Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30024121
Length (bp)1148
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30024121) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30024121) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30024121) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30024121) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024121

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024121SMESG000077268.1 Contig1063GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024121SMESG000023248.1 Contig1063GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30024121SMESG000023248.1 dd_Smed_v4_1808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024121SMESG000023248.1 dd_Smed_v4_1808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024121SMESG000023248.1 dd_Smed_v4_1808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024121SMESG000023248.1 dd_Smed_v4_1808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024121SMESG000023248.1 Contig49102newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024121SMESG000023248.1 Contig49102uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30024121SMESG000023248.1 dd_Smed_v4_1808_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024121SMESG000023248.1 dd_Smed_v4_1808_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp74F (gene:FBgn0036769 transcript:FBtr0075155)

HSP 1 Score: 53.9138 bits (128), Expect = 5.580e-8
Identity = 37/121 (30.58%), Postives = 68/121 (56.20%), Query Frame = 3
Query:  183 NILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMXXXXXXXXXXXXXXXXXXXXXXXALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATW 545
             ++D   + E+   +++    Y+L+    I+C    +G  G+ +E + +L+ + +++ ++F+   IGG+L       V  +++ EMR T+   Y   + IT AW+LTQ RL+CCGVD  TW
Sbjct:   39 TLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTM-ALYGSRREITQAWDLTQERLQCCGVD--TW 156          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp74F (gene:FBgn0036769 transcript:FBtr0075154)

