLNNKALCIPCSSHKLNLVVADAAKSSVLSTSFFGVLQRLYNLFSSSVQRWAVLRKHVKQLTLKPLSATRWEARIDSVKVVRYQLPEILEALSAL----QTFGIEKGDSETMSS-----SFLLCTIIWYNVLYQVNHVSKLLQSPNVSMGTLRAETEGVREYLEDFRENRLASCQTDAKDIAENLDMEMNLPEKKQRKKKRQFQYEGTEETQSTPD------ETFRRDFFLPLVDTALRSLGDRLSRLKGVYDLYDFL----FSKDNMKQTIKNGKLHERCKKLEQTLHDIDADDLAFEI--------NSSLHTFPDHVATCPFDMLNYIYSEKLLDL-YSTLSIALRLLLTLPVSVASGERSFSALKLIKTYMRSTMGQERLTGLALMSIEREVCRSLDMEDIVVAFAEAKVHKQ 731          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000033195.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11277158:11279506:-1 gene:ENSAMXG00000030798.1 transcript:ENSAMXT00000033195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 363.229 bits (931), Expect = 5.728e-109
Identity = 239/756 (31.61%), Postives = 386/756 (51.06%), Query Frame = 1
Query: 1513 DVGLWGELSSEDTLYWIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTN-GEKYTREWLVYSPKIGNVFCFVCKLLT-------ASNFNLATNGLR----DWKNAGSSIKSHQNSSEHRNALVTYLTRKSNY----SVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNP--GSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYV-----DQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKK---------FPDE-DQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNI-ELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRK 3678
            D GLW      D L   ++    C+ ++E    +K    D   +     L + +  N  EK  R+WL++S     +FC  C L +        S  N + +GL+     W+        H+  + H+   V + + + +      V   LQK++Q E     K+LER++ V   +  RNL FRG         +GNF+G LEL+A +DPF+ EH+ K      GS  T YLS     E ++L  K VL +I  + + + Y+ +  DSTPDISH +Q  +++RYV     D+  +K +ERF+ F +    TG+ ++++ +E  + + G+  Q+CR Q YDN  NM+GK KG++A++L+ N  A F PC+ H+LNLVG   A+ C E   FFG +  +YN FS+S ERW  L E +  ++  LS TRWSAR  +V+V+  +  +++EAL  ++   +     ++EAN L+N  + F+  +L+  W ++L+ ++  +  LQ+  ++LDV ++   +L   +  L+N +D +  EA  +    D       F+ +          PDE  Q     E S K  FRNN+F   +++I + L  R      I + F  +  + ++++  +K     + + Y  D+      E+L F       +P +  + L     I E  L+  F  +   LRIF  L I    GER+FSKLKL+KN+LRSTM Q  LN+LA+LS      K +DF  LI+ +A +K R+
Sbjct:   32 DPGLW-----PDKLTAQQRETLVCRLASERVDLTKVAPKDKEGKAFPDYLQYVKSANMREKIRRDWLIHSDSAKALFCIPCLLFSHEQTRPSKSALN-SKDGLKLSDIKWQKMYRKFPEHEKHTPHKQCYVKWKSLQHSLLVATGVDGHLQKQLQTEAEKHTKILERLLDVTLHLASRNLAFRGKTSNLDDVHNGNFLGTLELLAHYDPFIHEHLEKVKQKKKGSRLTHYLSPDTQNEFIELCGKRVLSTILKEREDAIYYSVICDSTPDISHTEQNVILVRYVHQDKEDRGVWKIVERFIEFKDFHKKTGQEISEMIIEALQSN-GIPLQECRGQGYDNGANMSGKVKGVQAQILKANPLATFSPCATHTLNLVGVHAAESCPEVATFFGSVNRLYNLFSASPERWAILKEKTGCSLHRLSDTRWSARIAAVRVVAAHLPSILEALECVLATCSLTSEAKSEANGLINYFKTFDAIVLLTVWVKILQCIDNRNVILQAGDISLDVEAANIKALQEEMQALRNRWDSLLAEATLVAHAMDVP---DHFRSEERRKRKRKCMPDEMRQEDATTEDSVKNAFRNNIFFVAMDSIISALSARFQTTANICETFAPILKLSDMTEAQIKTTCRALAKIYHMDLSQEFENEVLHFCTIYDATFPKNLSS-LELLNAIWEMQLQSIFGEICIALRIFCTLPITVAGGERAFSKLKLVKNYLRSTMGQDRLNSLAILSIESQLAKQLDFTDLISDFANKKTRQ 776          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO40662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J7])

HSP 1 Score: 65.855 bits (159), Expect = 8.391e-11
Identity = 69/314 (21.97%), Postives = 145/314 (46.18%), Query Frame = 1
Query: 2821 TRNEANNLLNKMEEFEFALLVIFWDQVLE---------------------RMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQR-SDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDID--DSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAF-PNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKVL 3687
            +R  AN LL+ M +FEF + +I   + L                      ++++V K+LQ+P+  +DV   L+        +L   FD        ++P+     + ++ ++  P           S  E ++ +  + +++++   + +  S   + +SK+   +  + ++       +   V+ Y DD++  D L  EL+++    R+ W       +    +   KN +  F PN+  +LRI   L + +   ERSFS +K +K +LR+TMS +   +LAL+S + +  +++D D++I+ +A    R+ ++
Sbjct:   20 SRTRANGLLSTMSKFEFTITMITVMKCLSVVKPLSIQLQKRASDIYRAYSQVSSVKKDLQAPRRDIDV---LFVKWYESSVDLGKDFD--------IVPSMPRIARIQQHRQNTPSS---------SPCEYYKRSQGIPLVDHLSTEMDKFFSADQMNVSKLISLVPEVLVATNGCD--LEEAVKFYTDDLESPDVLDVELVRW----RSKWTRVEEESIPRSAVDALKNCDAEFYPNVHVLLRILCTLPVTSAESERSFSTMKRLKTYLRNTMSTEREPSLALISVHYN--RSLDVDAIIDTFATRHPRRLLI 305          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO43282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ18])

HSP 1 Score: 61.2326 bits (147), Expect = 2.482e-9
Identity = 80/406 (19.70%), Postives = 167/406 (41.13%), Query Frame = 1
Query: 1768 SNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKS--NYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINF-FG-LIQEVYNFFSSSTERWNKLVEFSN------RTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFA-----LLVIFWDQVLERMNAVSKNLQS 2940
