Degenerin unc-8

Overview
NameDegenerin unc-8
Smed IDSMED30024111
Length (bp)835
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Degenerin unc-8 (SMED30024111) t-SNE clustered cells

Violin plots show distribution of expression levels for Degenerin unc-8 (SMED30024111) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Degenerin unc-8 (SMED30024111) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Degenerin unc-8 (SMED30024111) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024111

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024111SMESG000017668.1 dd_Smed_v4_31416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024111SMESG000017668.1 dd_Smed_v4_31416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024111SMESG000017668.1 dd_Smed_v4_31416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Degenerin unc-8 vs. TrEMBL
Match: S5W2R2 (Asic OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 3.428e-79
Identity = 141/279 (50.54%), Postives = 198/279 (70.97%), Query Frame = 2
Query:   14 RQYYINQIPLEF--NIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLPIYKNETGPPRICLNATFYSEEDVLKNANCMVNNFRK-IESVEAFRNLYRLKCQDYKLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQ-FSNWFQRIDNRSDF-ERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 835
            +Q +I  +   F  N +SY +FNSS   +S+FLYI+N++ IPQ+ E++L PG+NN++ L+Q R  Y G+ R CRN+ +E ELYD+LLQST  + G YDDC+K+ +Q+ +V  CNCY+ FLPI+KN +G PR+CLNA+ +SE +VLKNA CM+N FRK  ES +A R  Y  +C+ Y+ I CNKV YK +  K +  +LWS  T  RR +++K  +   FQ  +   DF E+++DN + + INR+   GDLYKEE EYPFS+LLSD+GGLMGLWLG+SV+
Sbjct:  208 KQKFIKSLLFRFKLNEESYKIFNSSYTFQSMFLYISNKDEIPQSNEIILTPGYNNVVQLTQNRHSYTGLRRTCRNEKFEAELYDSLLQSTEKYSGSYDDCKKIVSQQKYVKYCNCYNSFLPIFKNSSGFPRLCLNASIFSEAEVLKNAKCMINTFRKYAESDKARRRFYN-RCKMYRPIPCNKVLYKIDHRKEILVDLWSKSTNDRRREIIKTLYLKTFQTNETSLDFVEKVKDNIMQLIINRDNESGDLYKEEREYPFSELLSDVGGLMGLWLGLSVI 485          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A448XIM1 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS30987 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.404e-40
Identity = 97/288 (33.68%), Postives = 149/288 (51.74%), Query Frame = 2
Query:   41 LEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLP---IYKNETGPPRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLK-CQDYKLI-ECNKVKYKFE---KEKLLFTELWSGFTTKRRHKMLKQ-FSNWFQRID--------------NRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 835
            + +N  SYLL NSS    S++++IT +   P        PG+ N I++S  R         CR   Y VE++ A L S     G  + C ++ +QKL+V +C CY+P+LP   +     GPP IC N T +S  ++ +N  CM   + +  +V  + +L   + C+ ++++ ECN   Y  E   +E+++  ELW+      R   L+Q F +     D              N   F R+R N+ ++TI R+   G L  EE EYP S+LLSD+GGLMGLW+G+SVV
Sbjct:   27 INYNYDSYLLINSSYVSHSIYMFITPKGHEPAGDGHKFYPGYGNHITVSMRRTIKHHKKEPCRLTEYTVEVFGADLVSRHNSTGQAEFCHRIVSQKLYVERCGCYNPYLPFPVLNIKSGGPPPICFNMTLFSIHELAENERCMHTLYGEFRNVSHYLSLPEARHCEHFRIMTECNTRTYVIEELYRERMI--ELWTQSYNDARAAFLRQSFMDTSPDADKIMQLLAKNTTNEQNEYMFARLRQNFGLLTIRRDQAHGILVSEELEYPLSELLSDVGGLMGLWVGISVV 312          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: H2KV88 (Degenerin unc-8 OS=Clonorchis sinensis OX=79923 GN=CLF_111557 PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 8.206e-39
Identity = 87/290 (30.00%), Postives = 148/290 (51.03%), Query Frame = 2