HSP 1 Score: 53.9138 bits (128), Expect = 5.580e-8
Identity = 37/121 (30.58%), Postives = 68/121 (56.20%), Query Frame = 3
Query:  183 NILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMXXXXXXXXXXXXXXXXXXXXXXXALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATW 545
             ++D   + E+   +++    Y+L+    I+C    +G  G+ +E + +L+ + +++ ++F+   IGG+L       V  +++ EMR T+   Y   + IT AW+LTQ RL+CCGVD  TW
Sbjct:   39 TLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTM-ALYGSRREITQAWDLTQERLQCCGVD--TW 156          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A4Z2DMG6 (Tetraspanin OS=Schistosoma japonicum OX=6182 GN=EWB00_011005 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.831e-53
Identity = 110/250 (44.00%), Postives = 160/250 (64.00%), Query Frame = 3
Query:   81 FRMTLSGRSIKXXXXXXXXXXXXXXXXXXXXGINNILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMXXXXXXXXXXXXXXXXXXXXXXXALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTGWPSPVYKDLYICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLYG 830
            +R  LSGR++ LI  +LN I +LF +  + +GI  I+DHG M E+   S+Y +G Y+LIF+G ++      G   + RE+  ++++++ +L +L +  FI GI++L+  SS+ DS KN M  +L + Y R  +ITDAWNL Q  LRCCGVDD+ WSIY  S+WD I N DL   N K+S  + +Y F P SCC   +D  TGWP+ +Y+D   CQ +Q+GPPN  NG  NDA+YY GC  +++SY+  Y 
Sbjct:    2 YRKYLSGRTVALILFVLNGISILFGITLISLGIVYIVDHGNMFEVVGSSLYTSGVYMLIFLGLVITIIALCGYIAADRENICLIVSYIFILGLLALLLFISGIMILSFRSSLGDSSKNLMIDSLRSHYGRHGIITDAWNLVQRNLRCCGVDDSGWSIYNGSWWDMIVNSDLYETNTKLSESSLFYLFVPESCCAKKLDGLTGWPTDIYRDKKRCQTWQYGPPNKRNGPHNDAIYYAGCFESLRSYINNYA 251          
BLAST of Tetraspanin vs. TrEMBL
Match: C1L5Y7 (Tetraspanin OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 6.151e-53
Identity = 110/250 (44.00%), Postives = 160/250 (64.00%), Query Frame = 3
Query:   81 FRMTLSGRSIKXXXXXXXXXXXXXXXXXXXXGINNILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMXXXXXXXXXXXXXXXXXXXXXXXALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTGWPSPVYKDLYICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLYG 830
            +R  LSGR++ LI  +LN I +LF +  + +GI  I+DHG M E+   S+Y +G Y+LIF+G ++      G   + RE+  ++++++ +L +L +  FI GI++L+  SS+ DS KN M  +L + Y R  +ITDAWNL Q  LRCCGVDD+ WSIY  S+WD I N DL   N K+S  + +Y F P SCC   +D  TGWP+ +Y+D   CQ +Q+GPPN  NG  NDA+YY GC  +++SY+  Y 
Sbjct:    2 YRKYLSGRTVALILFVLNGISILFGITLISLGIVYIVDHGNMFEVVGSSLYTSGVYMLIFLGLVITIIALCGYIAADRENICLIVSYIFILGLLALLLFISGIMILSFRSSLGDSSKNLMIDSLRSHYGRHGIITDAWNLVQRNLRCCGVDDSGWSIYNGSWWDMIVNSDLYETNTKLSESSLFYLFVPESCCAKKLDGLTGWPTDIYRDKKRCQTWQYGPPNKRNGPHNDAIYYAGCFESLRSYINNYA 251          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A2H1CDC1 (Tetraspanin family protein OS=Fasciola hepatica OX=6192 GN=D915_08046 PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.168e-52
Identity = 99/219 (45.21%), Postives = 137/219 (62.56%), Query Frame = 3
Query:  174 GINNILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMXXXXXXXXXXXXXXXXXXXXXXXALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTGWPSPVYKDLYICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLYG 830
            G+  I+D+  + E+   ++Y +G YILIF G I+      GT  + +E+R M + +  +L I  +F FI GI+VL   +S+ +  +  M  TL NQY R K+ITDAWN TQ  LRCC VDD+ W  Y +S+WD   N DL   N KI+  +P+Y+F P SCC T++D  TGWPS  Y DL  CQN+Q+GPP    G  NDA+YY GC N++K+Y+  YG
Sbjct:   33 GVYAIIDNANISELFGTTLYTSGVYILIFFGIIIVLVAICGTVAAEKENRCMNVTYSAILCIAILFLFISGIIVLVFKNSLGEVARTIMLSTLRNQYGRYKIITDAWNFTQTNLRCCAVDDSGWQAYNDSWWDTFVNKDLYENNAKIAATSPFYKFVPESCCKTIIDGLTGWPSTTYLDLPRCQNWQYGPPYHFEGPHNDAIYYGGCFNSLKNYISTYG 251          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A4S2LNT9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005916 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.864e-52
Identity = 98/219 (44.75%), Postives = 137/219 (62.56%), Query Frame = 3
Query:  174 GINNILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMXXXXXXXXXXXXXXXXXXXXXXXALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTGWPSPVYKDLYICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLYG 830
            G   I+D     E+T  ++Y +G Y+LIF G I+ F    G   + +E+R +L+ + V + I   F FI GI+VLA   S+    K  M  +L NQY R K+ITDAWN TQ+RLRCCGV+D  W +Y +S+WD   N D+   N K+SR +P+Y+F P SCC T++D  TGWP+  Y DL+ C  +Q+GPP+F  G  NDA+YY GC N ++ Y+  YG
Sbjct:   32 GTFGIIDSANESELTGSALYTSGLYMLIFFGLIVLFLAVGGDVAAEKENRCLLVTYCVAICITIFFLFISGIMVLAFKDSLGQRAKQVMVSSLRNQYGRYKIITDAWNATQSRLRCCGVEDLGWQVYNDSWWDLFVNTDIYERNTKLSRSSPFYKFVPASCCVTVIDGITGWPTDRYLDLHRCMTWQYGPPSFPYGPHNDAIYYAGCFNRLREYVNQYG 250          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1S8WSM2 (Tetraspanin family protein OS=Opisthorchis viverrini OX=6198 GN=X801_06679 PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 6.016e-52
Identity = 96/219 (43.84%), Postives = 137/219 (62.56%), Query Frame = 3
Query:  174 GINNILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMXXXXXXXXXXXXXXXXXXXXXXXALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTGWPSPVYKDLYICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLYG 830
            G   I+D     E+T  ++Y +G Y+LIF G I+ F    G   + +E+R +L+ + V++ I   F  I G +VLA   S+    K  M  +L NQY R K+ITDAWN TQ+RLRCCGV+D  W +Y +S+WD   N D+   N K+SR +P+Y+F P SCC T++D  TGWP+  Y DL+ C  +Q+GPP+F +G  NDA+YY GC N ++ Y+  YG
Sbjct:   32 GTFGIIDSANESELTGSALYTSGLYMLIFFGLIILFLAVGGNVAAEKENRCLLVTYCVVICITIFFLSISGTMVLAFKDSLGQGAKQLMVSSLRNQYGRYKIITDAWNATQSRLRCCGVEDLGWQVYNDSWWDVFVNTDIYERNTKLSRSSPFYKFVPASCCVTVIDGITGWPTNRYLDLHRCMTWQYGPPSFPSGPHNDAIYYAGCFNRLRDYVNQYG 250          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 45.4394 bits (106), Expect = 8.198e-6
Identity = 43/164 (26.22%), Postives = 76/164 (46.34%), Query Frame = 3
Query:  174 GINNILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMXXXXXXXXXXXXXXXXXXXXXXXALPSSVNDSIKNEMRRTLINQYAR--TKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCC 659
            G+  +++ G  L + + S +    YILI  G ++  T  +G    +RE R  L A+  LL+++F+   I GIL       +++ +K+ M +T++  Y +   + +TDA +  Q   +CCG  D  W+ +  S W  +   +               R  P SCC
Sbjct:   39 GVWTLVEKGDYLSLLASSTFAATAYILILAGSVVMLTGLLGCCAVVRERRGCLAAYCGLLLLIFLLEVIAGILAYLYRQQLSEELKSHMNKTIVESYGQPDQQRVTDAMDKLQQEFKCCGSHD--WNDWQRSDWVKVAAAE--------------GRLVPDSCC 186          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000023248.1 (SMESG000023248.1)