            ++F++   G RD       +  H   +EH+ A  T    KS  ++ V+D+ +  +    + +             I+E NLPF  +        +G      EL  K  P  +E  +K+G   +   + ++  +  E+LD + + +         +++ F +++D + D        +++R  D    +   +F +   I + T + + +   + F +D  + +++    S DNA    GK+ G+      KN       C  H ++   + GA    E+  F  G  + ++Y +F +ST+R   L +F +      R +     TRW +R   V  + + Y ++          + F       ++  L ++ E+ FA     + ++F+  +L   + ++K LQ 
Sbjct:    6 ASFSVCHQGKRD-------VDRHLAGTEHKRASKTTSEHKSVKSFFVADKQKDAVTNAEVLYTGY----------ILEHNLPFESTAH------AG------ELFRKMFP-DSEIAKKYGCAPTKTAAIVNYALAPEMLDPVVQYI---------KTQPFSLAIDGSSDTGTASMYPLVVRIYDVNRGEVASQFWHMCLISDCTAQGIFNSVSDVF-RDYEVPWENVIGLSLDNASVNMGKHNGLYRHFERKNASVYTFGCPCHIVHNTASYGAKAYAEAAGFDLGDFLVDIYYYFDNSTKRQASLKDFCDFCDQDYRKILKYGATRWLSRELCVSRVLKQYPSL---------QSYFASQPELRSDKRLCRLREY-FADPXTEIHLMFFQSILPVFSELNKQLQG 361          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO40596 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q7])

HSP 1 Score: 56.6102 bits (135), Expect = 3.942e-9
Identity = 27/76 (35.53%), Postives = 50/76 (65.79%), Query Frame = 1
Query: 3451 FPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRK 3678
            +PN+  +LRI   L + +   ERSFS +K +K +LR+TMS +  ++LAL+S + +  +++D D++I+ +A    R+
Sbjct:   78 YPNVHVLLRILCTLSVTSAESERSFSTMKRLKTYLRNTMSTERESSLALISVHYN--RSLDVDAIIDTFATRHPRR 151          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO36427 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIQ1])

HSP 1 Score: 57.3806 bits (137), Expect = 1.420e-8
Identity = 58/233 (24.89%), Postives = 110/233 (47.21%), Query Frame = 1
Query: 2362 ENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNL-VGNSGADCCIESIN-----------FFGLIQEVYNFFSSSTERWNKLVEFSNR--TVKSLSKTRWSARSESVKVIHENYENVMEALNAII------------EDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYAS 2982
            E  TG+ +A++ LE  +  +GL+ ++ R Q YD A NM+    G  A+  E   KA+++  S H LNL + +S   C  +SI            FF  +Q    F +     + K V+ ++R   +  + +TRW+AR  +    ++++  ++ +L  II            +DA++   +++ A +LL  +  F F +  +   + L  +  ++  LQ   V +    S++AS
Sbjct:   21 EKKTGQEIANVILEKLQ-SLGLDPKNIRGQGYDEAANMSSDNVGSPAQNQEA-PKAVYVHYSGHCLNLFIAHS---CHQQSITSAIDKLKQCSLFFLEVQNEKVFLT-----FEKAVDDADRRKALVYMCRTRWAARHNAYTHFYQSFTFIITSLENIIYGANSELMGGEHQDASWDRRSKDNAASLLASLTSFYFIVSFLVLYEFLSHLAGITVKLQGRAVDIFKGLSVHAS 243          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO32247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL6])

HSP 1 Score: 49.6766 bits (117), Expect = 4.602e-7
Identity = 28/71 (39.44%), Postives = 46/71 (64.79%), Query Frame = 1
Query: 3448 AFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYA 3660
            AF N+  +L+I + L I++ + ERS S L+ +K +LRSTM++  LN LAL+  + D    +D D +I+ +A
Sbjct:   47 AFVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKD--MDLDLDRIIDLFA 115          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 407.142 bits (1045), Expect = 2.488e-124
Identity = 244/701 (34.81%), Postives = 395/701 (56.35%), Query Frame = 1
Query: 1627 NDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTR----KSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI-ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLY----ASLASYITNLKNSFDEIKIEAKKLLP--NTDYTVKRKRFKK-KFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIE-LSQEDLKQH---VNNVVEKYPD-DIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRK 3678
            ND+  R C    F     +GEK  R WL+YS    ++FCF CKL +  N NL T+G  +WK+A + + +H+ S EH N +  +       +S  ++  Q    +++ER+ WR VL R++A++ ++  RNL  RG  E      +GNF+  +EL+A+FDP + +H+ +     +   SY+   +  EL+DL++  +L +I DDIK++KYF + +D T DISH +QL +IIR V  +    I E F+ F+E E  TG++LA + L   E ++G++F+DCR QSYDN  NM GK KG++A++LEKN +A+FLPC AH+LNLV    A   ++++++FG++Q++Y  FS+S +RW  L    + T+KS ++TRW ++ +S++ +      V EAL   + D       + EA +L  ++  + F +  + W  +L  +  VSK +QSP + +D+  SL      SL SY     N F   ++ AK++    N +  +K+KR +  K     ++  EP   A +      F  +++   + + +R      +   FG LTN   L  E+L +    + N++    + D+D     EL+Q  + + N  P+  P+ L     + +K+L   +PN  T LRI L L +     ERSFSKLKLIK++LRSTMSQ+ L NLA++S N    + I +D +I+++A  K RK
Sbjct:  157 NDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNKNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLE-ELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSITLKSWTETRWESKIKSIEPMRYQGAAVREALIE-VRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSY---RANGFVNAQMAAKEMCKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILHFEKNWDLDSR---ELVQEIKNLPN-LPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARK 848          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 407.142 bits (1045), Expect = 2.488e-124