Query:   41 LEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLPIYKNETGP-----PRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLKCQDY--KLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQFSNWFQRI------------------DNRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 835
            L+FNI+S+++ N+S    ++   I+    +P    + L PG+ + I L+  RF+     R CRN  +EVE++DA L +     G    C ++ +Q L++  C CYSPFLP     + P     P +C N + +  E + +NA CM N  +K +    + N+   +  +Y   +  C  ++++  + +   T LW  ++ K     L      FQ +                  D+      +R+N+ ++TI R+  KG+L +E+ EYP ++LLSDIGGLMGLW+G+SV+
Sbjct:   49 LKFNIESHMIINTSYVSPTLDFIISRPGHMPHDEPIELLPGYMHYIGLNFQRFKREPSKRPCRNNVFEVEVFDANLATKYPVHGSATLCHRILSQNLYIKHCGCYSPFLPYPVIPSHPDFDDSPVLCFNMSRFKIEQLNQNAKCMFNLLQKYQDPVTYMNIPEAQECEYLGSVPPCEDIEHQLIQTRR--TPLWELWSEKYNDARLSFLKAAFQLVFEVDIVQNRLGKSFHMNNDSEPALRYLRENFALVTIERKVEKGELIREDLEYPLAELLSDIGGLMGLWIGISVI 336          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A183A5V1 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2336 PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.203e-37
Identity = 93/288 (32.29%), Postives = 150/288 (52.08%), Query Frame = 2
Query:   41 LEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLPIYKNET-----GPPRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLK-CQDYKLI-ECNKVKYKFEK-EKLLFTELWSGFTTKRRHKMLKQ-FSNWF------QRIDNRSD--------FERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 835
            L+FN  S+L+ NSS   R++ L+I+     P+   M L  G+ + +S+S TRF        CR   +  +++DA L++     G  D C K+ +Q+L+++ C CYSPFLP    +      G P +C N + ++   + +NA CM + + +      + NL   + C+ ++    C    Y  E   +    ELWS    + R   L   F + F      +RI    +        F  +R+N+ ++TI+R+FP+G L  EE EYP S+LLSD+GGLMGLW+G+SV+
Sbjct:  244 LKFNHDSFLIINSSYAPRNIDLFISLPGHFPEDESMELLSGYTHKVSVSMTRFIREPNRLPCRTDEFVAQMFDANLKTRREIVGSADFCHKLVSQRLYINNCGCYSPFLPYPVVDEHLLVHGQPVLCFNMSHFNITSIDQNAKCMYDVYTQYHDHSVYMNLPEAQYCETFRSTPPCESTSYMPESLRRTPIIELWSDTINEGRTAFLTSTFESVFGPDLPEERIRQLLNNSGNNSNMFTYMRNNFGMVTISRKFPRGTLTHEELEYPLSELLSDLGGLMGLWIGISVI 531          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A4S2L913 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009406 PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.632e-37
Identity = 87/290 (30.00%), Postives = 146/290 (50.34%), Query Frame = 2
Query:   41 LEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLPIYKNETGP-----PRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLKCQDY--KLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQFSNWFQRI------------------DNRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 835
            L+FNI+S+++ N+S    ++   I+    +P    + L PG+ + I L+  RF+     R CRN  ++VE++DA L +     G    C ++ +Q L++  C CYSPFLP     + P     P +C N + +  E + +NA CM N   K      + N+   +  +Y   +  C  ++++  + +   T LW  ++ K     L      FQ +                  D+      +R+N+ +ITI R+  KG+L +E+ EYP ++LLSDIGGLMGLW+G+SV+
Sbjct:  283 LKFNIESHMIINTSYVSPTLDFIISRPGHMPHDEPIELLPGYMHYIGLNFQRFKREPSKRPCRNNVFDVEVFDANLATKYPVHGSATLCHRILSQNLYIKYCGCYSPFLPYPVIPSHPDFDDSPVLCFNMSRFKIEQLNQNAKCMFNLLEKYRDPVTYMNIPEARECEYLGSVPPCEDIEHQLIQTRR--TPLWELWSEKYNDARLSFLKAAFQLVFEVDIVQNRLGKSFHINNDSEPALRYLRENFALITIERKVEKGELIREDLEYPLAELLSDIGGLMGLWIGISVI 570          
BLAST of Degenerin unc-8 vs. Ensembl Nematostella
Match: EDO31696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX71])