HSP 1 Score: 504.982 bits (1299), Expect = 0.000e+0
Identity = 317/318 (99.69%), Postives = 317/318 (99.69%), Query Frame = 3
Query:   87 MTLSGRSIKXXXXXXXXXXXXXXXXXXXXGINNILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMXXXXXXXXXXXXXXXXXXXXXXXALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTGWPSPVYKDLYICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLYGDXXXXXXXXXXXXXXXXXXXXXXELRYIQKKDNKEKERSAPTASSFGKLQNYPPEEIEPFDPGESSENTI 1040
            MTLSGRSIKLIFVILNFILLLFALAFLIVGINNILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMLIAFVVLLVILFIFTFIGGILVLALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTGWPSPVYKDL ICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLYGDGIGGLAIFVLLLFIAGIILAIVELRYIQKKDNKEKERSAPTASSFGKLQNYPPEEIEPFDPGESSENTI
Sbjct:    1 MTLSGRSIKLIFVILNFILLLFALAFLIVGINNILDHGLMLEITSGSIYLTGTYILIFVGFILCFTVCVGTYGSLREDRFMLIAFVVLLVILFIFTFIGGILVLALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTGWPSPVYKDLNICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLYGDGIGGLAIFVLLLFIAGIILAIVELRYIQKKDNKEKERSAPTASSFGKLQNYPPEEIEPFDPGESSENTI 318          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000045911.1 (SMESG000045911.1)