Identity = 244/701 (34.81%), Postives = 395/701 (56.35%), Query Frame = 1
Query: 1627 NDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTR----KSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI-ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLY----ASLASYITNLKNSFDEIKIEAKKLLP--NTDYTVKRKRFKK-KFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIE-LSQEDLKQH---VNNVVEKYPD-DIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRK 3678
            ND+  R C    F     +GEK  R WL+YS    ++FCF CKL +  N NL T+G  +WK+A + + +H+ S EH N +  +       +S  ++  Q    +++ER+ WR VL R++A++ ++  RNL  RG  E      +GNF+  +EL+A+FDP + +H+ +     +   SY+   +  EL+DL++  +L +I DDIK++KYF + +D T DISH +QL +IIR V  +    I E F+ F+E E  TG++LA + L   E ++G++F+DCR QSYDN  NM GK KG++A++LEKN +A+FLPC AH+LNLV    A   ++++++FG++Q++Y  FS+S +RW  L    + T+KS ++TRW ++ +S++ +      V EAL   + D       + EA +L  ++  + F +  + W  +L  +  VSK +QSP + +D+  SL      SL SY     N F   ++ AK++    N +  +K+KR +  K     ++  EP   A +      F  +++   + + +R      +   FG LTN   L  E+L +    + N++    + D+D     EL+Q  + + N  P+  P+ L     + +K+L   +PN  T LRI L L +     ERSFSKLKLIK++LRSTMSQ+ L NLA++S N    + I +D +I+++A  K RK
Sbjct:  157 NDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNKNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLE-ELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSITLKSWTETRWESKIKSIEPMRYQGAAVREALIE-VRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSY---RANGFVNAQMAAKEMCKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILHFEKNWDLDSR---ELVQEIKNLPN-LPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARK 848          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 407.142 bits (1045), Expect = 2.488e-124
Identity = 244/701 (34.81%), Postives = 395/701 (56.35%), Query Frame = 1
Query: 1627 NDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTR----KSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPI-ERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLY----ASLASYITNLKNSFDEIKIEAKKLLP--NTDYTVKRKRFKK-KFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIE-LSQEDLKQH---VNNVVEKYPD-DIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRK 3678
            ND+  R C    F     +GEK  R WL+YS    ++FCF CKL +  N NL T+G  +WK+A + + +H+ S EH N +  +       +S  ++  Q    +++ER+ WR VL R++A++ ++  RNL  RG  E      +GNF+  +EL+A+FDP + +H+ +     +   SY+   +  EL+DL++  +L +I DDIK++KYF + +D T DISH +QL +IIR V  +    I E F+ F+E E  TG++LA + L   E ++G++F+DCR QSYDN  NM GK KG++A++LEKN +A+FLPC AH+LNLV    A   ++++++FG++Q++Y  FS+S +RW  L    + T+KS ++TRW ++ +S++ +      V EAL   + D       + EA +L  ++  + F +  + W  +L  +  VSK +QSP + +D+  SL      SL SY     N F   ++ AK++    N +  +K+KR +  K     ++  EP   A +      F  +++   + + +R      +   FG LTN   L  E+L +    + N++    + D+D     EL+Q  + + N  P+  P+ L     + +K+L   +PN  T LRI L L +     ERSFSKLKLIK++LRSTMSQ+ L NLA++S N    + I +D +I+++A  K RK
Sbjct:  157 NDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNKNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLE-ELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSITLKSWTETRWESKIKSIEPMRYQGAAVREALIE-VRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSY---RANGFVNAQMAAKEMCKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILHFEKNWDLDSR---ELVQEIKNLPN-LPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARK 848          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 5.724e-29
Identity = 101/374 (27.01%), Postives = 184/374 (49.20%), Query Frame = 1
Query: 1702 EWLVYSPKIGNVFCFVCKL--LTASNFNLATN--GLRDWKNAG---SSIKSHQNSSEHRNALVTYL--------TRKSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQD-CRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSS--TERW----NKLVEFSNRTVKSLSKTRWSARSESVKVIHE 2757
            +WL YS    + FC+ C+   L AS  ++ T+  G ++WK A      +  H  S  H  A++ +         T   + S+  +  K +++ R Y + V E ++        +N+  RG  E   ++  GNF+ ++EL+AK +P +   +      G    + L      E++D +A+ V  SI+ ++ +S+ F + VD T D+S K+Q+  +IRY    N    E FL F   +      L+   +E  +K  GL++++    Q+YD A  M+GK  G++A++  +   A ++ C+AH LNLV         E+  FF L+Q++Y F S S   +RW     ++ +  ++ +K + + + S+  E+ K + E