HSP 1 Score: 46.595 bits (109), Expect = 5.537e-6
Identity = 40/144 (27.78%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  485 SVEAFRNLYRLKCQDYK-------------LIEC-NKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQFSNWFQR------IDNRSD----FER--IRDNYIVITINREFPKGDLYKEE-YEYPFSQLLSDIGGLMGLWLGMSVV 835
            S  A+  ++  KC +Y+             ++EC  KVK+K  + +L  +        +  +++   F+ W  +      IDN  D    + R   RDNY+ + I   F + + + EE   Y     LSDIGG +GLW+G+SV+
Sbjct:  240 SCLAYHQMHECKCMEYRFPTDSVCDTLNSTIVECLAKVKFKLSRNELGCSTACGPACREEAYRLTSSFAVWPSQRYQNSIIDNLFDGIFNYSRSWFRDNYLEVNIF--FKELNYFIEESVAYELVNFLSDIGGQLGLWVGVSVM 381          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000017668.1 (SMESG000017668.1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 259/265 (97.74%), Postives = 261/265 (98.49%), Query Frame = 2
Query:   41 LEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLPIYKNETGPPRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLKCQDYKLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQFSNWFQRIDNRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 835
            L  NIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTR+EYRGVHRKCR KTYEVELYDALLQSTSTFEG YDDCRKVETQKLFVSKCNCYSPFLPIYKN+TGPPRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLKCQDYKLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQFSNWFQRIDNRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV
Sbjct:  219 LNLNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRYEYRGVHRKCRKKTYEVELYDALLQSTSTFEGDYDDCRKVETQKLFVSKCNCYSPFLPIYKNKTGPPRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLKCQDYKLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQFSNWFQRIDNRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 483          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000069546.1 (SMESG000069546.1)

HSP 1 Score: 451.055 bits (1159), Expect = 2.805e-158
Identity = 217/265 (81.89%), Postives = 234/265 (88.30%), Query Frame = 2
Query:   41 LEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLPIYKNETGPPRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLKCQDYKLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQFSNWFQRIDNRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 835
            L FNIKSY+LFNSS  HRSVFLYITNRNGIPQ YEMLLEPGFNNI+SLSQ RFEYRGV RKCRNKTY+VELYDALLQSTS FEG+Y DC KVE+QKL VS C CY+PFLPIYKNETG PRICLNATFYSEE++LKNA CMVN  RK +S   +R  +  KCQDY+LI+CN+VKYK EKEKLLF EL SGFTT+RR K++K FS WFQRIDNRSDFERIRDNYIVITI REFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV
Sbjct:  218 LNFNIKSYMLFNSSFLHRSVFLYITNRNGIPQKYEMLLEPGFNNIVSLSQNRFEYRGVQRKCRNKTYKVELYDALLQSTSIFEGYYADCMKVESQKLCVSNCKCYNPFLPIYKNETGSPRICLNATFYSEEEILKNAKCMVNRLRKFKSFFLYRRFFNPKCQDYQLIKCNEVKYKIEKEKLLFAELSSGFTTQRRRKVIKGFSKWFQRIDNRSDFERIRDNYIVITIKREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 482          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000017678.1 (SMESG000017678.1)