HSP 1 Score: 139.428 bits (350), Expect = 1.867e-39
Identity = 64/138 (46.38%), Postives = 89/138 (64.49%), Query Frame = 3
Query:  414 VNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDDATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTGWPSPVYKDLYICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLY 827
            +N ++   M  +L+  Y +T LIT +W+  Q RLRCC V D  W++Y +SYW   TNI + N N+ ++  +P+Y+  P SCC+  +D QTGWPS    D+  CQ F FGPP F +GA N A+YYRGC NA KSY++ Y
Sbjct:   16 MNATVMKFMENSLVISYNKTSLITKSWDEAQIRLRCCAVSDRGWNLYRSSYWSANTNI-VRNYNINLTEFSPFYQMVPESCCFRPIDGQTGWPSDTPLDINQCQGFLFGPPRFPDGAHNPAIYYRGCFNATKSYIRYY 152          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tsp74F5.580e-830.58gene:FBgn0036769 transcript:FBtr0075155[more]
Tsp74F5.580e-830.58gene:FBgn0036769 transcript:FBtr0075154[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DMG65.831e-5344.00Tetraspanin OS=Schistosoma japonicum OX=6182 GN=EW... [more]
C1L5Y76.151e-5344.00Tetraspanin OS=Schistosoma japonicum OX=6182 PE=2 ... [more]
A0A2H1CDC12.168e-5245.21Tetraspanin family protein OS=Fasciola hepatica OX... [more]
A0A4S2LNT93.864e-5244.75Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8WSM26.016e-5243.84Tetraspanin family protein OS=Opisthorchis viverri... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CD1518.198e-626.22CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023248.10.000e+099.69SMESG000023248.1[more]
SMESG000045911.11.867e-3946.38SMESG000045911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024121 ID=SMED30024121|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=1148bp
TTTAAGTCATTTGTGTAAATTGTGAATATTTTAATTGCTTTCCTGAATTT
GATATTTTAAATTTTCATGTATATTACAAATTCAGAATGACACTATCTGG
CCGCTCAATTAAACTAATTTTTGTTATTCTTAATTTTATATTGCTGCTTT
TTGCTTTAGCGTTTCTTATCGTTGGTATAAATAATATACTCGATCATGGT
TTAATGCTTGAAATTACAAGTGGCTCAATTTATTTAACTGGAACATATAT
TTTGATATTCGTTGGTTTTATTCTCTGTTTTACAGTTTGTGTTGGGACTT
ATGGTAGTCTTAGAGAAGACAGATTTATGCTCATTGCGTTTGTGGTACTT
TTGGTGATTTTATTCATATTTACTTTTATCGGTGGCATTCTTGTATTGGC
TTTACCTAGTTCGGTAAATGATTCGATTAAAAATGAAATGAGAAGAACGC
TAATCAATCAATACGCCAGAACGAAACTCATCACAGACGCCTGGAATCTT
ACCCAAAACCGCCTGCGTTGCTGCGGCGTAGATGACGCAACGTGGAGTAT
CTATGTCAACAGTTACTGGGACAATATCACCAATATCGATTTGAATAACA
TGAATTTAAAAATTTCACGTGACAATCCGTATTATCGATTTGCCCCAATT
TCCTGCTGTTGGACATTGGTAGATACTCAAACGGGTTGGCCGAGTCCCGT
TTATAAAGACTTATACATTTGTCAAAATTTTCAATTCGGCCCCCCAAATT
TTGCAAATGGCGCCCAAAATGACGCATTGTATTACCGGGGCTGTGCAAAC
GCAATGAAAAGCTATCTGAAACTATACGGCGATGGAATTGGTGGCCTTGC
GATATTTGTGCTGCTCCTTTTTATCGCTGGAATAATTCTTGCAATCGTTG
AGTTGCGATACATTCAAAAAAAGGACAATAAAGAGAAAGAAAGGAGCGCT
CCGACGGCTTCCAGTTTTGGAAAATTACAAAATTATCCTCCGGAAGAAAT
TGAGCCGTTCGATCCGGGGGAGTCATCAGAAAATACAATTTAAACAAGTT
TCACCGTTTTTCCCAAATATGGCTGTGAATAATCAATAAATTTTTACTGT
TGTCTTATATAAACTTCATATTTGTAATAAATAAATTTTACAGACTTA
back to top

protein sequence of SMED30024121-orf-1

>SMED30024121-orf-1 ID=SMED30024121-orf-1|Name=SMED30024121-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=319bp
MTLSGRSIKLIFVILNFILLLFALAFLIVGINNILDHGLMLEITSGSIYL
TGTYILIFVGFILCFTVCVGTYGSLREDRFMLIAFVVLLVILFIFTFIGG
ILVLALPSSVNDSIKNEMRRTLINQYARTKLITDAWNLTQNRLRCCGVDD
ATWSIYVNSYWDNITNIDLNNMNLKISRDNPYYRFAPISCCWTLVDTQTG
WPSPVYKDLYICQNFQFGPPNFANGAQNDALYYRGCANAMKSYLKLYGDG
IGGLAIFVLLLFIAGIILAIVELRYIQKKDNKEKERSAPTASSFGKLQNY
PPEEIEPFDPGESSENTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR008952Tetraspanin_EC2_sf
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 10..33
score: 22.34
coord: 76..104
score: 26.49
coord: 49..75
score: 26.87
coord: 250..276
score: 24.82
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 107..166
e-value: 1.0E-5
score: 27.3
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 8..271
e-value: 9.7E-28
score: 97.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 280..318
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 8..282
NoneNo IPR availablePANTHERPTHR19282:SF261TETRASPANIN-14coord: 8..282
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 84..106
NoneNo IPR availableTMHMMTMhelixcoord: 50..72