Sbjct:  129 KWLEYSQSKDSAFCYACRHFGLPASGESVLTSEEGFKNWKKATFKDGGLLGHARSEAHTTAMLAWAEYEKSTSGTASLSASLDAEYSKLVKENREYIKVVGETLL----LTATQNIAQRGHKES-EVDSKGNFLAIMELLAKNNPIVKRKM-----AGQRNATCLGHDTQNEMIDCLAEMVRSSITGEVAESEAFSILVDETKDMSKKEQMSFVIRYY--YNGSVCECFLAFEAAQRLNAAALSQKIIEILQKH-GLDYKNHLVGQAYDGASVMSGKNTGVQARIKSEAPLAFYVHCNAHCLNLVLVDSVKFIPEANCFFSLLQKLYVFVSGSYVHQRWLEIQREMSQGKSKWLKRILERKQSSGQETPKALLE 489          

HSP 2 Score: 53.5286 bits (127), Expect = 1.352e-6
Identity = 27/72 (37.50%), Postives = 46/72 (63.89%), Query Frame = 1
Query: 3469 ILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKV 3684
            + ++ L L ++  + ERSFS LKLIK  LRST+S + L+NL +LS    + +AI+ D  ++ +A +   ++V
Sbjct:  586 LCKVALALPVSTASCERSFSTLKLIKTALRSTISDERLSNLGVLSVESRRARAINLDDFVDVFAKKHSNRRV 657          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000041223.1 (zinc finger MYM-type protein 1 [Source:NCBI gene;Acc:101155882])

HSP 1 Score: 124.405 bits (311), Expect = 1.748e-28
Identity = 112/445 (25.17%), Postives = 209/445 (46.97%), Query Frame = 1
Query: 1678 TNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAG--------SSIKSHQNSSEHRNALV---TYLTRKSNYSVSDQLQKE--IQQERIYW-RKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEI-ENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYG-NTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVC 2964
            TN E+Y   WL  S     ++C+ C L     F L  +G+  W + G         + K HQN++ H  ++V   T+   +    +++  ++E  +  E++   R++L+R++  +  + ++ L FRG +E  G    GN+  LL +IA+ +  L  H+    N     TS     I ++L+  + + +   I  ++K + +  + V+ T D S+  QL + +RYV +   K  ERF+ F ++      + +A + ++F  ++  L+     +Q ++ A   +    G++AKV E    A+F+ C AH L+LV + GA    E   FF  +  +  FFS S  R   L E   R +  ++ T W + S  V  + E  E + E    I+E+ + Y  ++   A+     ++ FEF  L+  ++ +    + +   LQ  K  +  C
Sbjct:   57 TNYERYP--WLTGSEVHCKLYCWECLL-----FALDRHGV--WSHTGFGNLTCLTKAAKKHQNTAGHLQSIVLSKTFGESRVELQLNEHARRETELHNEKVKKNREILKRLIDCVLFLGKQELSFRGRDESGGSSNRGNYCELLSVIAESNTDLHYHLST--NEAFSGTS---GKIQDDLISAIDEVIRDEIRREVKNAPFVSVMVEETTDASNAAQLALALRYVTRSGVK--ERFVRFEDVTSGKRADDIAGLVIKFLLENECLD--KVVAQCFEGATVTSSGLNGVQAKVKESAPLALFIHCYAHQLSLVLSQGASKLKECKIFFAHLNGLVAFFSRSPWRTQLLDEICQRRLPGVTPTPWQSTSRVVNTVFEKREALKELFGHILENHSEYDEDSVRCADGFKALLDCFEFCFLLHTFNGIFHYSDMLFSILQDKKSDVQFC 483          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000032685.1 (SMESG000032685.1)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 344/366 (93.99%), Postives = 344/366 (93.99%), Query Frame = 1
Query: 1192 MKRNYASGAFXXXXXXXXXXXXXXXXXLDCFFTKDSATESEFVAQEDRHQSDQIEVSSSTSNQPIFTGSSNQVFNDFENNLELVDNINNENLVESLIESSPNANRENDVGLWGELSSEDTLYWIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQL 2289
            MKRNYASGAFKRKKKAEREEEIKKIPKLDCFFTKDSATESEFVAQEDRHQSDQIEVSSSTSNQPIFTGSSNQVFNDFENNLELVDNINNENLVESLIESSPNANRENDVGLWGELSSEDTLYWIEKGPESCQHSTENFHSSKQLYNDNT                  YTRE LVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEH NALVTYLTRKSNYSVSDQLQKEI QERIYWRKVLERVVA ICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQL
Sbjct:    1 MKRNYASGAFKRKKKAEREEEIKKIPKLDCFFTKDSATESEFVAQEDRHQSDQIEVSSSTSNQPIFTGSSNQVFNDFENNLELVDNINNENLVESLIESSPNANRENDVGLWGELSSEDTLYWIEKGPESCQHSTENFHSSKQLYNDNT------------------YTRESLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHHNALVTYLTRKSNYSVSDQLQKEI-QERIYWRKVLERVVAFICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQL 347          

HSP 2 Score: 423.32 bits (1087), Expect = 2.362e-131
Identity = 214/218 (98.17%), Postives = 216/218 (99.08%), Query Frame = 1
Query: 3028 KIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKK 3681
            ++EAKKLLPNTDYT KRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMI NCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKK
Sbjct:  346 QLEAKKLLPNTDYTAKRKRFKKKFPDEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLKQHVNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMITNCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKK 563          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 337.421 bits (864), Expect = 1.399e-95
Identity = 221/753 (29.35%), Postives = 396/753 (52.59%), Query Frame = 1
Query: 1510 NDVGLWGELSSEDTL-YWIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQLQKEIQQ----ERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGK---TSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVE-FSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKN--SFDE---------IKIEAKKLLPNTDYTVKRKRFKKKFP---DEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTN-IELSQEDLKQHVNNVVEKYPD----DIDD-SLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKK 3681