HSP 1 Score: 412.92 bits (1060), Expect = 3.608e-143
Identity = 194/266 (72.93%), Postives = 230/266 (86.47%), Query Frame = 2
Query:   41 LEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLPIYKNETGPPRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLKCQDYKLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQFSNWF-QRIDNRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 835
            L+FN++SYLLFNSS  HRSVFLYITNRNGIP   E+LL PGFNNI+SLSQ+R+EYRGV RKCRNK +E ELYD LLQSTSTFEGHYDDC+KVE+QKLFV  C CYSPFLPIYKNETGPPRICLNATFYSE+++++NA CM + + K +S +AFRN YRLKCQDY+ I+CN+VKYK EK+K LF E WSG T +RR+++LK+ S +  ++ D ++ FER+RDN+I ITINREF KGDLYKEEYEYPFS+LLSDIGGLMGLWLGMSVV
Sbjct:  220 LKFNLESYLLFNSSYLHRSVFLYITNRNGIPHKNEILLAPGFNNIVSLSQSRYEYRGVLRKCRNKIFETELYDGLLQSTSTFEGHYDDCKKVESQKLFVGICKCYSPFLPIYKNETGPPRICLNATFYSEDEIVRNAKCMTDVYTKFQSYKAFRNHYRLKCQDYRFIKCNEVKYKIEKDKELFVEFWSGLTNQRRNELLKKVSYYLMEKFDIKNYFERMRDNFIGITINREFQKGDLYKEEYEYPFSELLSDIGGLMGLWLGMSVV 485          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000016391.1 (SMESG000016391.1)

HSP 1 Score: 379.407 bits (973), Expect = 1.447e-130
Identity = 177/265 (66.79%), Postives = 217/265 (81.89%), Query Frame = 2
Query:   41 LEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLPIYKNETGPPRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLKCQDYKLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLKQFSNWF-QRIDNRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSV 832
            L+FN++SY LFNSS  HRSVFLYI+NRN  P+  E+LL PGFNNIISLSQ+R+E +GV RKCRN+ Y VELYDALL+STSTFEGHYDDC++VE+Q+LFV  CNCYSPFLPIYKN+TG PRICLN TFYSEE++L+NA CMV+ FR+ +S +AF N+    C+ Y+ I+C +VKY  EKEK LF E WSG T +RR +++K++S    ++ DN+  FER+RDN+I I I RE  KGDLYKEEYEYPFS+LLSDIGGLMGLWLGMSV
Sbjct:  220 LKFNLESYFLFNSSYLHRSVFLYISNRNSFPRRNEILLAPGFNNIISLSQSRYELKGVQRKCRNEKYVVELYDALLKSTSTFEGHYDDCKRVESQRLFVRNCNCYSPFLPIYKNKTGQPRICLNGTFYSEEEILQNAKCMVDVFRRFQSYKAFMNILHSNCEHYRFIKCKEVKYGIEKEKELFVEFWSGLTNQRRQRLIKKYSRHLTEKFDNKKYFERMRDNFIGIAIKRETQKGDLYKEEYEYPFSELLSDIGGLMGLWLGMSV 484          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000017657.1 (SMESG000017657.1)

HSP 1 Score: 288.115 bits (736), Expect = 9.689e-95
Identity = 142/266 (53.38%), Postives = 195/266 (73.31%), Query Frame = 2
Query:   41 LEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEMLLEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYDDCRKVETQKLFVSKCNCYSPFLPIYKNETGPPRICLNATFYSEEDVLKNANCMVNNFRKIESVEAFRNLYRLKCQDYKLIECNKVKYKFEKEKLLFTELWSGFTTKRRHKMLK-QFSNWFQRIDNRSDFERIRDNYIVITINREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVV 835
            L+FN  SYLLFNSS    SVFL++ N N IPQ+  M L P +N+IISLSQ+R+ Y+ +  KCR + Y VELYD  LQS S FEG++ DC+KV++Q++FVS+C CYSPFLPIYKN TGPPRICLNAT YSE+++++NA CMV+ +++     +        C+ Y+L +C++++YK  KEK LFTE ++G + +RR KM+K  FS + Q+  +   +  IRDN++ + I+RE  KGDL+KEE+EY   +LLSDIGGLMGLWLGMS+V
Sbjct:  211 LKFNFDSYLLFNSSYSPPSVFLFLNNANEIPQSKAMTLIPSYNHIISLSQSRYIYKNIKEKCREEIYYVELYDVTLQSYSKFEGNFVDCKKVKSQEMFVSQCKCYSPFLPIYKNATGPPRICLNATLYSEDEIIQNAYCMVDAYKRFNENNS-------SCEIYRLAKCDEIRYKMGKEKELFTEFFNGNSNERRRKMIKIIFSQFTQQPVSEIPYNIIRDNFMQLKISRETEKGDLFKEEFEYRMFELLSDIGGLMGLWLGMSIV 469          
The following BLAST results are available for this feature:
BLAST of Degenerin unc-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5W2R23.428e-7950.54Asic OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A448XIM12.404e-4033.68Uncharacterized protein OS=Protopolystoma xenopodi... [more]
H2KV888.206e-3930.00Degenerin unc-8 OS=Clonorchis sinensis OX=79923 GN... [more]
A0A183A5V11.203e-3732.29Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4S2L9132.632e-3730.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Degenerin unc-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO316965.537e-627.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Degenerin unc-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017668.10.000e+097.74SMESG000017668.1[more]
SMESG000069546.12.805e-15881.89SMESG000069546.1[more]
SMESG000017678.13.608e-14372.93SMESG000017678.1[more]
SMESG000016391.11.447e-13066.79SMESG000016391.1[more]
SMESG000017657.19.689e-9553.38SMESG000017657.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024111 ID=SMED30024111|Name=Degenerin unc-8|organism=Schmidtea mediterranea sexual|type=transcript|length=835bp
AATCTGTACATCAAGACAATATTACATCAATCAGATTCCATTGGAATTTA
ATATCAAAAGTTATTTGCTGTTTAACTCAAGCGCATTCCACCGTTCGGTA
TTCCTATATATTACAAATAGAAATGGGATTCCTCAAACATATGAAATGTT
GCTAGAGCCTGGATTCAACAATATTATTTCCCTCTCGCAGACCCGATTCG
AATATAGAGGGGTTCACCGAAAATGCCGAAATAAAACGTATGAGGTTGAA
TTGTATGACGCGCTTTTACAATCAACCTCAACCTTTGAAGGTCATTATGA
TGACTGCAGGAAGGTTGAAACCCAGAAATTGTTTGTCAGTAAATGCAATT
GTTACAGTCCGTTTTTGCCGATTTACAAAAATGAAACTGGGCCCCCAAGA
ATTTGTTTGAATGCGACATTTTATTCCGAAGAAGATGTCCTTAAAAACGC
AAATTGTATGGTTAACAATTTTAGGAAAATTGAAAGCGTTGAAGCATTCC
GAAATCTTTATCGTTTAAAGTGTCAAGATTACAAATTAATAGAGTGCAAC
AAAGTGAAATATAAATTTGAAAAAGAAAAACTATTATTTACCGAGTTATG
GAGTGGATTCACAACTAAAAGACGCCATAAAATGTTAAAACAATTTTCCA
ATTGGTTTCAAAGAATTGATAATAGAAGCGATTTTGAACGAATCCGGGAT
AATTATATTGTGATTACAATAAATCGGGAATTTCCAAAAGGAGATTTATA
TAAAGAAGAATATGAATATCCATTTTCGCAATTATTGTCAGACATTGGAG
GATTAATGGGACTCTGGCTAGGGATGAGTGTCGTT
back to top

protein sequence of SMED30024111-orf-1

>SMED30024111-orf-1 ID=SMED30024111-orf-1|Name=SMED30024111-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
ICTSRQYYINQIPLEFNIKSYLLFNSSAFHRSVFLYITNRNGIPQTYEML
LEPGFNNIISLSQTRFEYRGVHRKCRNKTYEVELYDALLQSTSTFEGHYD
DCRKVETQKLFVSKCNCYSPFLPIYKNETGPPRICLNATFYSEEDVLKNA
NCMVNNFRKIESVEAFRNLYRLKCQDYKLIECNKVKYKFEKEKLLFTELW
SGFTTKRRHKMLKQFSNWFQRIDNRSDFERIRDNYIVITINREFPKGDLY
KEEYEYPFSQLLSDIGGLMGLWLGMSVV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 266..278
score: 42.82
coord: 86..102
score: 20.94
coord: 252..266
score: 37.07
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 28..278
e-value: 9.8E-25
score: 87.4
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 45..278
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 33..254
e-value: 4.2E-21
score: 77.4
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 255..278
e-value: 4.2E-21
score: 77.4
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 68..182
e-value: 4.2E-21
score: 77.4
NoneNo IPR availablePANTHERPTHR11690:SF222PICKPOCKET 6-RELATEDcoord: 45..278