Mitochondrial ATP synthase subunit 9

Overview
NameMitochondrial ATP synthase subunit 9
Smed IDSMED30024106
Length (bp)702
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial ATP synthase subunit 9 (SMED30024106) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial ATP synthase subunit 9 (SMED30024106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial ATP synthase subunit 9 (SMED30024106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial ATP synthase subunit 9 (SMED30024106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024106SMESG000059768.1 dd_Smed_v4_401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024106SMESG000059768.1 dd_Smed_v4_401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024106SMESG000059768.1 dd_Smed_v4_401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024106SMESG000059768.1 dd_Smed_v4_401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024106SMESG000059768.1 dd_Smed_v4_401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024106SMESG000059768.1 dd_Smed_v4_401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024106SMESG000059768.1 Contig47116newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024106SMESG000059768.1 Contig47116uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30024106SMESG000059768.1 dd_Smed_v6_401_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Human
Match: ATP5MC1 (ATP synthase membrane subunit c locus 1 [Source:HGNC Symbol;Acc:HGNC:841])

HSP 1 Score: 96.2857 bits (238), Expect = 4.685e-25
Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 2
Query:  212 KFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            +F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   27 EFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 109          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Human
Match: ATP5MC1 (ATP synthase membrane subunit c locus 1 [Source:HGNC Symbol;Acc:HGNC:841])

HSP 1 Score: 96.6709 bits (239), Expect = 5.286e-25
Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 2
Query:  185 SPLANIKDC---KFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SP+ + K     +F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   32 SPVNSSKQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 126          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Human
Match: ATP5MC2 (ATP synthase membrane subunit c locus 2 [Source:HGNC Symbol;Acc:HGNC:842])

HSP 1 Score: 97.0561 bits (240), Expect = 5.335e-25
Identity = 73/92 (79.35%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  188 PLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            PL ++   + F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   49 PLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 140          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Human
Match: ATP5MC2 (ATP synthase membrane subunit c locus 2 [Source:HGNC Symbol;Acc:HGNC:842])

HSP 1 Score: 97.0561 bits (240), Expect = 5.335e-25
Identity = 73/92 (79.35%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  188 PLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            PL ++   + F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   49 PLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 140          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Human
Match: ATP5MC2 (ATP synthase membrane subunit c locus 2 [Source:HGNC Symbol;Acc:HGNC:842])

HSP 1 Score: 97.0561 bits (240), Expect = 5.335e-25
Identity = 73/92 (79.35%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  188 PLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            PL ++   + F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   49 PLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 140          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Celegans
Match: Y82E9BR.3 (ATP synthase lipid-binding protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9BKS0])

HSP 1 Score: 92.8189 bits (229), Expect = 4.682e-24
Identity = 75/109 (68.81%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  140 LNLMRSFLVNNVQKLSPLANIKDCKFHTSTV-RNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            L L RS L +       + N    +  ++TV R DID AAKYIGAGAAT GVAGSGAGIG VFG+LVIGYARNP LKQQLFSYAILGFALSEAMGLFCL M F+ILFA 
Sbjct:    8 LPLTRSLLASRAPLALRMENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLTMGFMILFAL 116          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Celegans
Match: Y82E9BR.3 (ATP synthase lipid-binding protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9BKS0])

HSP 1 Score: 92.8189 bits (229), Expect = 4.682e-24
Identity = 75/109 (68.81%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  140 LNLMRSFLVNNVQKLSPLANIKDCKFHTSTV-RNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            L L RS L +       + N    +  ++TV R DID AAKYIGAGAAT GVAGSGAGIG VFG+LVIGYARNP LKQQLFSYAILGFALSEAMGLFCL M F+ILFA 
Sbjct:    8 LPLTRSLLASRAPLALRMENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLTMGFMILFAL 116          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Celegans
Match: Y82E9BR.3 (ATP synthase lipid-binding protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9BKS0])

HSP 1 Score: 92.8189 bits (229), Expect = 4.682e-24
Identity = 75/109 (68.81%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  140 LNLMRSFLVNNVQKLSPLANIKDCKFHTSTV-RNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            L L RS L +       + N    +  ++TV R DID AAKYIGAGAAT GVAGSGAGIG VFG+LVIGYARNP LKQQLFSYAILGFALSEAMGLFCL M F+ILFA 
Sbjct:    8 LPLTRSLLASRAPLALRMENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLTMGFMILFAL 116          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Celegans
Match: Y82E9BR.3 (ATP synthase lipid-binding protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9BKS0])

HSP 1 Score: 92.8189 bits (229), Expect = 4.682e-24
Identity = 75/109 (68.81%), Postives = 82/109 (75.23%), Query Frame = 2
Query:  140 LNLMRSFLVNNVQKLSPLANIKDCKFHTSTV-RNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            L L RS L +       + N    +  ++TV R DID AAKYIGAGAAT GVAGSGAGIG VFG+LVIGYARNP LKQQLFSYAILGFALSEAMGLFCL M F+ILFA 
Sbjct:    8 LPLTRSLLASRAPLALRMENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLTMGFMILFAL 116          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Fly
Match: ATPsynC (gene:FBgn0039830 transcript:FBtr0085774)

HSP 1 Score: 101.679 bits (252), Expect = 4.667e-27
Identity = 76/97 (78.35%), Postives = 83/97 (85.57%), Query Frame = 2
Query:  176 QKLSPLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            Q  +P+A +   + F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLMMAFL+LFAF
Sbjct:   42 QNTTPVALLPQIRSFQTSPVTRDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFAF 138          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Fly
Match: ATPsynC (gene:FBgn0039830 transcript:FBtr0085773)

HSP 1 Score: 101.679 bits (252), Expect = 4.667e-27
Identity = 76/97 (78.35%), Postives = 83/97 (85.57%), Query Frame = 2
Query:  176 QKLSPLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            Q  +P+A +   + F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLMMAFL+LFAF
Sbjct:   42 QNTTPVALLPQIRSFQTSPVTRDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFAF 138          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Fly
Match: ATPsynC (gene:FBgn0039830 transcript:FBtr0305121)

HSP 1 Score: 101.679 bits (252), Expect = 4.667e-27
Identity = 76/97 (78.35%), Postives = 83/97 (85.57%), Query Frame = 2
Query:  176 QKLSPLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            Q  +P+A +   + F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLMMAFL+LFAF
Sbjct:   42 QNTTPVALLPQIRSFQTSPVTRDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFAF 138          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Fly
Match: ATPsynC (gene:FBgn0039830 transcript:FBtr0085772)

HSP 1 Score: 101.679 bits (252), Expect = 4.667e-27
Identity = 76/97 (78.35%), Postives = 83/97 (85.57%), Query Frame = 2
Query:  176 QKLSPLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            Q  +P+A +   + F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLMMAFL+LFAF
Sbjct:   42 QNTTPVALLPQIRSFQTSPVTRDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFAF 138          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Fly
Match: ATPsynC (gene:FBgn0039830 transcript:FBtr0306237)

HSP 1 Score: 101.679 bits (252), Expect = 4.667e-27
Identity = 76/97 (78.35%), Postives = 83/97 (85.57%), Query Frame = 2
Query:  176 QKLSPLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            Q  +P+A +   + F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLMMAFL+LFAF
Sbjct:   42 QNTTPVALLPQIRSFQTSPVTRDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFAF 138          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Zebrafish
Match: atp5mc3a (ATP synthase membrane subunit c locus 3a [Source:ZFIN;Acc:ZDB-GENE-040426-857])

HSP 1 Score: 101.293 bits (251), Expect = 8.235e-27
Identity = 75/92 (81.52%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SP+A +    F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   47 SPVAQMALRSFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 138          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Zebrafish
Match: atp5mc3a (ATP synthase membrane subunit c locus 3a [Source:ZFIN;Acc:ZDB-GENE-040426-857])

HSP 1 Score: 101.293 bits (251), Expect = 8.235e-27
Identity = 75/92 (81.52%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SP+A +    F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   47 SPVAQMALRSFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 138          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Zebrafish
Match: atp5mc3b (ATP synthase membrane subunit c locus 3b [Source:ZFIN;Acc:ZDB-GENE-020814-1])

HSP 1 Score: 96.2857 bits (238), Expect = 8.354e-25
Identity = 71/82 (86.59%), Postives = 75/82 (91.46%), Query Frame = 2
Query:  215 FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   58 FQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 139          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Zebrafish
Match: atp5mc3b (ATP synthase membrane subunit c locus 3b [Source:ZFIN;Acc:ZDB-GENE-020814-1])

HSP 1 Score: 96.2857 bits (238), Expect = 8.354e-25
Identity = 71/82 (86.59%), Postives = 75/82 (91.46%), Query Frame = 2
Query:  215 FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   58 FQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 139          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Zebrafish
Match: atp5mc1 (ATP synthase membrane subunit c locus 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1966])

HSP 1 Score: 95.1301 bits (235), Expect = 2.274e-24
Identity = 71/82 (86.59%), Postives = 74/82 (90.24%), Query Frame = 2
Query:  215 FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            F TS    DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   56 FQTSVASRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 137          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Xenopus
Match: atp5mc3 (ATP synthase membrane subunit c locus 3 [Source:NCBI gene;Acc:448663])

HSP 1 Score: 97.4413 bits (241), Expect = 3.538e-25
Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 2
Query:  212 KFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            +F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   52 EFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 134          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Xenopus
Match: atp5mc3 (ATP synthase membrane subunit c locus 3 [Source:NCBI gene;Acc:448663])

HSP 1 Score: 97.0561 bits (240), Expect = 4.516e-25
Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 2
Query:  212 KFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            +F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   50 EFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 132          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Xenopus
Match: atp5mc3 (ATP synthase membrane subunit c locus 3 [Source:NCBI gene;Acc:448663])

HSP 1 Score: 97.0561 bits (240), Expect = 5.185e-25
Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 2
Query:  212 KFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            +F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   59 EFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 141          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Xenopus
Match: atp5mc3 (ATP synthase membrane subunit c locus 3 [Source:NCBI gene;Acc:448663])

HSP 1 Score: 96.6709 bits (239), Expect = 6.912e-25
Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 2
Query:  212 KFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            +F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   48 EFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 130          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Xenopus
Match: atp5mc1 (ATP synthase membrane subunit c locus 1 [Source:NCBI gene;Acc:448692])

HSP 1 Score: 88.9669 bits (219), Expect = 6.132e-22
Identity = 69/81 (85.19%), Postives = 73/81 (90.12%), Query Frame = 2
Query:  218 HTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
             +S    DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   53 QSSVTCRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 133          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Mouse
Match: Atp5g1 (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Source:MGI Symbol;Acc:MGI:107653])

HSP 1 Score: 97.4413 bits (241), Expect = 2.813e-25
Identity = 74/92 (80.43%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SPL  +   +F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   45 SPL-QVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 135          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Mouse
Match: Atp5g1 (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Source:MGI Symbol;Acc:MGI:107653])

HSP 1 Score: 97.4413 bits (241), Expect = 2.813e-25
Identity = 74/92 (80.43%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SPL  +   +F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   45 SPL-QVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 135          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Mouse
Match: Atp5g1 (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Source:MGI Symbol;Acc:MGI:107653])

HSP 1 Score: 97.4413 bits (241), Expect = 2.813e-25
Identity = 74/92 (80.43%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SPL  +   +F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   45 SPL-QVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 135          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Mouse
Match: Atp5g1 (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Source:MGI Symbol;Acc:MGI:107653])

HSP 1 Score: 97.4413 bits (241), Expect = 2.813e-25
Identity = 74/92 (80.43%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SPL  +   +F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   45 SPL-QVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 135          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Mouse
Match: Atp5g2 (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Source:MGI Symbol;Acc:MGI:1915192])

HSP 1 Score: 97.0561 bits (240), Expect = 4.420e-25
Identity = 74/92 (80.43%), Postives = 79/92 (85.87%), Query Frame = 2
Query:  188 PLAN-IKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            PL + I    F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   54 PLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 145          
BLAST of Mitochondrial ATP synthase subunit 9 vs. UniProt/SwissProt
Match: sp|Q9U505|AT5G_MANSE (ATP synthase lipid-binding protein, mitochondrial OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.123e-25
Identity = 78/119 (65.55%), Postives = 87/119 (73.11%), Query Frame = 2
Query:  152 RSFLVNNVQKLSPLANIKDC---------------KFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            RS + +N   + PLA +                   F T++V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLMMAFL+LFAF
Sbjct:   13 RSAIFSNAAVVRPLAAVSTQTQLVPAAPAQLSAVRSFQTTSVTKDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFAF 131          
BLAST of Mitochondrial ATP synthase subunit 9 vs. UniProt/SwissProt
Match: sp|Q5RAP9|AT5G2_PONAB (ATP synthase F(0) complex subunit C2, mitochondrial OS=Pongo abelii OX=9601 GN=ATP5MC2 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 8.266e-25
Identity = 73/92 (79.35%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  188 PLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            PL ++   + F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   49 PLTSLVSSRNFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 140          
BLAST of Mitochondrial ATP synthase subunit 9 vs. UniProt/SwissProt
Match: sp|Q9CR84|AT5G1_MOUSE (ATP synthase F(0) complex subunit C1, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc1 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.968e-24
Identity = 74/92 (80.43%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SPL  +   +F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   45 SPL-QVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 135          
BLAST of Mitochondrial ATP synthase subunit 9 vs. UniProt/SwissProt
Match: sp|Q06645|AT5G1_RAT (ATP synthase F(0) complex subunit C1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc1 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.410e-24
Identity = 74/92 (80.43%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SPL  +   +F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   45 SPL-QVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 135          
BLAST of Mitochondrial ATP synthase subunit 9 vs. UniProt/SwissProt
Match: sp|Q06055|AT5G2_HUMAN (ATP synthase F(0) complex subunit C2, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC2 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.562e-24
Identity = 73/92 (79.35%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  188 PLANIKDCK-FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            PL ++   + F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   49 PLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 140          
BLAST of Mitochondrial ATP synthase subunit 9 vs. TrEMBL
Match: A0A0R3UFR3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5982 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.491e-29
Identity = 84/117 (71.79%), Postives = 95/117 (81.20%), Query Frame = 2
Query:  119 KNMSLCRLNLMRSFLVNNVQKLSPLA--NIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            K M++     +   +++ + KL PLA  +I     HTS VR DIDQAAKYIGAGAAT GVAGSGAGIG+VFG+LVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLIL+AF
Sbjct:    9 KTMTVASRPFVSRAVLSGLPKLCPLAASDITSKNLHTSVVRRDIDQAAKYIGAGAATIGVAGSGAGIGSVFGNLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILYAF 125          
BLAST of Mitochondrial ATP synthase subunit 9 vs. TrEMBL
Match: A0A5K3EK72 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.950e-29
Identity = 84/117 (71.79%), Postives = 95/117 (81.20%), Query Frame = 2
Query:  119 KNMSLCRLNLMRSFLVNNVQKLSPLA--NIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            K M++     +   +++ + KL PLA  +I     HTS VR DIDQAAKYIGAGAAT GVAGSGAGIG+VFG+LVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLIL+AF
Sbjct:   10 KTMTVASRPFVSRAVLSGLPKLCPLAASDITSKNLHTSVVRRDIDQAAKYIGAGAATIGVAGSGAGIGSVFGNLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILYAF 126          
BLAST of Mitochondrial ATP synthase subunit 9 vs. TrEMBL
Match: A0A0R3SFT4 (ATP-synt_C domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3720 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 8.884e-29
Identity = 83/118 (70.34%), Postives = 94/118 (79.66%), Query Frame = 2
Query:  116 TKNMSLCRLNLMRSFLVNNVQKLSPLAN--IKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
             K+++L         ++ N+ KLSPLA+  I     HTS    DIDQAAKYIGAGAAT GVAGSGAGIG+VFG+LV+GYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLIL+AF
Sbjct:    8 VKSLALASRPAASRLIITNLPKLSPLASTEIVSKNLHTSVAHRDIDQAAKYIGAGAATIGVAGSGAGIGSVFGNLVMGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILYAF 125          
BLAST of Mitochondrial ATP synthase subunit 9 vs. TrEMBL
Match: A0A183ANJ8 (ATP-synt_C domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS8532 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.853e-28
Identity = 81/118 (68.64%), Postives = 94/118 (79.66%), Query Frame = 2
Query:  110 CKTKNMSLCRLNLMRSFLVNNVQKLSPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            C+++ +    L+L+R      +  +S   ++   KFHTS VR DIDQAAKYIGAGAAT G AGSGAGIG+VFG+LVIGYARNP LKQQLFSYAILGFALSEAMGLFCLMMAFLIL+AF
Sbjct:    7 CQSRVVIRPALSLLRGSQALRLSAVSAAPSVLSSKFHTSIVRRDIDQAAKYIGAGAATVGAAGSGAGIGSVFGNLVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLILYAF 124          
BLAST of Mitochondrial ATP synthase subunit 9 vs. TrEMBL
Match: A0A0R3TAM1 (ATP-synt_C domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS4108 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 3.489e-28
Identity = 80/118 (67.80%), Postives = 97/118 (82.20%), Query Frame = 2
Query:  116 TKNMSLCRLNLMRSFLVNNVQKLSPLANIK--DCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
             K++++         +++N+ KLSP+A+++  +   HTS    DIDQAAKYIGAGAAT GVAGSGAGIG+VFG+LV+GYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLIL+AF
Sbjct:    8 VKSLAMASRPAASRLVISNLPKLSPIASMEIVNKNLHTSIAHRDIDQAAKYIGAGAATIGVAGSGAGIGSVFGNLVMGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILYAF 125          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Cavefish
Match: atp5mc3b (ATP synthase F(0) complex subunit C2, mitochondrial-like [Source:NCBI gene;Acc:103042584])

HSP 1 Score: 100.908 bits (250), Expect = 7.740e-27
Identity = 75/92 (81.52%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SPL+ +    F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   38 SPLSQVALRGFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 129          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Cavefish
Match: atp5mc3b (ATP synthase F(0) complex subunit C2, mitochondrial-like [Source:NCBI gene;Acc:103042584])

HSP 1 Score: 100.523 bits (249), Expect = 1.320e-26
Identity = 75/92 (81.52%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SPL+ +    F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   48 SPLSQVALRGFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 139          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Cavefish
Match: atp5mc3b (ATP synthase F(0) complex subunit C2, mitochondrial-like [Source:NCBI gene;Acc:103042584])

HSP 1 Score: 100.523 bits (249), Expect = 1.320e-26
Identity = 75/92 (81.52%), Postives = 80/92 (86.96%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SPL+ +    F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   48 SPLSQVALRGFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 139          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Cavefish
Match: ENSAMXT00000036927.1 (ATP synthase F(0) complex subunit C3, mitochondrial [Source:NCBI gene;Acc:103027531])

HSP 1 Score: 98.2117 bits (243), Expect = 1.089e-25
Identity = 74/92 (80.43%), Postives = 79/92 (85.87%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SP+  +    F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   49 SPITQMCLRSFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 140          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Cavefish
Match: ENSAMXT00000049606.1 (ATP synthase F(0) complex subunit C3, mitochondrial [Source:NCBI gene;Acc:103027531])

HSP 1 Score: 98.2117 bits (243), Expect = 1.224e-25
Identity = 74/92 (80.43%), Postives = 79/92 (85.87%), Query Frame = 2
Query:  185 SPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            SP+  +    F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   47 SPITQMCLRSFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 138          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Sea Lamprey
Match: atp5mc3a (ATP synthase membrane subunit c locus 3a [Source:ZFIN;Acc:ZDB-GENE-040426-857])

HSP 1 Score: 98.9821 bits (245), Expect = 3.917e-27
Identity = 76/96 (79.17%), Postives = 80/96 (83.33%), Query Frame = 2
Query:  173 VQKLSPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            V   S LA +    F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:    6 VSAPSGLALVARRDFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 101          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Sea Lamprey
Match: atp5mc3b (ATP synthase membrane subunit c locus 3b [Source:ZFIN;Acc:ZDB-GENE-020814-1])

HSP 1 Score: 97.4413 bits (241), Expect = 4.349e-26
Identity = 75/100 (75.00%), Postives = 80/100 (80.00%), Query Frame = 2
Query:  161 LVNNVQKLSPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            L   VQ    L +     F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   40 LFPAVQHQGTLVHAAQRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 139          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Sea Lamprey
Match: atp5mc3b (ATP synthase membrane subunit c locus 3b [Source:ZFIN;Acc:ZDB-GENE-020814-1])

HSP 1 Score: 97.4413 bits (241), Expect = 7.299e-26
Identity = 74/96 (77.08%), Postives = 79/96 (82.29%), Query Frame = 2
Query:  173 VQKLSPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            VQ    L +     F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   61 VQHQGTLVHAAQRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 156          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000839.1 (pep scaffold:Pmarinus_7.0:GL479015:51266:53309:-1 gene:ENSPMAG00000000766.1 transcript:ENSPMAT00000000839.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 1.285e-25
Identity = 72/82 (87.80%), Postives = 75/82 (91.46%), Query Frame = 2
Query:  215 FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   69 FQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 150          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Yeast
Match: OLI1 (F0-ATP synthase subunit c (ATPase-associated proteolipid); encoded on the mitochondrial genome; mutation confers oligomycin resistance; expression is specifically dependent on the nuclear genes AEP1 and AEP2 [Source:SGD;Acc:S000007274])

HSP 1 Score: 59.3066 bits (142), Expect = 1.704e-12
Identity = 28/46 (60.87%), Postives = 36/46 (78.26%), Query Frame = 2
Query:  323 FGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            F +L+ G +RNP +K  +F  AILGFALSEA GLFCLM++FL+LF 
Sbjct:   30 FAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFG 75          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Nematostella
Match: EDO42877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S000])

HSP 1 Score: 97.8265 bits (242), Expect = 5.230e-26
Identity = 76/101 (75.25%), Postives = 81/101 (80.20%), Query Frame = 2
Query:  161 LVNNVQKLSPL-ANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            LV  V   SPL   +    F TS+   D+D AAK+IGAGAAT G AGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLMMAFLILFA
Sbjct:   34 LVKAVVPASPLLGALASRGFQTSSAVQDVDSAAKFIGAGAATVGAAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 134          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Medaka
Match: atp5mc3b (ATP synthase membrane subunit c locus 3 [Source:NCBI gene;Acc:101163447])

HSP 1 Score: 100.908 bits (250), Expect = 1.210e-26
Identity = 75/96 (78.12%), Postives = 80/96 (83.33%), Query Frame = 2
Query:  173 VQKLSPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            V   SPL  +    F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   43 VMPQSPLTQVTLRGFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 138          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Medaka
Match: atp5mc3b (ATP synthase membrane subunit c locus 3 [Source:NCBI gene;Acc:101163447])

HSP 1 Score: 100.138 bits (248), Expect = 3.129e-26
Identity = 75/96 (78.12%), Postives = 80/96 (83.33%), Query Frame = 2
Query:  173 VQKLSPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            V   SPL  +    F TS +  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   52 VMPQSPLTQVTLRGFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 147          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Medaka
Match: ATP5MC2 (ATP synthase F(0) complex subunit C2, mitochondrial [Source:NCBI gene;Acc:101173375])

HSP 1 Score: 97.0561 bits (240), Expect = 3.113e-25
Identity = 72/82 (87.80%), Postives = 75/82 (91.46%), Query Frame = 2
Query:  215 FHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
            F TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   59 FQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 140          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Medaka
Match: atp5mc1 (ATP synthase F(0) complex subunit C3, mitochondrial [Source:NCBI gene;Acc:101156015])

HSP 1 Score: 93.9745 bits (232), Expect = 4.341e-24
Identity = 71/81 (87.65%), Postives = 74/81 (91.36%), Query Frame = 2
Query:  218 HTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
             TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:   51 QTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 131          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Medaka
Match: atp5mc1 (ATP synthase F(0) complex subunit C3, mitochondrial [Source:NCBI gene;Acc:101156015])

HSP 1 Score: 93.5893 bits (231), Expect = 4.305e-23
Identity = 71/83 (85.54%), Postives = 74/83 (89.16%), Query Frame = 2
Query:  212 KFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFA 460
               TS V  DID AAK+IGAGAAT GVAGSGAGIGTVFGSL+IGYARNP LKQQLFSYAILGFALSEAMGLFCLM+AFLILFA
Sbjct:  132 SLQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 214          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Planmine SMEST
Match: SMESG000059768.1 (SMESG000059768.1)

HSP 1 Score: 157.918 bits (398), Expect = 1.765e-49
Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 2
Query:  149 MRSFLVNNVQKLSPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            MRSFLVNNVQKLSPLANIKDCKFHTSTVRNDIDQAAKYIGAGAATAGVAGSGAGIGTVFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF
Sbjct:    1 MRSFLVNNVQKLSPLANIKDCKFHTSTVRNDIDQAAKYIGAGAATAGVAGSGAGIGTVFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 105          
BLAST of Mitochondrial ATP synthase subunit 9 vs. Planmine SMEST
Match: SMESG000078181.1 (SMESG000078181.1)

HSP 1 Score: 102.834 bits (255), Expect = 7.924e-28
Identity = 81/97 (83.51%), Postives = 84/97 (86.60%), Query Frame = 2
Query:  173 VQKLSPLANIKDCKFHTSTVRNDIDQXXXXXXXXXXXXXXXXXXXXXXXXFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 463
            V K+S +  +     HTS    DIDQAAKYIGAGAATAGVAGSGAGIGTVFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF
Sbjct:   20 VIKVSSIPPVNSNYIHTSARICDIDQAAKYIGAGAATAGVAGSGAGIGTVFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGLFCLMMAFLILFAF 116          
The following BLAST results are available for this feature:
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP5MC14.685e-2586.75ATP synthase membrane subunit c locus 1 [Source:HG... [more]
ATP5MC15.286e-2578.95ATP synthase membrane subunit c locus 1 [Source:HG... [more]
ATP5MC25.335e-2579.35ATP synthase membrane subunit c locus 2 [Source:HG... [more]
ATP5MC25.335e-2579.35ATP synthase membrane subunit c locus 2 [Source:HG... [more]
ATP5MC25.335e-2579.35ATP synthase membrane subunit c locus 2 [Source:HG... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y82E9BR.34.682e-2468.81ATP synthase lipid-binding protein, mitochondrial ... [more]
Y82E9BR.34.682e-2468.81ATP synthase lipid-binding protein, mitochondrial ... [more]
Y82E9BR.34.682e-2468.81ATP synthase lipid-binding protein, mitochondrial ... [more]
Y82E9BR.34.682e-2468.81ATP synthase lipid-binding protein, mitochondrial ... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATPsynC4.667e-2778.35gene:FBgn0039830 transcript:FBtr0085774[more]
ATPsynC4.667e-2778.35gene:FBgn0039830 transcript:FBtr0085773[more]
ATPsynC4.667e-2778.35gene:FBgn0039830 transcript:FBtr0305121[more]
ATPsynC4.667e-2778.35gene:FBgn0039830 transcript:FBtr0085772[more]
ATPsynC4.667e-2778.35gene:FBgn0039830 transcript:FBtr0306237[more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5mc3a8.235e-2781.52ATP synthase membrane subunit c locus 3a [Source:Z... [more]
atp5mc3a8.235e-2781.52ATP synthase membrane subunit c locus 3a [Source:Z... [more]
atp5mc3b8.354e-2586.59ATP synthase membrane subunit c locus 3b [Source:Z... [more]
atp5mc3b8.354e-2586.59ATP synthase membrane subunit c locus 3b [Source:Z... [more]
atp5mc12.274e-2486.59ATP synthase membrane subunit c locus 1 [Source:ZF... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5mc33.538e-2586.75ATP synthase membrane subunit c locus 3 [Source:NC... [more]
atp5mc34.516e-2586.75ATP synthase membrane subunit c locus 3 [Source:NC... [more]
atp5mc35.185e-2586.75ATP synthase membrane subunit c locus 3 [Source:NC... [more]
atp5mc36.912e-2586.75ATP synthase membrane subunit c locus 3 [Source:NC... [more]
atp5mc16.132e-2285.19ATP synthase membrane subunit c locus 1 [Source:NC... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp5g12.813e-2580.43ATP synthase, H+ transporting, mitochondrial F0 co... [more]
Atp5g12.813e-2580.43ATP synthase, H+ transporting, mitochondrial F0 co... [more]
Atp5g12.813e-2580.43ATP synthase, H+ transporting, mitochondrial F0 co... [more]
Atp5g12.813e-2580.43ATP synthase, H+ transporting, mitochondrial F0 co... [more]
Atp5g24.420e-2580.43ATP synthase, H+ transporting, mitochondrial F0 co... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U505|AT5G_MANSE1.123e-2565.55ATP synthase lipid-binding protein, mitochondrial ... [more]
sp|Q5RAP9|AT5G2_PONAB8.266e-2579.35ATP synthase F(0) complex subunit C2, mitochondria... [more]
sp|Q9CR84|AT5G1_MOUSE1.968e-2480.43ATP synthase F(0) complex subunit C1, mitochondria... [more]
sp|Q06645|AT5G1_RAT2.410e-2480.43ATP synthase F(0) complex subunit C1, mitochondria... [more]
sp|Q06055|AT5G2_HUMAN2.562e-2479.35ATP synthase F(0) complex subunit C2, mitochondria... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UFR32.491e-2971.79Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EK722.950e-2971.79Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3SFT48.884e-2970.34ATP-synt_C domain-containing protein OS=Hymenolepi... [more]
A0A183ANJ82.853e-2868.64ATP-synt_C domain-containing protein OS=Echinostom... [more]
A0A0R3TAM13.489e-2867.80ATP-synt_C domain-containing protein OS=Rodentolep... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5mc3b7.740e-2781.52ATP synthase F(0) complex subunit C2, mitochondria... [more]
atp5mc3b1.320e-2681.52ATP synthase F(0) complex subunit C2, mitochondria... [more]
atp5mc3b1.320e-2681.52ATP synthase F(0) complex subunit C2, mitochondria... [more]
ENSAMXT00000036927.11.089e-2580.43ATP synthase F(0) complex subunit C3, mitochondria... [more]
ENSAMXT00000049606.11.224e-2580.43ATP synthase F(0) complex subunit C3, mitochondria... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atp5mc3a3.917e-2779.17ATP synthase membrane subunit c locus 3a [Source:Z... [more]
atp5mc3b4.349e-2675.00ATP synthase membrane subunit c locus 3b [Source:Z... [more]
atp5mc3b7.299e-2677.08ATP synthase membrane subunit c locus 3b [Source:Z... [more]
ENSPMAT00000000839.11.285e-2587.80pep scaffold:Pmarinus_7.0:GL479015:51266:53309:-1 ... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
OLI11.704e-1260.87F0-ATP synthase subunit c (ATPase-associated prote... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO428775.230e-2675.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5mc3b1.210e-2678.13ATP synthase membrane subunit c locus 3 [Source:NC... [more]
atp5mc3b3.129e-2678.13ATP synthase membrane subunit c locus 3 [Source:NC... [more]
ATP5MC23.113e-2587.80ATP synthase F(0) complex subunit C2, mitochondria... [more]
atp5mc14.341e-2487.65ATP synthase F(0) complex subunit C3, mitochondria... [more]
atp5mc14.305e-2385.54ATP synthase F(0) complex subunit C3, mitochondria... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit 9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000059768.11.765e-49100.00SMESG000059768.1[more]
SMESG000078181.17.924e-2883.51SMESG000078181.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024106 ID=SMED30024106|Name=Mitochondrial ATP synthase subunit 9|organism=Schmidtea mediterranea sexual|type=transcript|length=702bp
AAAAAATGTTAATGTAAATAATAATTTATCGTAAAAAAATCAGTGAAACT
TAATTTTACAAGCATTATTGTTTAATTATATTAAAACATAAATTAGTTTA
TTATCAAGTTGCAAAACCAAAAATATGTCACTATGCAGATTAAATCTAAT
GCGTTCCTTCTTAGTCAACAATGTGCAAAAGTTAAGTCCTCTTGCAAATA
TTAAAGACTGTAAATTCCATACTTCAACAGTTAGAAATGATATTGATCAA
GCAGCCAAATATATTGGTGCTGGTGCAGCTACTGCCGGAGTAGCTGGATC
TGGAGCAGGTATTGGAACAGTTTTTGGAAGTCTCGTAATCGGTTACGCAA
GAAATCCAGGATTGAAACAGCAATTATTCTCTTATGCCATTTTAGGTTTT
GCGCTCAGTGAAGCTATGGGTCTATTTTGTCTTATGATGGCATTTTTGAT
ATTATTTGCCTTTTAGTATGTCTTTTAGAGTTTAGGATGTTTTATTATTG
GAATGATGAAAATAAAAAAAATAGTGTTGAGTAGTAGTTATCGATGTGAC
AAATAAATTGTTGAAATTTTCGTATTTTAATGGTTCTCGTGCTACCAATA
CTCCCTGTTTGGGTTTTTAGGAGTAAATTTTCATGAATATTTTTTTAGTT
TTGTGATATTGTGACATTTTAGCAGTATTTCTATATTTAAGTTATGAAAT
TT
back to top

protein sequence of SMED30024106-orf-1

>SMED30024106-orf-1 ID=SMED30024106-orf-1|Name=SMED30024106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
MSLCRLNLMRSFLVNNVQKLSPLANIKDCKFHTSTVRNDIDQAAKYIGAG
AATAGVAGSGAGIGTVFGSLVIGYARNPGLKQQLFSYAILGFALSEAMGL
FCLMMAFLILFAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0015986ATP synthesis coupled proton transport
GO:0015991ATP hydrolysis coupled proton transport
GO:0006810transport
GO:0006811ion transport
GO:0015992proton transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR038662ATP_synth_F0_csu_sf
IPR035921F/V-ATP_Csub_sf
IPR000454ATP_synth_F0_csu
IPR002379ATPase_proteolipid_c-like_dom
IPR020537ATP_synth_F0_csu_DDCD_BS
Vocabulary: molecular function
TermDefinition
GO:0015078hydrogen ion transmembrane transporter activity
GO:0008289lipid binding
Vocabulary: cellular component
TermDefinition
GO:0045263proton-transporting ATP synthase complex, coupling factor F(o)
GO:0033177proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0005753mitochondrial proton-transporting ATP synthase complex
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031966mitochondrial membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000454ATP synthase, F0 complex, subunit CPRINTSPR00124ATPASECcoord: 47..66
score: 53.63
coord: 85..110
score: 58.41
coord: 68..83
score: 46.32
IPR000454ATP synthase, F0 complex, subunit CPANTHERPTHR10031ATP SYNTHASE LIPID-BINDING PROTEIN, MITOCHONDRIALcoord: 25..112
IPR038662F1F0 ATP synthase subunit C superfamilyGENE3DG3DSA:1.20.20.10coord: 40..111
e-value: 1.4E-36
score: 126.3
IPR002379V-ATPase proteolipid subunit C-like domainPFAMPF00137ATP-synt_Ccoord: 47..109
e-value: 2.7E-10
score: 40.4
NoneNo IPR availablePANTHERPTHR10031:SF31ATP SYNTHASE F(0) COMPLEX SUBUNIT C1, MITOCHONDRIALcoord: 25..112
NoneNo IPR availableCDDcd18182ATP-synt_Fo_c_ATP5G3coord: 65..109
e-value: 6.30206E-21
score: 77.1647
NoneNo IPR availableTMHMMTMhelixcoord: 89..111
NoneNo IPR availableTMHMMTMhelixcoord: 52..74
IPR020537ATP synthase, F0 complex, subunit C, DCCD-binding sitePROSITEPS00605ATPASE_Ccoord: 75..96
IPR035921F/V-ATP synthase subunit C superfamilySUPERFAMILYSSF81333F1F0 ATP synthase subunit Ccoord: 40..112