            ND   W    ++  L   IEKGP       +N  S+  L  +   R  SK  F+ +  NGEK+ REWL+YSPK    FCF CKL       L   G  DW++   ++  H+ ++ H      +   K N      + K +Q+    E+  W ++++R+++V+  +  + L FRGS+     + +GNF+  +E+I KFD  +A+HI++   P + K     Y       E++ ++A  + K I   IK++KYF + +D TPD  H +Q+ M+IRYV   N+   E  LN++E                      LN  D R Q YDN  NM+GK++G++ ++L+   +A+F+PC+AH+LNL  N  A+    +++FF  +  VYNFFS+S  RW  L +   + T+K +S+TRW AR ++++ +      + ++L  I E+++     R+EA  L NK++ ++F   +I W ++LE+++ +SK +Q     +  C+     +  +  +++N  SF+          + +E +   P  + +V+ +  +K+F    DED      + + KE+F+ + F  IL+   ++L  R +      + FGFL   I++  E++K+   ++  K+ D    DI    L+ EL+     I++      P  L   + + + NLE +FPN+ T L++ L + +   +GERSFSKLK+IKN LR++M+Q+ L+N+++++   +   + + +  + ++A +K R++
Sbjct:  106 NDPACWPLALTDKVLDILIEKGP------VQNIQSTYPL--NEFGRSFSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFGKQEIKLVNEGFNDWQHISDNLSRHEKTTLHIENCTCWKKLKLNLKRKTTIDKNMQRYYDAEKKRWCQIVKRMISVVQFLAGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVYIKNY---EVELNYLE----------------------LNISDMRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVKSLTLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSM-PTVRHEAECLANKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFP-AEISVRSRHHRKQFSYERDEDI-----QFTPKEHFQISFFNVILDTAISSLTTRFETLSGFERCFGFLYKFIDMEHEEIKKSCFDLHNKFKDGESCDISGVELYQELVSLKIIIKD---RKQPEEL--IKFLYKYNLETSFPNVATSLKLLLTVPVFVASGERSFSKLKIIKNHLRTSMTQECLSNISIIAIENEIADSTNIEGAVEEFASKKSRRE 813          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 336.65 bits (862), Expect = 1.456e-95
Identity = 221/753 (29.35%), Postives = 396/753 (52.59%), Query Frame = 1
Query: 1510 NDVGLWGELSSEDTL-YWIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQLQKEIQQ----ERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGK---TSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVE-FSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKN--SFDE---------IKIEAKKLLPNTDYTVKRKRFKKKFP---DEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTN-IELSQEDLKQHVNNVVEKYPD----DIDD-SLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKK 3681
            ND   W    ++  L   IEKGP       +N  S+  L  +   R  SK  F+ +  NGEK+ REWL+YSPK    FCF CKL       L   G  DW++   ++  H+ ++ H      +   K N      + K +Q+    E+  W ++++R+++V+  +  + L FRGS+     + +GNF+  +E+I KFD  +A+HI++   P + K     Y       E++ ++A  + K I   IK++KYF + +D TPD  H +Q+ M+IRYV   N+   E  LN++E                      LN  D R Q YDN  NM+GK++G++ ++L+   +A+F+PC+AH+LNL  N  A+    +++FF  +  VYNFFS+S  RW  L +   + T+K +S+TRW AR ++++ +      + ++L  I E+++     R+EA  L NK++ ++F   +I W ++LE+++ +SK +Q     +  C+     +  +  +++N  SF+          + +E +   P  + +V+ +  +K+F    DED      + + KE+F+ + F  IL+   ++L  R +      + FGFL   I++  E++K+   ++  K+ D    DI    L+ EL+     I++      P  L   + + + NLE +FPN+ T L++ L + +   +GERSFSKLK+IKN LR++M+Q+ L+N+++++   +   + + +  + ++A +K R++
Sbjct:  106 NDPACWPLALTDKVLDILIEKGP------VQNIQSTYPL--NEFGRSFSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFGKQEIKLVNEGFNDWQHISDNLSRHEKTTLHIENCTCWKKLKLNLKRKTTIDKNMQRYYDAEKKRWCQIVKRMISVVQFLAGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVYIKNY---EVELNYLE----------------------LNISDMRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVKSLTLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSM-PTVRHEAECLANKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFP-AEISVRSRHHRKQFSYERDED-----IQFTPKEHFQISFFNVILDTAISSLTTRFETLSGFERCFGFLYKFIDMEHEEIKKSCFDLHNKFKDGESCDISGVELYQELVSLKIIIKD---RKQPEEL--IKFLYKYNLETSFPNVATSLKLLLTVPVFVASGERSFSKLKIIKNHLRTSMTQECLSNISIIAIENEIADSTNIEGAVEEFASKKSRRE 813          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000047334.1 (SMESG000047334.1)

HSP 1 Score: 327.02 bits (837), Expect = 6.442e-95
Identity = 213/723 (29.46%), Postives = 378/723 (52.28%), Query Frame = 1
Query: 1510 NDVGLWGELSSEDTL-YWIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTY----LTRKSNYSVSDQLQKEIQQERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGK---TSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVE-FSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKN--SFDE---------IKIEAKKLLPNTDYTVKRKRFKKKFP---DEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTN-IELSQEDLKQHVNNVVEKYPD----DIDD-SLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNL 3591
            ND   W    ++  L   IEKGP       +N  S+  L  +   R  SK  F+ +  NGEK+ RE L+YSPK   +FCF CKL       L   G  DW++   ++  H+ ++ H      +    L  K   ++   +Q+    E+  W ++++R+++V+  +  + L FRGS+ I   + +GNF+  +E+I KFD  +A+HI++   P + K     YL      E++ ++A  + K I   IK++KYF + +D TPD  H +Q+ M+IRYV   N+   E  LN++E                      LN  D R Q YDN  NM+GK++ ++ ++L+   +A+F+PC+AH+LNL  N  A+    +++FF  +  +YN FS+S  RW  L +   + T+K +S+T+W AR ++++ +      + ++L  I E+++     R+EA  L  K++ ++F   +I W ++LE+++ +SK +Q     +  C+     +  +  +++N  SF+          + +E +   P  +  V+ +  +K+F    DED      + + KE+F+ + F  IL+   ++L  R +      + FGFL   I++  E++K+   ++  K+ D    DI    L+ EL+     I++      P  L   + + + NLE +FPN+ T L++ L + ++  +GERSFSKLK+IKN LR++M+Q+ L+N+
Sbjct:  235 NDPACWPLALTDKVLDILIEKGP------VQNIQSTYPL--NEFGRSFSKVYFYRKLPNGEKFNRELLIYSPKNDAIFCFCCKLFGKQEIKLVNEGFNDWQHISDNLSRHEKTTLHIENYTCWKKLELNLKRKTTIDKNMQRYYDAEKKRWCQIVKRMISVVQFLAGQCLAFRGSSGILYEKNNGNFLKAIEMIGKFDDIMADHIKRVQEPNAPKNRMPHYLGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVHIKNY---EVELNYLE----------------------LNISDMRGQGYDNGSNMSGKHRRLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAIYNIFSASPFRWQVLKKNVKSLTLKQVSETQWEARIKAIRPLRNELGEIYDSLIEIAEESSM-PTVRHEAECLAMKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFP-AEIIVRSRHHRKQFSYERDED-----IQFTPKEHFQISFFYVILDTAISSLTTRFETLSGFERCFGFLYKFIDMEHEEIKKSCFDLHNKFKDGESCDISGVELYQELVSLKIIIKD---RKQPEEL--IKFLYKYNLETSFPNVATSLKLLLTVPVSVASGERSFSKLKIIKNHLRTSMTQERLSNI 912          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 317.39 bits (812), Expect = 6.302e-89
Identity = 211/754 (27.98%), Postives = 383/754 (50.80%), Query Frame = 1
Query: 1510 NDVGLWGELSSEDTL-YWIEKGPESCQHSTENFHSSKQLYNDNTVRYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATNGLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQLQKEIQQ----ERIYWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDPFLAEHIRKFGNPGSGK---TSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYFGMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLADISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLPCSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVE-FSNRTVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANNLLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLASYITNLKN--SFDE---------IKIEAKKLLPNTDYTVKRKRFKKKFP---DEDQTTTEPEISAKENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTN-IELSQEDLKQHVNNVVEKYPD----DIDD-SLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNLEIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNLALLSCNIDKLKAIDFDSLINQYALEKFRKKV 3684
            ND   W    ++  L   IEKGP       +N  S+  L  +   R  SK  F+ +  NGEK+ REWL+YSPK    FCF CKL       L   G  DW++   ++  H+ ++ H      +   K N      + K +Q+    E+  W ++++R+++V+  +  + L FRGS+     + +GNF+  +E+I KFD  +A+HI++   P + K     Y       E++ ++A  + K I   IK++KYF + +D TPD  H +Q+ M+I                                             D R Q YDN  NM+GK++G++ ++L+   +A+F+PC+AH+LNL  N  A+    +++FF  +  VYNFFS+S  RW  L +   + T+K +S+TRW AR ++++ +      + ++L  I E+++     R+EA  L NK++ ++F   +I W ++LE+++ +SK +Q     +  C+     +  +  +++N  SF+          + +E +   P  + +V+ +  +K+F    DED      + + KE+F+ + F  IL+   ++L  R +      + FGFL   I++  E++K+   ++  K+ D    DI    L+ EL+     I++      P  L   + + + NLE +FPN+ T L++ L + +   +GERSFSKLK+IKN LR++M+Q+ L+N+++++   +   + + +  + ++A +K R++ 
Sbjct:  106 NDPACWPLALTDKVLDILIEKGP------VQNIQSTYPL--NEFGRSFSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFGKQEIKLVNEGFNDWQHISDNLSRHEKTTLHIENCTCWKKLKLNLKRKTTIDKNMQRYYDAEKKRWCQIVKRMISVVQFLAGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVI--------------------------------------------SDMRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVKSLTLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSM-PTVRHEAECLANKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFP-AEISVRSRHHRKQFSYERDEDI-----QFTPKEHFQISFFNVILDTAISSLTTRFETLSGFERCFGFLYKFIDMEHEEIKKSCFDLHNKFKDGESCDISGVELYQELVSLKIIIKD---RKQPEEL--IKFLYKYNLETSFPNVATSLKLLLTVPVFVASGERSFSKLKIIKNHLRTSMTQECLSNISIIAIENEIADSTNIEGAVEEFASKKSRRET 795          
The following BLAST results are available for this feature:
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZMYM15.799e-3325.23zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM15.799e-3325.23zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM15.799e-3325.23zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM15.799e-3325.23zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
THAP121.254e-2624.21THAP domain containing 12 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CR762475.16.787e-6125.68pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
thap12a6.923e-1921.55THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GE... [more]
thap12b5.210e-1521.39THAP domain containing 12b [Source:ZFIN;Acc:ZDB-GE... [more]
si:ch211-240b21.21.353e-638.20si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000043220.16.626e-12538.28pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
tbx181.493e-3624.56T-box 18 [Source:Xenbase;Acc:XB-GENE-489907][more]
slc10a64.968e-2524.94solute carrier family 10 (sodium/bile acid cotrans... [more]
thap126.754e-1521.37THAP domain containing 12 [Source:NCBI gene;Acc:39... [more]
ENSXETT00000005329.12.843e-1119.96uncharacterized LOC100494784 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zmym14.723e-2622.76zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym14.723e-2622.76zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Thap122.423e-2523.52THAP domain containing 12 [Source:MGI Symbol;Acc:M... [more]
Zmym11.606e-2322.69zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym58.847e-636.59zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SVZ6|ZMYM1_HUMAN2.785e-3225.23Zinc finger MYM-type protein 1 OS=Homo sapiens OX=... [more]
sp|O43422|P52K_HUMAN6.022e-2624.2152 kDa repressor of the inhibitor of the protein k... [more]
sp|Q9CUX1|P52K_MOUSE1.695e-2423.5252 kDa repressor of the inhibitor of the protein k... [more]
sp|A6QPH9|ZMYM5_BOVIN1.969e-835.56Zinc finger MYM-type protein 5 OS=Bos taurus OX=99... [more]
sp|Q9UJ78|ZMYM5_HUMAN6.481e-832.43Zinc finger MYM-type protein 5 OS=Homo sapiens OX=... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A151J2H93.363e-17641.03Zinc finger MYM-type protein 1 OS=Trachymyrmex cor... [more]
A0A2S2QLG53.859e-17439.87Zinc finger MYM-type protein 1 OS=Sipha flava OX=1... [more]
A0A2S2Q4F27.344e-17041.04Zinc finger MYM-type protein 1 OS=Sipha flava OX=1... [more]
H3A5Q31.886e-16938.22Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
A0A2S2P9T62.002e-16941.04Zinc finger MYM-type protein 1 OS=Schizaphis grami... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035531.18.765e-14837.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042715.12.136e-14037.00pep primary_assembly:Astyanax_mexicanus-2.0:16:118... [more]
ENSAMXT00000036272.11.038e-11632.03pep primary_assembly:Astyanax_mexicanus-2.0:20:119... [more]
ENSAMXT00000025204.28.510e-11033.66pep primary_assembly:Astyanax_mexicanus-2.0:12:736... [more]
ENSAMXT00000033195.15.728e-10931.61pep primary_assembly:Astyanax_mexicanus-2.0:16:112... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406628.391e-1121.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432822.482e-919.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405963.942e-935.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364271.420e-824.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322474.602e-739.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028133.12.488e-12434.81zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.12.488e-12434.81zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.12.488e-12434.81zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000027735.15.724e-2927.01pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
ENSORLT00000041223.11.748e-2825.17zinc finger MYM-type protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032685.12.362e-13193.99SMESG000032685.1[more]
SMESG000061124.11.399e-9529.35SMESG000061124.1[more]
SMESG000061124.11.456e-9529.35SMESG000061124.1[more]
SMESG000047334.16.442e-9529.46SMESG000047334.1[more]
SMESG000061124.16.302e-8927.98SMESG000061124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024122 ID=SMED30024122|Name=Zinc finger MYM-type protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3977bp
TTTGAATTTTGATGAATTTTCGATTTCAAAGATCTTAGGTGTTATAAATG
TGTTTTTTATTTTGAAATTACGATATGGATGATATATTATTGATGAATTT
ATTCACAATAATTTTTCATTAACCTACTACGACATTACACACAAGAAAGT
AAATAAACACAAAACCGGCAGTGTGTTGTTACACAGTTCATTTGTTAAAA
AAACGTATTTTATACCCGAAAGAAACCAAGCCAGTGAAAGAAACATACAG
CGAACGATCCACTCGGTCTTTTTTGAGATGAACCTAGTAAATTCCACGCT
TCAAACCATGCAATATGGAGTGTCTACACTTTATTCTTTTTTTTGTGAAT
TTATCAGAGCTCTTATTGCATATATTTTGCATTGGGATCTCCGCAGTTAA
TACTTTATTTATTTATTTAAAAATTTCCTGTGTATCCACGATATGAATAG
TTTTTATTTATTTCTTGCTAAATATACCAGCAATGCTCATTATTATTTTA
TTTGCGGTCATTTCAACTATATATTTCTGAAGTTTACATCATATGCTATC
ATTTTATTTCTGAACCAGTATTTTGTCTTATTATTTATATACAGGCCCGG
ATTTACCTATAGGCAGACTAGGCACTGCCTAGGGGCCCCGCAGTTTTGGG
GGCCCAAAATCGAAATCATCTAAGGGGCCACAAAAAAAATATTTTTTTTA
ATGGATTTTTTATATACTAAAATATAAAAAAATTAAAATACAGTATAAAA
TACATGTATTATATAAAGAATTAAAAAAACATTGTACGTATGTTTTTATT
TAAGGAAATTTTCTAAAATACTAACAATTTGGGGCCCCAATAATTTTAAA
AGTTGTTATAGTTGAAAAAATATTTTTTCTTTATTTCCGCAACCTCCAAG
GGGGTTATCATTAGTGGAGTTTGTCGGTTGAAATTTGCGAAGGCGGGAAT
CGAATTGTTATTGTGTAGAAACATATTTTTTTGGAGTGTTGGTAAAAATT
TTATACACAAAAGAAAAAAATTATTTCAAACGAAATCGGCTTAAAAATAA
AAAATTTAAAATAAAGCAATTTTAGGACGAAGTGAGGCTTTTTTTTAATT
GATTAATTGTTAAGATCTAGGTATAGTATAAAAATATTAAAATTATTTAA
TCAATTTAATTAAAAAATACTATAATTAAATTTAAGATAGAATGAAACGA
AACTACGCAAGCGGAGCGTTTAAAAGGAAGAAAAAAGCAGAGAGAGAAGA
AGAAATTAAGAAAATTCCTAAGCTAGATTGTTTTTTCACTAAAGATTCTG
CAACCGAAAGTGAATTTGTAGCACAAGAAGATCGGCACCAAAGCGACCAA
ATAGAGGTCTCTTCCAGTACTTCAAATCAACCTATTTTCACTGGAAGTTC
AAATCAAGTTTTTAATGATTTCGAAAATAATTTGGAGCTGGTAGATAACA
TTAATAATGAAAATTTAGTGGAATCCCTGATTGAATCATCTCCAAATGCA
AATCGTGAGAATGACGTAGGATTATGGGGAGAATTGTCTTCTGAAGACAC
TTTGTACTGGATTGAGAAGGGCCCTGAAAGTTGCCAACATTCAACAGAAA
ACTTTCATTCTTCCAAACAGCTCTATAATGACAATACTGTTCGATATTGC
TCTAAGACTTTATTCTTTGATGAAAAAACAAATGGAGAAAAGTACACTCG
CGAATGGCTTGTATATTCGCCTAAAATTGGAAATGTTTTTTGTTTTGTTT
GCAAATTACTCACTGCTTCAAATTTCAATTTAGCAACCAATGGCCTGCGA
GATTGGAAAAATGCTGGTTCCTCAATCAAAAGCCATCAAAACTCTTCAGA
ACATCGTAATGCTTTAGTTACATATTTAACTAGAAAAAGTAACTATTCTG
TGTCGGATCAATTGCAAAAAGAAATACAACAAGAAAGGATTTACTGGAGA
AAAGTCTTAGAACGAGTTGTAGCTGTTATTTGCACCATTGTTGAACGAAA
TTTACCATTTCGAGGATCAAATGAAATTTTTGGAATGGAAGGAAGTGGCA
ATTTCATTGGACTCTTGGAACTTATTGCAAAATTTGATCCATTTTTAGCA
GAGCACATTAGAAAGTTTGGTAATCCAGGATCTGGAAAAACTTCTTATCT
CTCAAAAACAATTTTTGAGGAATTGCTCGATCTGATGGCAAAAACAGTAT
TGAAGTCGATTTCTGATGACATCAAACAATCAAAATATTTTGGAATGTCT
GTGGATTCCACCCCTGATATATCACACAAAGATCAATTGTGCATGATTAT
CAGATACGTTGATCAAATCAATTTTAAACCAATCGAGCGATTCTTAAACT
TTATTGAGATAGAGAATCACACTGGAGAATATTTAGCTGACATTTCATTG
GAATTTTTTGAAAAGGATATTGGGTTAAATTTTCAAGATTGCCGATCACA
ATCGTATGACAACGCTATGAATATGGCCGGAAAATACAAAGGAATGAGGG
CAAAAGTTCTTGAAAAAAATGATAAAGCAATTTTTTTACCGTGCAGTGCT
CATTCTTTGAACTTGGTTGGAAATTCAGGTGCGGACTGTTGCATAGAATC
AATCAATTTTTTCGGATTAATTCAGGAAGTTTACAATTTTTTTTCATCGT
CTACTGAGAGATGGAACAAGTTAGTTGAATTTTCAAATAGAACGGTAAAA
TCGTTATCAAAGACTAGATGGAGTGCTCGTTCTGAGTCAGTTAAGGTTAT
TCACGAAAACTATGAAAATGTAATGGAAGCACTAAATGCCATCATTGAAG
ATGCAAATTTTTATGGAAACACTAGAAATGAAGCAAATAATTTATTGAAT
AAAATGGAGGAGTTTGAATTCGCACTTCTCGTTATATTTTGGGATCAGGT
TCTAGAGAGAATGAATGCAGTTTCAAAAAATTTGCAAAGTCCTAAAGTCA
CATTAGACGTTTGTTCTTCGTTATATGCATCTCTAGCTTCATATATTACA
AATTTGAAAAATAGCTTTGATGAAATTAAAATTGAAGCTAAAAAATTGTT
ACCAAACACTGACTACACTGTCAAGAGAAAGAGATTTAAAAAGAAATTTC
CAGATGAAGATCAAACTACCACAGAACCAGAAATTAGTGCTAAAGAGAAC
TTTCGAAACAACGTCTTCATGAAAATTTTAGAAAACATCGAAAATAATTT
GATTCAGCGCTCTGATTGTTACTTGGAAATTTCTAAAGTGTTTGGTTTTT
TGACAAATATTGAATTGTCGCAAGAAGATTTGAAACAACATGTGAATAAC
GTTGTTGAAAAATATCCAGATGATATAGACGATTCACTTTTTTTCGAGTT
ACTACAATTTCACGAATATATCAGGAACGATTGGCCAAATGATCATCCAA
ATCATTTGAGTTTCTACGAGATAATTAAAGAAAAAAATTTGGAAATTGCT
TTTCCAAATTTGGAAACAATTTTAAGAATTTTTTTGTGTCTAATGATTGC
TAATTGCACTGGCGAAAGAAGTTTCTCAAAATTGAAGCTGATTAAAAATT
TTTTGAGGTCAACGATGAGTCAAAAAATTTTGAATAATTTGGCCTTATTA
TCTTGTAACATTGATAAATTGAAAGCTATTGATTTTGATTCATTGATTAA
TCAATATGCTCTAGAAAAATTTAGAAAGAAAGTTTTGTAAAATTATATTT
TTGACATGACATATGTATCTTATTTTTAAGCGGAATTATTTAATAAATAT
ATTTCAAAATATAAATAGGTAGTAAATAATTATTTCTTAAATACTTTTAG
CAAATAAAATAATCTACATAATTTCCTTGAAATATACTAATTAATTTTGA
GGGCCCCAAAAAGCTCCTTTGCCTAGGGCCAACAAATGCTTAAATCCGGC
CCTGCGTATGACAAGGTGTTAATATAATATTTTTACTTACAAAAAATACA
AAGTTACAAACAGGAAAATTATCAACG
back to top

protein sequence of SMED30024122-orf-1

>SMED30024122-orf-1 ID=SMED30024122-orf-1|Name=SMED30024122-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=833bp
MKRNYASGAFKRKKKAEREEEIKKIPKLDCFFTKDSATESEFVAQEDRHQ
SDQIEVSSSTSNQPIFTGSSNQVFNDFENNLELVDNINNENLVESLIESS
PNANRENDVGLWGELSSEDTLYWIEKGPESCQHSTENFHSSKQLYNDNTV
RYCSKTLFFDEKTNGEKYTREWLVYSPKIGNVFCFVCKLLTASNFNLATN
GLRDWKNAGSSIKSHQNSSEHRNALVTYLTRKSNYSVSDQLQKEIQQERI
YWRKVLERVVAVICTIVERNLPFRGSNEIFGMEGSGNFIGLLELIAKFDP
FLAEHIRKFGNPGSGKTSYLSKTIFEELLDLMAKTVLKSISDDIKQSKYF
GMSVDSTPDISHKDQLCMIIRYVDQINFKPIERFLNFIEIENHTGEYLAD
ISLEFFEKDIGLNFQDCRSQSYDNAMNMAGKYKGMRAKVLEKNDKAIFLP
CSAHSLNLVGNSGADCCIESINFFGLIQEVYNFFSSSTERWNKLVEFSNR
TVKSLSKTRWSARSESVKVIHENYENVMEALNAIIEDANFYGNTRNEANN
LLNKMEEFEFALLVIFWDQVLERMNAVSKNLQSPKVTLDVCSSLYASLAS
YITNLKNSFDEIKIEAKKLLPNTDYTVKRKRFKKKFPDEDQTTTEPEISA
KENFRNNVFMKILENIENNLIQRSDCYLEISKVFGFLTNIELSQEDLKQH
VNNVVEKYPDDIDDSLFFELLQFHEYIRNDWPNDHPNHLSFYEIIKEKNL
EIAFPNLETILRIFLCLMIANCTGERSFSKLKLIKNFLRSTMSQKILNNL
ALLSCNIDKLKAIDFDSLINQYALEKFRKKVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR008906HATC_C_dom
IPR025398DUF4371
IPR012337RNaseH-like_sf
IPR013809ENTH
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding