C-type lectin domain-containing protein

Overview
NameC-type lectin domain-containing protein
Smed IDSMED30024104
Length (bp)1080
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C-type lectin domain-containing protein (SMED30024104) t-SNE clustered cells

Violin plots show distribution of expression levels for C-type lectin domain-containing protein (SMED30024104) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024104

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30024104h1SMcG0018286 SmedASXL_002740SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30024104h1SMcG0018286 SmedASXL_002740SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30024104h1SMcG0018286 dd_Smed_v6_1155_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024104h1SMcG0018286 OX_Smed_1.0.02082ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: ACAN (aggrecan [Source:HGNC Symbol;Acc:HGNC:319])

HSP 1 Score: 75.485 bits (184), Expect = 4.842e-14
Identity = 42/129 (32.56%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  571 CPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            C  GW K YQ  C+ HF       DA R C E+ S L+S+   EE   F     Q Y+      +G  D   EG+++W D +  +F NW   +P+      E C +M++   G+WND+PC   +   C+
Sbjct: 1844 CEEGWNK-YQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQE-FVNNNAQDYQ-----WIGLNDRTIEGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCK 1965          
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: ACAN (aggrecan [Source:HGNC Symbol;Acc:HGNC:319])

HSP 1 Score: 75.485 bits (184), Expect = 4.940e-14
Identity = 42/129 (32.56%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  571 CPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            C  GW K YQ  C+ HF       DA R C E+ S L+S+   EE   F     Q Y+      +G  D   EG+++W D +  +F NW   +P+      E C +M++   G+WND+PC   +   C+
Sbjct: 2282 CEEGWNK-YQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQE-FVNNNAQDYQ-----WIGLNDRTIEGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCK 2403          
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: ACAN (aggrecan [Source:HGNC Symbol;Acc:HGNC:319])

HSP 1 Score: 75.485 bits (184), Expect = 4.949e-14
Identity = 42/129 (32.56%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  571 CPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            C  GW K YQ  C+ HF       DA R C E+ S L+S+   EE   F     Q Y+      +G  D   EG+++W D +  +F NW   +P+      E C +M++   G+WND+PC   +   C+
Sbjct: 2263 CEEGWNK-YQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQE-FVNNNAQDYQ-----WIGLNDRTIEGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCK 2384          
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: ACAN (aggrecan [Source:HGNC Symbol;Acc:HGNC:319])

HSP 1 Score: 75.485 bits (184), Expect = 4.953e-14
Identity = 42/129 (32.56%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  571 CPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            C  GW K YQ  C+ HF       DA R C E+ S L+S+   EE   F     Q Y+      +G  D   EG+++W D +  +F NW   +P+      E C +M++   G+WND+PC   +   C+
Sbjct: 2282 CEEGWNK-YQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQE-FVNNNAQDYQ-----WIGLNDRTIEGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCK 2403          
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Match: ACAN (aggrecan [Source:HGNC Symbol;Acc:HGNC:319])

HSP 1 Score: 75.485 bits (184), Expect = 4.961e-14
Identity = 42/129 (32.56%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  571 CPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            C  GW K YQ  C+ HF       DA R C E+ S L+S+   EE   F     Q Y+      +G  D   EG+++W D +  +F NW   +P+      E C +M++   G+WND+PC   +   C+
Sbjct: 2320 CEEGWNK-YQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQE-FVNNNAQDYQ-----WIGLNDRTIEGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCK 2441          
BLAST of C-type lectin domain-containing protein vs. Ensembl Celegans
Match: clec-52 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q17452])

HSP 1 Score: 57.7658 bits (138), Expect = 3.385e-9
Identity = 42/141 (29.79%), Postives = 65/141 (46.10%), Query Frame = 1
Query:  541 SFNDIKDYLNCPSGWYKLYQSECFHFKPNL---NLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENE-----GAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTE--SCLMV------YLSTGKWNDIP 915
            +F  +    +CPSG Y  ++   F +K  +   N NDAR  C+  G  LAS+++L EN      +K    N+     G + +G     S+  WQW D +   + NW  GEPN    E  + L+       Y    +WN++P
Sbjct:  156 TFPAVTIPSHCPSG-YTWFELTDFCYKNTVQYTNFNDARSACQADGGDLASIHSLAENTFLVGFSKAGCTNKDKDWTGDVFIGLVFQNSK--WQWTDGSVVDYVNWGDGEPNNMNKEWWTSLVADPHQGKYSEASRWNNVP 293          

HSP 2 Score: 51.9878 bits (123), Expect = 2.573e-7
Identity = 31/130 (23.85%), Postives = 53/130 (40.77%), Query Frame = 1
Query:  574 PSGWYKLYQSECFH-FKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGY----TDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRG 948
            P   Y+   S C   F+  ++   A   C      L SV+N  +N   + +A++  +  G   LG      D  +  NW W D  +  + N+  G+P    + +C+ +   T KW    C  K+  +C  
Sbjct:   22 PGALYQQSSSRCLTLFRAAVDFQTAESICATLNGHLVSVHNAIDNTFVSGQAQKFID--GGAWLGAQASAPDVTNPLNWYWTDGTDFNYQNYKVGQPTQTGSTACMQLETGTSKWQTANCTTKLPFICSA 149          
BLAST of C-type lectin domain-containing protein vs. Ensembl Celegans
Match: clec-53 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:P91429])

HSP 1 Score: 55.0694 bits (131), Expect = 2.440e-8
Identity = 40/132 (30.30%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECFHFKPNL---NLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGA-----IMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTE--SCLMVYLSTGK------WNDIP 915
            +CPSG Y  +++  F +K  +   N NDAR  C+  G  LAS++++ EN      +K    N+       + +G     S+  WQW D +   + NW  GEPN    E  + L+     GK      WN++P
Sbjct:  165 HCPSG-YTWFETTDFCYKTTVQFTNFNDARSACQADGGDLASIHSIAENAFLVGLSKAGITNKDKDWNDDVWIGLVYQNSK--WQWTDGSVVNYVNWGDGEPNNMNKEWWTALVADPHEGKNSEGTRWNNVP 293          

HSP 2 Score: 50.8322 bits (120), Expect = 5.546e-7
Identity = 33/135 (24.44%), Postives = 54/135 (40.00%), Query Frame = 1
Query:  574 PSGWYKLYQSECFH-FKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIM---LGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHILYVK 966
            P   Y+   S C   F+  +N   A   C      L S++N  +N   + +A Q Y + GA +       D  +  NW W D +   + N+  G+P    + +C+ +   T KW    C  K+  +C      V 
Sbjct:   22 PGSIYQQSNSRCLTLFRAAVNFQTAESICATLSGHLVSIHNAIDNAFVSSQA-QKYMDGGAWIGAQASAPDVTNPLNWYWTDGSNFDYQNYKVGQPTPPGSTACMQLETGTAKWQTANCTNKLPFICSAAATVVP 155          
BLAST of C-type lectin domain-containing protein vs. Ensembl Celegans
Match: clec-49 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9XUL6])

HSP 1 Score: 55.0694 bits (131), Expect = 2.665e-8
Identity = 36/118 (30.51%), Postives = 53/118 (44.92%), Query Frame = 1
Query:  613 HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYE--NEGAIMLGYTDAESEGNWQWLDENET-KFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHIL 957
            +F      + A + C   G  LASV N +EN L    A   ++  N     +G TD E+ G W+W D + T  ++NW  GEP  G+   C +     G W+ I C      VC   ++
Sbjct:   36 YFTAPAQFSFAEQQCNLLGGHLASVQNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYSNWQLGEPQSGS--DCAIQDKGDGTWSAIGCTSYRPYVCVTPVI 151          
BLAST of C-type lectin domain-containing protein vs. Ensembl Celegans
Match: Y38H6C.8 (pep chromosome:WBcel235:V:20514637:20515706:1 gene:WBGene00012621.1 transcript:Y38H6C.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38H6C.8)

HSP 1 Score: 51.9878 bits (123), Expect = 5.737e-8
Identity = 31/120 (25.83%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  595 YQSECFHF-KPNLNLNDARRYCEER-GSQLASVNNLEENN-LFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCR 945
            +   C+ F + +    DA   C +  G  L  + N+ +NN +  +    L  +  +  +G +DA    NW W+D +  +F+NW  G+P       C  + +STGKW    C  ++  +C+
Sbjct:   25 FGDSCYSFNRVHGKFKDANDLCVKMFGGSLVKITNIIDNNWMQKLAVNHLDADYNSFWIGASDAAHYTNWTWIDGSPMRFSNWGPGQPL--EDRHCGTMLISTGKWFSQVCDERIQFLCQ 142          
BLAST of C-type lectin domain-containing protein vs. Ensembl Celegans
Match: clec-50 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9XUL7])

HSP 1 Score: 53.1434 bits (126), Expect = 1.072e-7
Identity = 38/130 (29.23%), Postives = 56/130 (43.08%), Query Frame = 1
Query:  580 GWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYE--NEGAIMLGYTDAESEGNWQWLDENET-KFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHIL 957
            G Y  + + C+ +F        A   C   G  LASV N +EN L    A   ++  N     +G  D E+ G W+W D + T  ++NW  GEP  G+   C +     G W+ I C      VC   ++
Sbjct:   24 GIYNAHFNRCYQYFTAPAQFEFAEEQCNLLGGHLASVQNGQENALLQSNAANSFKRSNYSDYWIGANDLETSGTWKWTDPSVTFDYSNWQLGEPQSGS--DCAIQDKGDGTWSAIGCTSYRPYVCVTPVI 151          
BLAST of C-type lectin domain-containing protein vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072661)

HSP 1 Score: 59.3066 bits (142), Expect = 3.613e-10
Identity = 38/109 (34.86%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  643 ARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENE-TKFTNWNGGEPN-----GGTTESCLMVYLSTG---KWNDIPCYVKMNAVC 942
            A +YC   G  LAS+++ EEN+      +          +  TD   EGN+ W+       FTNWN GEPN      G  E+CL ++   G   KWND PC  +   VC
Sbjct:   75 ATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 183          
BLAST of C-type lectin domain-containing protein vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072660)

HSP 1 Score: 59.3066 bits (142), Expect = 3.613e-10
Identity = 38/109 (34.86%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  643 ARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENE-TKFTNWNGGEPN-----GGTTESCLMVYLSTG---KWNDIPCYVKMNAVC 942
            A +YC   G  LAS+++ EEN+      +          +  TD   EGN+ W+       FTNWN GEPN      G  E+CL ++   G   KWND PC  +   VC
Sbjct:   75 ATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 183          
BLAST of C-type lectin domain-containing protein vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072659)

HSP 1 Score: 59.6918 bits (143), Expect = 1.392e-9
Identity = 38/109 (34.86%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  643 ARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENET-KFTNWNGGEPN-----GGTTESCLMVYLSTG---KWNDIPCYVKMNAVC 942
            A +YC   G  LAS+++ EEN+      +          +  TD   EGN+ W+       FTNWN GEPN      G  E+CL ++   G   KWND PC  +   VC
Sbjct:  263 ATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 371          
BLAST of C-type lectin domain-containing protein vs. Ensembl Fly
Match: lectin-24Db (gene:FBgn0040102 transcript:FBtr0077469)

HSP 1 Score: 49.6766 bits (117), Expect = 2.396e-6
Identity = 31/103 (30.10%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  643 ARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDE-NETKFTNWNGGEPN-GGTTESCLMVYLSTGKWNDIPCYVKMNAVCR 945
            A  +C + G  +A++ + EE +  + +      ++ +  LG  D +S   +  +    E +F NWN GEPN G   E+C  V L   K ND PC+ K + +C+
Sbjct:  259 AVDFCRDMGGYIAAIKDQEELDAISARL-----DDKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENC--VELIRSKMNDDPCHRKKHVICQ 354          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-75b4.10 (si:dkeyp-75b4.10 [Source:ZFIN;Acc:ZDB-GENE-090313-394])

HSP 1 Score: 67.781 bits (164), Expect = 3.420e-13
Identity = 40/128 (31.25%), Postives = 63/128 (49.22%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECFHFKPNLNL-NDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEP-NGGTTESCL-MVYLSTGKWNDIPCYVKMNAVC 942
             CPSGW K + S+CF F        +A ++C + G  LAS+ +   +N      K+  +      +G  DA     W W D ++ +++ W+ GEP NGG  E C  M +    +WND  C  ++N +C
Sbjct:   27 RCPSGWEK-FGSQCFKFFSEYKTWAEAEKHCVDLGGNLASIQSDITHNFLIAYLKRQEKGITRTWIGAHDATQADIWFWSDGSKFEYSAWHSGEPNNGGNAERCAEMGFGDEQRWNDARCETRLNFIC 153          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-75b4.10 (si:dkeyp-75b4.10 [Source:ZFIN;Acc:ZDB-GENE-090313-394])

HSP 1 Score: 67.781 bits (164), Expect = 3.420e-13
Identity = 40/128 (31.25%), Postives = 63/128 (49.22%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECFHFKPNLNL-NDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEP-NGGTTESCL-MVYLSTGKWNDIPCYVKMNAVC 942
             CPSGW K + S+CF F        +A ++C + G  LAS+ +   +N      K+  +      +G  DA     W W D ++ +++ W+ GEP NGG  E C  M +    +WND  C  ++N +C
Sbjct:   27 RCPSGWEK-FGSQCFKFFSEYKTWAEAEKHCVDLGGNLASIQSDITHNFLIAYLKRQEKGITRTWIGAHDATQADIWFWSDGSKFEYSAWHSGEPNNGGNAERCAEMGFGDEQRWNDARCETRLNFIC 153          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-241l7.4 (si:dkey-241l7.4 [Source:ZFIN;Acc:ZDB-GENE-041014-238])

HSP 1 Score: 67.0106 bits (162), Expect = 4.565e-13
Identity = 44/131 (33.59%), Postives = 64/131 (48.85%), Query Frame = 1
Query:  556 KDYLNCPSGWYKLYQSECFHF-KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGK-WNDIPCYVKMNAVC 942
            ++ L C  GW     S CF F   ++N   A R C+  G  LASV++  EN+        L        +G  D E +G W W D +   +TNW  GEP+GG +E CL +  ++ + WND  C  +M  +C
Sbjct:   22 EERLRCERGWSG-SGSRCFRFFSRSVNWVTAERNCQSLGGNLASVHDQVENDFLL----SLVPGSTRCWIGGHDGEQDGQWLWSDGSVYGYTNWCSGEPSGG-SEHCLEINWTSNRCWNDQRCSTRMGYLC 146          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-241l7.4 (si:dkey-241l7.4 [Source:ZFIN;Acc:ZDB-GENE-041014-238])

HSP 1 Score: 67.0106 bits (162), Expect = 4.565e-13
Identity = 44/131 (33.59%), Postives = 64/131 (48.85%), Query Frame = 1
Query:  556 KDYLNCPSGWYKLYQSECFHF-KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGK-WNDIPCYVKMNAVC 942
            ++ L C  GW     S CF F   ++N   A R C+  G  LASV++  EN+        L        +G  D E +G W W D +   +TNW  GEP+GG +E CL +  ++ + WND  C  +M  +C
Sbjct:   22 EERLRCERGWSG-SGSRCFRFFSRSVNWVTAERNCQSLGGNLASVHDQVENDFLL----SLVPGSTRCWIGGHDGEQDGQWLWSDGSVYGYTNWCSGEPSGG-SEHCLEINWTSNRCWNDQRCSTRMGYLC 146          
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-241l7.4 (si:dkey-241l7.4 [Source:ZFIN;Acc:ZDB-GENE-041014-238])

HSP 1 Score: 67.0106 bits (162), Expect = 4.565e-13
Identity = 44/131 (33.59%), Postives = 64/131 (48.85%), Query Frame = 1
Query:  556 KDYLNCPSGWYKLYQSECFHF-KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGK-WNDIPCYVKMNAVC 942
            ++ L C  GW     S CF F   ++N   A R C+  G  LASV++  EN+        L        +G  D E +G W W D +   +TNW  GEP+GG +E CL +  ++ + WND  C  +M  +C
Sbjct:   22 EERLRCERGWSG-SGSRCFRFFSRSVNWVTAERNCQSLGGNLASVHDQVENDFLL----SLVPGSTRCWIGGHDGEQDGQWLWSDGSVYGYTNWCSGEPSGG-SEHCLEINWTSNRCWNDQRCSTRMGYLC 146          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: vrk2 (VRK serine/threonine kinase 2 [Source:Xenbase;Acc:XB-GENE-954461])

HSP 1 Score: 71.2478 bits (173), Expect = 2.515e-14
Identity = 45/144 (31.25%), Postives = 71/144 (49.31%), Query Frame = 1
Query:  532 LGISFNDIKDYLNCPSGWYKLYQSECF-HFKPNLNLNDARRYCEE--RGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESC---LMVYLSTGKWNDIPCYVKMNAVCR 945
            LG+S +D     +CP GW+  Y+S C+ +F+  L+ ++A   C     G+ LAS+ +  E ++        Y+  G + +G  D E    W+W D +   + NW  GEPN    E     L V     KWND PC ++ + VC+
Sbjct:   17 LGVSLSDAAPRSSCPYGWF-YYKSHCYGYFRFKLSWSEAEFECVSYGHGAHLASILDNAEADIIASHVSA-YQVNGDVWIGLHDPEQNRRWKWNDGSMYNYRNWKNGEPNNVNNEEYCGELAVETRFEKWNDAPCNIQNHFVCK 158          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000044886.1 (regenerating family member 1 beta [Source:NCBI gene;Acc:100485321])

HSP 1 Score: 67.781 bits (164), Expect = 3.864e-13
Identity = 41/145 (28.28%), Postives = 63/145 (43.45%), Query Frame = 1
Query:  520 FKDALGISFNDIKDYLNCPSGWYKLYQSECFHFKPN-LNLNDARRYCEE--RGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCR 945
             K    + F+     + CP GW+  Y+S C+    N +   DA   C     G+ LAS+ +  E  +         + EG + +G  D E  G W+W D +   F  W  G P+    +   +V L   KWND+ C  + N VC+
Sbjct:   12 LKLVFSLFFSGASVRMACPPGWF-FYRSHCYAVSKNPVPWADAEYECNSYGHGAHLASIMDDAEAAIIGSHVSASQDKEG-VWIGLHDPEKNGRWKWTDGSMYNFQAWKSGLPDNAKGKEFCVVLLEYKKWNDVGCGGRRNYVCK 154          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000001317.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:125388439:125508996:-1 gene:ENSXETG00000000905.1 transcript:ENSXETT00000001317.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 9.345e-13
Identity = 43/129 (33.33%), Postives = 63/129 (48.84%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFK-PNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENE--TKFTNWNGGEPN-GGTTESCLMVYLSTGKWNDIPC-YVKMNAVC 942
            C S W + ++  C++      N   AR +C + G  L  VN+ +E  L   K K    N     +G +D E EG W W+D  +  T +  W  GEPN  G  E C  +  + G+WND+ C Y + NA+C
Sbjct:   39 CDSAWIQ-FEDSCYYITTKKTNWQKARSFCVQEGGDLVVVNSEKEQFL---KEKSGVSNLKRFWIGLSDIEEEGTWTWVDGTDYSTSYQFWRAGEPNDAGGNEDCAHI-RTNGEWNDVHCTYAECNAIC 162          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000044866.1 (regenerating family member 1 beta [Source:NCBI gene;Acc:100485321])

HSP 1 Score: 63.1586 bits (152), Expect = 1.639e-11
Identity = 41/150 (27.33%), Postives = 66/150 (44.00%), Query Frame = 1
Query:  487 IDYLLNVENENFKDALGISFNDIKDYLNCPSGWYKLYQSECFHFKPN-LNLNDARRYCEE--RGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEP-NGGTTESCLMVYLSTGKWNDIPCYV 924
             ++L++V     K    + F+     + CP GW+  Y+S C+    N +   DA   C     G+ LAS+ +  E  +         + EG + +G  D E  G W+W D +   F  W  G P N    E C+++     KWND+ C +
Sbjct:    4 FEFLISV----LKLVFSLFFSGASVRMACPPGWF-FYRSHCYAVSKNPVPWADAEYECNSYGHGAHLASIMDDAEAAIIGSHVSASQDKEG-VWIGLHDPEKNGRWKWTDGSMYNFQAWKSGLPDNAKGKEFCVVLLGEYKKWNDVGCSI 147          
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000044902.1 (regenerating family member 1 beta [Source:NCBI gene;Acc:100485321])

HSP 1 Score: 63.1586 bits (152), Expect = 2.059e-11
Identity = 41/148 (27.70%), Postives = 63/148 (42.57%), Query Frame = 1
Query:  520 FKDALGISFNDIKDYLNCPSGWYKLYQSECFHFKPN-LNLNDARRYCEE--RGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTG---KWNDIPCYVKMNAVCR 945
             K    + F+     + CP GW+  Y+S C+    N +   DA   C     G+ LAS+ +  E  +         + EG + +G  D E  G W+W D +   F  W  G P+    +   +V L      KWND+ C  + N VC+
Sbjct:   19 LKLVFSLFFSGASVRMACPPGWF-FYRSHCYAVSKNPVPWADAEYECNSYGHGAHLASIMDDAEAAIIGSHVSASQDKEG-VWIGLHDPEKNGRWKWTDGSMYNFQAWKSGLPDNAKGKEFCVVLLGGSKYKKWNDVGCGGRRNYVCK 164          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Acan (aggrecan [Source:MGI Symbol;Acc:MGI:99602])

HSP 1 Score: 76.6406 bits (187), Expect = 1.391e-14
Identity = 44/141 (31.21%), Postives = 69/141 (48.94%), Query Frame = 1
Query:  535 GISFNDIKDYLNCPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            G + + + D   C  GW K +Q  C+ HF       DA R C E+ S L+S+   EE   F  K  Q Y+      +G  D   EG+++W D +  +F  W   +P+    T E C +M++   G+WND+PC  ++   C+
Sbjct: 1910 GETESTVADQEQCEEGWTK-FQGHCYRHFHDRETWVDAERRCREQQSHLSSIVTPEEQE-FVNKNAQDYQ-----WIGLNDRTIEGDFRWSDGHSLQFEKWRPNQPDNFFATGEDCVVMIWHERGEWNDVPCNYQLPFTCK 2043          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Ncan (neurocan [Source:MGI Symbol;Acc:MGI:104694])

HSP 1 Score: 74.3294 bits (181), Expect = 7.405e-14
Identity = 41/134 (30.60%), Postives = 63/134 (47.01%), Query Frame = 1
Query:  556 KDYLNCPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPN---GGTTESCLMVYLSTGKWNDIPCYVKMNAVCR 945
            KD   C  GW+K +Q  C+ +F       DA R C  R   L SV++ EE+          +EN     +G  D   E ++QW D    ++ NW   +P+    G  +  +MV   +G+WND+PC   +  VC+
Sbjct: 1035 KDTEGCDRGWHK-FQGHCYRYFAHRRAWEDAERDCRRRAGHLTSVHSPEEHKFINSFG---HENS---WIGLNDRTVERDFQWTDNTGLQYENWREKQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVCK 1161          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Mbl2 (mannose-binding lectin (protein C) 2 [Source:MGI Symbol;Acc:MGI:96924])

HSP 1 Score: 70.4774 bits (171), Expect = 1.467e-13
Identity = 39/106 (36.79%), Postives = 57/106 (53.77%), Query Frame = 1
Query:  628 LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG-GTTESCLMVYLSTGKWNDIPCYVKMNAVC 942
            ++L+  +  C E    +A+  N EEN+     AK +        LG TD   EG+++ L  N  ++TNWN GEPN  G  E C+++ L  GKWND+PC     A+C
Sbjct:  142 MSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIA------YLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVI-LGNGKWNDVPCSDSFLAIC 240          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Clec4d (C-type lectin domain family 4, member d [Source:MGI Symbol;Acc:MGI:1298389])

HSP 1 Score: 69.3218 bits (168), Expect = 2.666e-13
Identity = 56/196 (28.57%), Postives = 83/196 (42.35%), Query Frame = 1
Query:  382 SFISGDSCETC-GTQFYITESSMTQLSKISDDNNRHIDYLLNVENENFKDALGISFNDIKDYLNCPSGWYKLYQSEC-FHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDEN----ETKFTNWNGGEPNGGTTESCLMVYLSTGK--WNDIPCYVKMNAVCR 945
            SF+S     TC  T  Y    +   + K+SD + R    +  +  E    A G        +  CP  W + +QS C F    N   +++ R C    S L ++N   E N  T    QL +   +  LG  D   EG WQW+D+      T F  W  GE N    E C+++     K  WND PC+ ++  +C+
Sbjct:   29 SFLSACFISTCLVTHHYFLRWTRGSVVKLSDYHTR----VTCIREEPQPGATG------GTWTCCPVSW-RAFQSNCYFPLNDNQTWHESERNCSGMSSHLVTINTEAEQNFVT----QLLDKRFSYFLGLADENVEGQWQWVDKTPFNPHTVF--WEKGESNDFMEEDCVVLVHVHEKWVWNDFPCHFEVRRICK 207          
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Match: Cd209g (CD209g antigen [Source:MGI Symbol;Acc:MGI:1917442])

HSP 1 Score: 67.781 bits (164), Expect = 7.373e-13
Identity = 42/125 (33.60%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFKPNL-NLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVC 942
            CP  W +L+Q  C+ F   L +   +   CE+ G+ L  VN++ E     +K   + +N+    +G +D  SEG+WQW+D+   K + W  GEPN    E C  V ++  KWND  C      VC
Sbjct:   66 CPWDW-ELFQGSCYLFSRTLGSWETSASSCEDLGAHLVIVNSVSEQQF--LKYWHIRKNQ-LTWIGLSDHRSEGSWQWVDDTPLKLSFWKEGEPNNEGDEDC--VVMAEDKWNDSRCTANNFWVC 184          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|P86854|PLCL_MYTGA (Perlucin-like protein OS=Mytilus galloprovincialis OX=29158 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.900e-15
Identity = 38/121 (31.40%), Postives = 68/121 (56.20%), Query Frame = 1
Query:  565 LNCPSGWYKLYQSECFHFKPN-LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWL-DENETKFTNWNGGEPNGGTTESCLMVYLSTG-KWNDIPC 918
            +NCP+GW K Y++ C+ F P+  N +DA + C+  G  L  + + EEN+       +  +++    +G  D ++EG+W+W+ D +   ++NW+ G+PN    E C   + +   +WNDI C
Sbjct:   28 VNCPAGW-KKYKTNCYFFSPDGKNWHDAAKQCQTMGGYLVKITDSEENSWVVDMITKSVKHKYGYWMGMADLKNEGDWRWVNDSSAVSYSNWHRGQPNNANNEDCGHFWSAVNYEWNDIVC 147          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61282|PGCA_MOUSE (Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 9.729e-14
Identity = 44/141 (31.21%), Postives = 69/141 (48.94%), Query Frame = 1
Query:  535 GISFNDIKDYLNCPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            G + + + D   C  GW K +Q  C+ HF       DA R C E+ S L+S+   EE   F  K  Q Y+      +G  D   EG+++W D +  +F  W   +P+    T E C +M++   G+WND+PC  ++   C+
Sbjct: 1910 GETESTVADQEQCEEGWTK-FQGHCYRHFHDRETWVDAERRCREQQSHLSSIVTPEEQE-FVNKNAQDYQ-----WIGLNDRTIEGDFRWSDGHSLQFEKWRPNQPDNFFATGEDCVVMIWHERGEWNDVPCNYQLPFTCK 2043          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01758|ISP2_OSMMO (Type-2 ice-structuring protein OS=Osmerus mordax OX=8014 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.077e-13
Identity = 44/133 (33.08%), Postives = 66/133 (49.62%), Query Frame = 1
Query:  556 KDYLNCPSGWYKLYQSECFHFKP-NLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIM--LGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGK-WNDIPCYVKMNAVC 942
            K+   CP+ W K++   CF F P  L+   A+  C + G+ LAS+++LEE        K+L    G I   +G +D      W W+D     FT+W   +P+   TE C+ + +  GK WND PC     +VC
Sbjct:   33 KNLTECPTDW-KMFNGRCFLFNPLQLHWAHAQISCMKDGANLASIHSLEEYAF----VKEL-TTAGLIPAWIGGSDCHVSTYWFWMDSTSMDFTDWCAAQPDFTLTECCIQINVGVGKCWNDTPCTHLHASVC 159          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|P07897|PGCA_RAT (Aggrecan core protein OS=Rattus norvegicus OX=10116 GN=Acan PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 1.797e-13
Identity = 43/133 (32.33%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  559 DYLNCPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            D   C  GW K +Q  C+ HF       DA R C E+ S L+S+   EE   F  K  Q Y+      +G  D   EG+++W D +  +F  W   +P+    T E C +M++   G+WND+PC  ++   C+
Sbjct: 1910 DQEQCEEGWTK-FQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQE-FVNKNAQDYQ-----WIGLNDRTIEGDFRWSDGHSLQFEKWRPNQPDNFFATGEDCVVMIWHERGEWNDVPCNYQLPFTCK 2035          
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Match: sp|P16112|PGCA_HUMAN (Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 2.382e-13
Identity = 42/129 (32.56%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  571 CPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            C  GW K YQ  C+ HF       DA R C E+ S L+S+   EE   F     Q Y+      +G  D   EG+++W D +  +F NW   +P+      E C +M++   G+WND+PC   +   C+
Sbjct: 2320 CEEGWNK-YQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQE-FVNNNAQDYQ-----WIGLNDRTIEGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCK 2441          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: I3KXG2 (C-type lectin domain-containing protein OS=Oreochromis niloticus OX=8128 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.680e-15
Identity = 43/131 (32.82%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECFHFKPN-LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYEN-EGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLM-VYLSTGKWNDIPCYVKMNAVCRGH 951
            NCP  W+  + S C+ +    ++ +DA  +C  +G+ L S++N+EE  +F     +++++ + A  +G +D   EG W W D +  +F NW  GEPN    E+C+   Y +  KWND PC     +VC  H
Sbjct:   25 NCPPFWWS-FSSRCYKYVATPMSWSDAEFHCLSQGANLVSIHNMEEE-IFVRSLIEIFDHAQRATWIGLSDIHREGRWMWSDGSVARFFNWKTGEPNNDGEENCVTNNYHTVKKWNDWPCSSSFASVCVKH 153          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: A0A3P8NPD7 (C-type lectin domain-containing protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.661e-15
Identity = 44/142 (30.99%), Postives = 74/142 (52.11%), Query Frame = 1
Query:  520 FKDALGISFNDIKDYLNCPSGWYKLYQSECFHFKPN-LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVC 942
            F  ++  +++  +    CP+GW ++++  CF + P  +N   A R C   G+ LASV+   E+ L  ++    +   G   +G TDA  EG W W D +   + NW GGEPN    + CL +  S+  W+D  C+V + ++C
Sbjct:    4 FLRSITTAYHQSQRCRGCPNGWSRIHR-RCFLYVPRAMNWATAERNCLSMGANLASVHTSAEHQL--IQRLTAHNGYGVTWVGGTDASGEGIWLWSDGSRFNYQNWCGGEPNNYLKQDCLQINYSSKCWDDQHCHVNLPSIC 142          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: V9L209 (C-type lectin domain family 4 member E-like protein OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 4.938e-15
Identity = 59/196 (30.10%), Postives = 93/196 (47.45%), Query Frame = 1
Query:  364 EILKNKSFISGDSCETCGTQFYITESSMTQLSKISDDNNRHIDYLLNVENENFKDALGISFNDIKDYLNCPSGWYKLYQSECFHFKPN-LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFT--NWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVC 942
            E+ K K  +S  S +       + E  ++ +  +S    RH + L++V +E  KDA G+    IK    CP  W   +  +C++F  N L   +A+  C  + + L  +NN+ E    ++       N     +G +D E EG WQW+D    + T  +W  GEPN            +TGKWNDIPC++K  A+C
Sbjct:   25 ELSKVKDMVSAISTQMKQINVDLMEE-VSHIRNVSAQLKRHQNNLMDVMSE-MKDA-GL----IKQL--CPKAWLN-FNKKCYYFLNNSLTWENAKDTCSGKQAHLVVINNIAEQLFLSLG------NSRENWIGLSDIEKEGQWQWVDGTSYELTPKHWKAGEPNDSNNAEDCACLATTGKWNDIPCHLKKTAIC 204          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: A0A3P8QSB4 (C-type lectin domain-containing protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 5.767e-15
Identity = 43/130 (33.08%), Postives = 65/130 (50.00%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECFHFKPNL-NLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMV-YLSTGKWNDIPCYVKMNAVCRGH 951
            NCP+ W+  +   C+ +     + +DA  YC  +G+ L S++N+EE+N      +    +E A  +G +D   EG W W D +   F NW  GEPN    E C+   Y +  +WND PC     +VC  H
Sbjct:   32 NCPTYWWS-FNGRCYKYVATPKSWSDAEFYCLSQGAHLVSIHNMEEDNFVRSLIRNSDPDERATWIGLSDIHREGRWMWSDGSVVDFFNWKKGEPNNRGNEDCVTRNYRTIKQWNDWPCSSSCASVCLKH 160          
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Match: A0A060YWB0 (C-type lectin domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00010197001 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 6.749e-15
Identity = 47/129 (36.43%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  562 YLNCPSGWYKLYQSECFHF-KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGK-WNDIPCYVKMNAVC 942
            Y NCP  W   Y + CF +    L+  DA  YC   G+ LASVN+  E +      K     E    +G +D   EG W W D ++  +T+W+ GEPNG   E+C+       K WNDI C  K   VC
Sbjct:   35 YTNCPQDWSS-YNNRCFRYVASQLDWADAESYCVTLGANLASVNDKGEFSFVKNLIKSFDPAESYTWIGLSDLHKEGRWMWTDGSKVVYTSWSLGEPNGSRKENCVHTNFQKDKLWNDITCSYKHAFVC 162          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030897.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:18943369:18961484:-1 gene:ENSAMXG00000014806.2 transcript:ENSAMXT00000030897.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 3.434e-14
Identity = 40/131 (30.53%), Postives = 63/131 (48.09%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCL-MVYLSTGKWNDIPCYVKMNAVCRGHI 954
            +CP  W   +   CF +F   ++   A  +C   G+ LAS++N  E  L     +    NE  + +G +  + + NW W D ++  +TNWN  EPN    E C+ M + +   WNDIPC  K   +C   +
Sbjct:   58 DCPKDWVT-FNRRCFKYFGQEMDWASAEDHCLSLGANLASIHNENEYQLVKALIRGKDPNENPVWIGLSACQKKYNWIWSDGSKLTYTNWNPNEPNFAYEECCVHMNFGAQMNWNDIPCDFKFAFICAKKL 187          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000017124.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001941.1:105384:109943:1 gene:ENSAMXG00000016629.2 transcript:ENSAMXT00000017124.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 8.528e-14
Identity = 41/128 (32.03%), Postives = 61/128 (47.66%), Query Frame = 1
Query:  580 GWYKLYQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHILYV 963
            GW     S  +      N  ++R  C ERGS L  +N+ EE N   M  K  Y+    + +G  D+E+EG W+W+D +E     W  GEPN    E C+   ++   W D PC  + N +C   I+ +
Sbjct:   15 GWIYFSSSIYYVSTEKKNWTESRDDCRERGSVLLIINSREEQNFINMWRK--YQE---VWIGLGDSETEGVWKWVDGSELITGFWRAGEPNSKGDEDCV---INEWNWADYPCNSQFNWICEKRIMTI 134          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000046950.1 (lactose-binding lectin l-2-like [Source:NCBI gene;Acc:103037032])

HSP 1 Score: 69.707 bits (169), Expect = 8.602e-14
Identity = 38/127 (29.92%), Postives = 63/127 (49.61%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMV-YLSTGKWNDIPCYVKMNAVC 942
            +CP GW + +   CF +F  +++   A  YC   G  LAS+++  E  +     +     E    +G ++ + + +W W D N  +++ WN  EPN  + E C+ + Y S   WNDIPC    + VC
Sbjct:   53 SCPYGWVQ-FDGRCFSYFGYSMDWAAAEAYCINLGGNLASIHSENEYQVVKALVRAYDPKEQETWIGLSNCQKKNSWLWSDGNRYRYSKWNNKEPNHSSGECCVHINYGSQKDWNDIPCNKAYSFVC 178          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: acana (aggrecan core protein-like [Source:NCBI gene;Acc:103021642])

HSP 1 Score: 73.1738 bits (178), Expect = 1.443e-13
Identity = 39/133 (29.32%), Postives = 62/133 (46.62%), Query Frame = 1
Query:  559 DYLNCPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            D   C  GW K +Q  C+ HF       +A ++C   G+ L S+ N EE   F     Q Y+      +G  D   E ++QW D    ++ NW   +P+    + E C +M++   G+WND+PC   +   C+
Sbjct: 1293 DVDTCAEGWTK-FQGHCYLHFSERQTWEEAEQHCRSLGAHLVSITNREE-QFFVNSHAQDYQ-----WIGLNDKTFENDFQWSDGTPLQYENWRPNQPDNYFNSGEDCVVMIWHENGQWNDVPCNYHLPFTCK 1418          
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Match: acana (aggrecan core protein-like [Source:NCBI gene;Acc:103021642])

HSP 1 Score: 72.7886 bits (177), Expect = 1.690e-13
Identity = 39/133 (29.32%), Postives = 62/133 (46.62%), Query Frame = 1
Query:  559 DYLNCPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            D   C  GW K +Q  C+ HF       +A ++C   G+ L S+ N EE   F     Q Y+      +G  D   E ++QW D    ++ NW   +P+    + E C +M++   G+WND+PC   +   C+
Sbjct: 1331 DVDTCAEGWTK-FQGHCYLHFSERQTWEEAEQHCRSLGAHLVSITNREE-QFFVNSHAQDYQ-----WIGLNDKTFENDFQWSDGTPLQYENWRPNQPDNYFNSGEDCVVMIWHENGQWNDVPCNYHLPFTCK 1456          
BLAST of C-type lectin domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001836.1 (pep scaffold:Pmarinus_7.0:GL478684:172:28670:1 gene:ENSPMAG00000001649.1 transcript:ENSPMAT00000001836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 2.864e-14
Identity = 42/133 (31.58%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  559 DYLNCPSGWYKLYQSECFHFKPNL-NLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR 945
            D   C  GW K +Q  C++F P   N  DA R C   GS LAS+ + EE   F  +  Q Y+      +G  D   E +++W D +  ++ NW   +P+      E C +M++   G+WND+PC   +   C+
Sbjct: 1618 DTQQCEVGWQK-FQGHCYNFFPQRRNWEDAERDCRLHGSHLASILSSEEQR-FINRMAQDYQ-----WIGLNDKMFEHDFRWSDGHTLQYENWRPAQPDSFFFDGEDCVVMIWHENGQWNDVPCNYYLPYTCK 1743          
BLAST of C-type lectin domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003237.1 (pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 gene:ENSPMAG00000002956.1 transcript:ENSPMAT00000003237.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 6.897e-10
Identity = 39/144 (27.08%), Postives = 66/144 (45.83%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECFHF-KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG--GTTESC-LMVYLSTGKWNDIPCYVKMNAVCR------GHILYVKN 969
            +C  GW+  +   C+ +    L   +A   C   G  LAS+ + +ENN F +     Y+      +G  D  SEG++ W D ++  F +W   +P+    + E C ++++   G+WND+PC   +   C       GH   V N
Sbjct:    1 SCEPGWHG-FGGRCYRYVAERLPWAEAEEACRSVGGHLASIASRDENN-FILALGSDYQ-----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCCETQPGRCGHPPIVSN 137          
BLAST of C-type lectin domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004493.1 (pep scaffold:Pmarinus_7.0:GL476717:442705:443808:1 gene:ENSPMAG00000004092.1 transcript:ENSPMAT00000004493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 2.231e-9
Identity = 42/136 (30.88%), Postives = 57/136 (41.91%), Query Frame = 1
Query:  571 CPSGWYKLYQSEC-FHFKPNL----NLNDARRYCE-ERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG-----GTTESCLMVYLSTGKWNDIPCYVKMNAVCR 945
            C +GW + Y   C F F  +L       +AR+ CE    S LAS+++  +           Y N   + +G    E    W W D+    +TNW  GEPN         ESC+  Y   G WND  C  K   +CR
Sbjct:    1 CWNGW-QPYGRHCYFIFDGSLGGATTWPEARQECEIVHRSHLASIHSRADTEFLLRANFTRYHN---LWIGLGRDERAVGWSWADDTPVGYTNWADGEPNDIMHEEAFLESCVEFYHHDGTWNDQDCEQKRGFICR 132          
BLAST of C-type lectin domain-containing protein vs. Ensembl Sea Lamprey
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 57.3806 bits (137), Expect = 3.042e-9
Identity = 34/117 (29.06%), Postives = 55/117 (47.01%), Query Frame = 1
Query:  607 CFHFKPN--LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIM-LGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLS-TGKWNDIPCYVKMNAVCR 945
            C+ F  +  L+ ++AR  C ++GS L S+  + E               GAIM +G  D +S+G WQW D +  K  NW+ G P+    ++C ++      KW    C   +  VC+
Sbjct:  204 CYQFNVHAVLSWHEARTSCLQQGSDLLSITEMHEQTYIA----GFLSGFGAIMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFFSKWQTKECAAALPYVCK 316          

HSP 2 Score: 56.9954 bits (136), Expect = 3.661e-9
Identity = 33/126 (26.19%), Postives = 53/126 (42.06%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRG 948
            CP GW     S  +         DA   C   G  L S++ L + +      + +  +   + LG  D +++  ++W D     FT W+   PN    E C+ ++   G+W D PC  K  +VCR 
Sbjct:  338 CPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLSLHGLADVDFLV---QHVLSDGEEVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNSRPGEGCVSLWGKEGRWKDGPCDAKKASVCRA 460          

HSP 3 Score: 47.7506 bits (112), Expect = 3.370e-6
Identity = 39/147 (26.53%), Postives = 64/147 (43.54%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECFHFKPN----LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNW--NGGEPNGGTTE-------SCLMVYLS-----TGKWNDIPCYV-KMNAVCRGH 951
            NCP GW+ ++  +C  F            A+ YCE + + LA++ N  E     +K   L   + +  +G     S G + WL+E+   FTNW      P G           SC++V+       TGKW+   C + + N +C+ +
Sbjct:  931 NCPDGWH-VFGDKCLGFVDGPGQARTWMGAKEYCESQDATLATIANHLEQAFIILK---LAPGQDSYWVGLHVRASVGAFTWLEEHNVTFTNWMHPAWAPRGQRPRLWLVMQVSCVLVWNGPPLHFTGKWDSRNCVLEEHNFICQKY 1073          
BLAST of C-type lectin domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004490.1 (pep scaffold:Pmarinus_7.0:GL476717:438077:441513:1 gene:ENSPMAG00000004073.1 transcript:ENSPMAT00000004490.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 5.293e-8
Identity = 38/137 (27.74%), Postives = 56/137 (40.88%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFKPNL----NLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGA-IMLGYTDAESEGNWQWLDENETK-FTNWNGGEP-NGGTTESCLMVYLS---TGKWNDIPCYVKMNAVCRGH 951
            CP GW   +   C+    +L      N+A   C+  G+QL S+N+++E +        L  N      +G +D E +G  +W D      FTNW    P N      C  +Y     +GKW    C    + VC  H
Sbjct:   27 CPEGWVP-FAGRCYWVVTSLVRRTTWNEALFTCQRVGAQLLSINSVDEQDFINSLIPDLQNNRVVDFWIGASDKERDGEMKWSDGTAVSGFTNWAANHPRNTPGRWDCGQIYTGGSESGKWETTDCIKVQSFVCEVH 162          
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Match: EDO49512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE1])

HSP 1 Score: 70.8626 bits (172), Expect = 2.674e-13
Identity = 46/149 (30.87%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  547 NDIKD-----YLNCPSGWYKLYQSECFHFK-PNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEP-NGGTTESCLMVY---LSTGKWNDIPCYVKMNAVCRGHILYV 963
            ND+ D     + NC +GW K +   C+ F     + + AR+ C+  G  L S+ +  E    T++  Q    E A  +G  D   E  W+W D +  +FTNW   +P N    E C   Y    + G+WND+PCY   + +C+    YV
Sbjct:  921 NDVTDIYNSEFGNCKTGW-KEFGQFCYQFNMEKKSWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYA-WIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYV 1067          

HSP 2 Score: 67.3958 bits (163), Expect = 3.366e-12
Identity = 40/132 (30.30%), Postives = 60/132 (45.45%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFK---PNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGT-TESCLMVYLSTGKWNDIPCYVKMNAVCRGHI 954
            C  GW K +   C+ F      +  + AR  C  +G+ L S+ N EE +    ++K  Y    +I +G  D   EG WQW D +   +  WNGGEPN     E+C  +      WND  C  +   +C+  +
Sbjct: 1774 CQPGWVK-FDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQSKSSYR---SIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGEMVAGNRLWNDYSCSQQRGYICKSKL 1901          

HSP 3 Score: 60.077 bits (144), Expect = 7.006e-10
Identity = 36/130 (27.69%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEP-NGGTTESCLMV---YLSTGKWNDIPCYVKMNAVCR 945
            +CPSG+ K  +S    +   LN  +A   C++ G+QL S++ ++E        K L  N   +  G     +   + W D++  ++TNW  G+P   GT+++C+ V     S G+W+ + C +K + +C+
Sbjct: 1632 DCPSGYSKYGESCYLMYYNKLNWKEAGEVCQKDGAQLISIHGVKEQAYMIKNLKDLVGN---VWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCK 1758          

HSP 4 Score: 55.4546 bits (132), Expect = 2.460e-8
Identity = 42/134 (31.34%), Postives = 62/134 (46.27%), Query Frame = 1
Query:  568 NCPSGWYKLYQSECFHFKPN------LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKF-TNWNGGEPNG-GTTESCLMVYLSTGKWNDIPCYVKMNAVCR 945
            +C  GW  L  S C+ F  +       +  +A   C+  G  LAS+++  E N  T + KQ Y NE    +G+ D  +E ++ W D     F TNW  GEPN     E C  +    G WND  C  + + +C+
Sbjct:   24 DCTVGWEALGGS-CYKFIVSSLTVRGQSWENAENLCQSYGGHLASISDQSEQNFITGRIKQ-YTNE-HFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTELLYQDGLWNDDDCSKEYSFICK 154          

HSP 5 Score: 51.2174 bits (121), Expect = 5.091e-7
Identity = 39/134 (29.10%), Postives = 62/134 (46.27%), Query Frame = 1
Query:  571 CPSGWYKLYQSE-CFHFKPNLNL-NDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG-GTTESCLMVYLSTGK-----WNDIPCYVKMNA-VCR 945
            CP GW +      C+    +     DAR  C  +G++LAS++   E+ L T      ++  G + +G TD    G ++W D +   +T+W  GEPN  G T SC+   ++        W D  C    +A VC+
Sbjct: 1085 CPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWD-AGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEPNDRGITGSCVRATMTVSSRDWMYWVDSDCTENSHAYVCK 1217          

HSP 6 Score: 49.6766 bits (117), Expect = 1.542e-6
Identity = 37/133 (27.82%), Postives = 55/133 (41.35%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFKPNLNLN-----DARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG-GTTESCLMVYLSTGKWNDIPCYVKMNAVCRGH 951
            C +GW   +   C++F      +     +AR +C +    L S+    EN     + K  Y     + +G  D  +EG   W D +   + NW   EPN     E C  +    G+WND  C +K   VCR H
Sbjct: 1332 CDAGWV-YWGGLCYYFSNATTADLKTWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYY-YWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGEMSRFDGRWNDQNCNLKRTFVCRKH 1462          

HSP 7 Score: 49.2914 bits (116), Expect = 2.093e-6
Identity = 39/139 (28.06%), Postives = 55/139 (39.57%), Query Frame = 1
Query:  571 CPSGWYKLYQSEC--FHFKPNLNLNDARRYCEE-----RGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLST---GKWNDIPCYVKMNAVCRGHIL 957
            C SGW   Y   C  F F    N  +A   C +         L  +NNL E    T     L  N G + +G  D  +EG + W+D +   +TNW  G+P       C+ +  S+   G+W+   C      VC    L
Sbjct: 1484 CDSGWIN-YDKSCYKFVFDQRQNWVNAESVCSQGLNSTNSGHLVVINNLYEQAFLTT---MLASNRGNVWIGLNDLHTEGTFGWVDYSSVAYTNWIAGKPGWSYWADCVGMSTSSSSLGEWDVEVCSGFQGYVCETDAL 1618          

HSP 8 Score: 47.3654 bits (111), Expect = 9.605e-6
Identity = 36/137 (26.28%), Postives = 53/137 (38.69%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFKPN----LNLNDARRYCEER--GSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPN--GGTTESCLMVY----LSTGKWNDIPCYVKMNAVCR 945
            CP  W   Y+  C+HF  +    +    A   C+    GS L S+   +E               G I LG  D  SEG + W D +   +TNW   EP+  G  +  C+ +       +G W  + C      VC+
Sbjct:  298 CPVNWVP-YKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSD--RKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCK 431          
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Match: EDO38432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD09])

HSP 1 Score: 64.3142 bits (155), Expect = 9.211e-13
Identity = 36/129 (27.91%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHF---KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTG-KWNDIPCYVKMNAVCR 945
            CP GW K+++  C+ F    P L+ + AR  C+ RG+ L  V +  E++   +K     +      +G TD   E  + W D  +  + +W   +P+G T E+C+ ++ S+  K+ DI C   +  +C+
Sbjct:    1 CPEGW-KVFRGSCYFFNLASPFLSYDQAREDCKGRGANLTDVQDANEHSF--LKRHISPDANIGYFIGLTDEAEEEVFVWQDGKKASYLDWGLSDPSGSTNENCVALHSSSSFKFVDISCADSLGHICK 126          
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Match: EDO49509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGD7])

HSP 1 Score: 68.9366 bits (167), Expect = 1.141e-12
Identity = 43/136 (31.62%), Postives = 65/136 (47.79%), Query Frame = 1
Query:  553 IKDYLNCPSGWYKLYQSECFHFKPN-LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEP-NGGTTESCLMVYLST---GKWNDIPCYVKMNAVCR 945
            I ++  C +GW K Y   C+ F  +  N   AR  C+ RG +L S+ +  E    T++    +       +G+ D   E  W+W D +  +FTNW   +P N   +E C   Y  T   G+WNDI CY  M  +C+
Sbjct:  937 ISEFGVCRTGW-KEYGQYCYQFNSDKRNWQSARLMCQNRGGELVSILSPVEQAHITLEVG-FFGLSTFAWIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICK 1070          

HSP 2 Score: 67.781 bits (164), Expect = 2.866e-12
Identity = 43/131 (32.82%), Postives = 65/131 (49.62%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHF------KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCR 945
            C +GW + Y S C+ F      +  L+  DA   C+  G +L S+ +  E +  T ++   Y NE    +G+ D  SEGN+ W+D + + F NW  GEPN    E C     +TG+WND  C      +C+
Sbjct:   26 CQAGW-ESYSSYCYLFVVRSQSQIGLSWEDADIDCQSYGGRLTSILDRNEQSFIT-RSTIRYRNE-RFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAVWNTGQWNDELCSNTYGYICK 153          

HSP 3 Score: 58.9214 bits (141), Expect = 1.949e-9
Identity = 38/135 (28.15%), Postives = 63/135 (46.67%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFKPN----LNLNDARRYCE-ERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGT---TESCLMVYLST--GKWNDIPCYVKMNAVCR 945
            CP  W  +  S CF F  +    L  + A+  C    G+ LASV  ++E N    +          + +G+ D  +EG + W D  +  +TNW+  EP  GT   ++ C+++   +  G W+  PC +K   +CR
Sbjct:  310 CPVNWVTIGDS-CFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARN--VWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCR 441          

HSP 4 Score: 57.7658 bits (138), Expect = 4.830e-9
Identity = 33/126 (26.19%), Postives = 57/126 (45.24%), Query Frame = 1
Query:  586 YKLYQSECFHFK--PNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGG-TTESCLMVYLSTGKWNDIPCYVKMNAVCRGHI 954
            +K +   C+ F+    L    AR  C+  G  L S+ + +E +    + K +  N   I  G  D   E  ++W D +   FT+W  G+PN     ++C+ V    G WND+ C  +   +C+  +
Sbjct: 1792 FKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTV--NGIWIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCVAVQTRMGSWNDVNCMQRRGYICKAKL 1915          

HSP 5 Score: 55.0694 bits (131), Expect = 2.877e-8
Identity = 35/111 (31.53%), Postives = 55/111 (49.55%), Query Frame = 1
Query:  571 CPSGWYKLYQS-ECFHFKPNLNL-NDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG-GTTESCLMVYLST 894
            CP+GW +      C+    +     DAR  C  +G++LAS++   E+ L T      ++  G + +G TD    G ++W D +   +TNW  GEPN  G T SC+   L+ 
Sbjct: 1186 CPAGWQRSPDGNACYGLTLDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWD-AGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPNDRGVTGSCVRATLTV 1295          

HSP 6 Score: 52.7582 bits (125), Expect = 1.704e-7
Identity = 33/103 (32.04%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  640 DARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGT-TESCLMVYLSTGKWNDIPCYVKMNAVCR 945
            DAR  C++ G++L S+ +  EN       +  Y +   I +G  D + E  ++W D +   +TN+N  EPN     E CL +    GKWND  C  K   +C+
Sbjct: 1372 DARAACQQAGAELISIQSAAENAFVYSGFRAKYRSW-TIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRWNGKWNDNQCNRKNPYICK 1473          

HSP 7 Score: 49.2914 bits (116), Expect = 2.220e-6
Identity = 37/142 (26.06%), Postives = 60/142 (42.25%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFKPN--LNLNDARRYCEERGS------QLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMV---YLSTGKWNDIPCYVKMNAVCRGHILYV 963
            C SGW   Y   C+ F      N  +AR  C+ RG+       L +++N  E   F       Y ++    +G  D  +EG + W D +  ++TNWN  +P       C+ +     + GKW   PC  ++  +C    L +
Sbjct: 1496 CNSGWLH-YDKSCYKFVATERQNWANARLRCD-RGTNSSMYGDLVTIDNQYEQ-AFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPI 1634          

HSP 8 Score: 48.521 bits (114), Expect = 3.553e-6
Identity = 30/115 (26.09%), Postives = 48/115 (41.74%), Query Frame = 1
Query:  565 LNCPSGWYKLYQSECFHFKPN-LNL-NDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKW 903
            + C  GW +     C+ F  + L +  DAR  C  RG  L S+    E +    + K L  +  ++ +G  D ES   + W D++    T W+ G P   T  +    +  T  W
Sbjct:  607 VRCGVGWEEGPDDTCYQFNTDTLKIWADARAVCNGRGGDLLSIVTANEKSYIEKRIKPLAGSSASLWIGLNDRESNRLFSWSDQSPFVITRWDAGYPKDTTITTTQKKFSMTANW 721          

HSP 9 Score: 47.3654 bits (111), Expect = 8.482e-6
Identity = 36/131 (27.48%), Postives = 61/131 (46.56%), Query Frame = 1
Query:  565 LNCPSGWYKLYQSECFHF-KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWL-DENETKFTNWNGGEPNGGT-TESC--LMVYLSTGKWNDIPCYVKMNAVC 942
            + C  GW + + + C+ F       + A+  C   G  L  V++  E N  + +++ + +   ++ +G TD  +EG++ W  D     +TNW  GEPN  +  E C  +M     G WND  C    N +C
Sbjct:  175 IVCDFGW-EFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQ---SMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFIC 301          
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Match: EDO38614 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCJ8])

HSP 1 Score: 66.6254 bits (161), Expect = 1.452e-12
Identity = 42/149 (28.19%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  502 NVENENFKDALGISFNDIKDYLNCPSGWYKLYQSECFHFK-PNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCR 945
            NV   N K  L  +         CP GW+  + + C+  K  N+    A++ C    S + S+++++EN       + L+ ++  I LG  D  S G+W+W D +   FT W    P+G   + C+ +    GKWND  C + +  VC+
Sbjct:  129 NVSKSNCKHGLEYTHYKKLSLAQCPLGWHH-HANNCYVIKFENVTWQVAKQRCHSMDSAMVSISSVKENAF----VRGLFYSD-TIWLGLEDFSS-GSWRWEDGSPASFTYWQASAPSGQLGQDCVKMSHQRGKWNDCQCDLLLPYVCK 270          
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Match: EDO27896 (pep supercontig:ASM20922v1:NEMVEscaffold_3035:5431:6413:-1 gene:NEMVEDRAFT_v1g149561 transcript:EDO27896 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 3.159e-11
Identity = 36/125 (28.80%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  574 PSGWYKLYQSECFHFK-PNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCR 945
            P GW+  + + C+  K  N+    A++ C    S + S+++++EN       + L+ ++  I LG  D  S G+W+W D +   FT W    P+G   + C+ +    GKWND  C + +  VC+
Sbjct:    2 PLGWHH-HANNCYVIKFENVTWQVAKQRCHSMDSAMVSISSVKENAF----VRGLFYSD-TIWLGLEDFSS-GSWRWEDGSPASFTYWQASAPSGQLGQDCVKMSHQRGKWNDCQCDLLLPYVCK 119          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033058.1 (pep primary_assembly:ASM223467v1:21:6426657:6438028:1 gene:ENSORLG00000027148.1 transcript:ENSORLT00000033058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 2.228e-15
Identity = 42/138 (30.43%), Postives = 68/138 (49.28%), Query Frame = 1
Query:  538 ISFNDIKDY-LNCPSGWYKLYQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEP-NGGTTESCLMVYL-STGKWNDIPCYVKMNAVC 942
            I+ +D K +   CP  W +   S  F  + + + ++AR+ C+ RG+ L  +N+ +EN   +        N     +G TD + EG W+W+D +    T W  G+P N    E C+  +  S G WNDIPC +    +C
Sbjct:    3 ITLSDFKKWKTGCPEKWTRFCSSCYFLSEESKSWDEARKSCKARGADLVVINSKDENEFISKL------NTERCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLIC 134          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037766.1 (pep primary_assembly:ASM223467v1:21:6513805:6529236:1 gene:ENSORLG00000030608.1 transcript:ENSORLT00000037766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 3.049e-14
Identity = 37/125 (29.60%), Postives = 57/125 (45.60%), Query Frame = 1
Query:  571 CPSGWYKLYQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENN-LFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVC 942
            CPSGW     S  F  +   + ++AR +C    + L  +N+ EEN  LF +K          + +G TD   EG W+W+D +      W   +P+    E C+ +  + G WND  C   M  +C
Sbjct:   14 CPSGWISFGFSCYFFSEEKKSWDEAREFCRTTEADLVVINSKEENYFLFRVKPYHF----KPVWIGLTDKVQEGTWKWVDGSPLTLKFWEENQPDDYKEEDCVQIRHAAGSWNDFSCETSMRWIC 134          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000032282.1 (pep primary_assembly:ASM223467v1:11:9656740:9657995:1 gene:ENSORLG00000026380.1 transcript:ENSORLT00000032282.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 2.368e-13
Identity = 45/136 (33.09%), Postives = 65/136 (47.79%), Query Frame = 1
Query:  565 LNCPSGWYKLYQSECF-HFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG-GTTESCLMV-YLSTGKWNDIPCYVKMNAVCRGHILYV 963
            +NCP   +  +Q+ C+ +F       +A   C   G  L S+++ EE             NE A  +GYTDA+ EG W W D     + NWN GEPN     E+C +  +    +WNDI C  K   +C G +LY+
Sbjct:   35 VNCPEFSF-YFQNRCYRYFATQRTWTEAESDCVSEGLNLVSIHSPEEQRYVKFLISNFDANERATWIGYTDAQQEGVWLWSDRTIDNYQNWNRGEPNNFNGPENCAVTNWGFFRRWNDINCSEKFPFLCSG-VLYL 168          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044179.1 (pep primary_assembly:ASM223467v1:21:6141420:6169874:1 gene:ENSORLG00000027318.1 transcript:ENSORLT00000044179.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 3.047e-13
Identity = 38/135 (28.15%), Postives = 61/135 (45.19%), Query Frame = 1
Query:  544 FNDIKDYLNCPSGWYKLYQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNG-GTTESCLMV-YLSTGKWNDIPCYVKMNAVC 942
            F ++     CP  W     S  F  + +   ++AR +C  RG+ L  +N  EEN   +   KQ       + +G TD + EG W+ +D +    T W  G+P+     E C    +   G WND+PC++    +C
Sbjct:   66 FQNVDRKTRCPKKWIGFGSSCYFLSEESKTWDEAREFCRARGADLVVINTEEENEFISALKKQ------QVWIGLTDRDLEGTWKSVDGSSLNLTFWGSGQPDDYDKEEDCGETNFEFLGHWNDVPCHLSRQLIC 194          
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040391.1 (pep primary_assembly:ASM223467v1:21:5982169:5984964:1 gene:ENSORLG00000027583.1 transcript:ENSORLT00000040391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 3.411e-13
Identity = 51/184 (27.72%), Postives = 86/184 (46.74%), Query Frame = 1
Query:  415 GTQFYITESSMTQLSKISDDNNRHIDYLLNVENENFKDALGISFNDIKDY-LNCPSGWYKLYQSECFHFK-PNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEP--NGGTT----ESCLMVYLSTGKWNDIPCYVKMNAVC 942
            G  F     S+ +LS+ISD  +   + L +V  E     L  +   + D+   CPSGW + + S C+ F   + + ++AR+ C+ R + L  +N+ +E      K  Q       + +G TD   EG+W+W+D +      W   +P  +GG+     E C  +  + G WNDI C   +  +C
Sbjct:   35 GPDFISDGDSVKKLSEISDSKDNLTEQLNDV-IETMNSNLTETTKKLMDWKPRCPSGWIR-FGSSCYFFSGESKSWDEARKSCKARQADLVVINSTDE------KVDQ------PVWIGLTDKVQEGSWKWVDGSPLTLKFWGKNQPDSDGGSQRYGEEDCAEIRETPGFWNDISCETSLRWIC 204          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000028600.1 (SMESG000028600.1)

HSP 1 Score: 435.647 bits (1119), Expect = 4.763e-164
Identity = 210/211 (99.53%), Postives = 211/211 (100.00%), Query Frame = 1
Query:  340 KKKLAENSEILKNKSFISGDSCETCGTQFYITESSMTQLSKISDDNNRHIDYLLNVENENFKDALGISFNDIKDYLNCPSGWYKLYQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHILYVKNL 972
            +KKLAENSEILKNKSFISGDSCETCGTQFYITESSMTQLSKISDDNNRHIDYLLNVENENFKDALGISFNDIKDYLNCPSGWYKLYQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHILYVKNL
Sbjct:   82 QKKLAENSEILKNKSFISGDSCETCGTQFYITESSMTQLSKISDDNNRHIDYLLNVENENFKDALGISFNDIKDYLNCPSGWYKLYQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHILYVKNL 292          

HSP 2 Score: 161.77 bits (408), Expect = 4.763e-164
Identity = 74/76 (97.37%), Postives = 76/76 (100.00%), Query Frame = 3
Query:  126 LVPSVLIEAAYKQHPKCVFPFKYQGRVYDDCVVKDAGAPWCSEDAEYKGLFHYCNNNEGDTQESNGAFLSAQKKIS 353
            LVPSVLIEAAYKQHPKCVFPFKYQGRVYDDCVVKDAGAPWCSEDAEYKGLFHYCNNNEGDTQESNGAFLSAQKK++
Sbjct:   11 LVPSVLIEAAYKQHPKCVFPFKYQGRVYDDCVVKDAGAPWCSEDAEYKGLFHYCNNNEGDTQESNGAFLSAQKKLA 86          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000034284.1 (SMESG000034284.1)

HSP 1 Score: 69.3218 bits (168), Expect = 7.098e-13
Identity = 42/147 (28.57%), Postives = 67/147 (45.58%), Query Frame = 1
Query:  517 NFKDALGISFNDIKDYLNCPSGWYKLYQSECFH-FKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGK---WNDIPCYVKMNAVCR 945
            N ++  G+   D      CPSG    + + C+  ++  LN  DA + C + G  L S+ +  EN      AK +Y    A  +G  D ++EG ++W D   T +  +  GEPN    E C+ +     +   WNDI C  +   VC+
Sbjct:  248 NEREESGLPLCDAYPTSQCPSGSL-FFNNYCYKKYETPLNYQDAEKKCADNGGHLVSIQSQSEN---VFVAKTVYPGTDAFYIGLNDIQTEGQYKWTDSKATNYMKFYAGEPNNYGNEDCIQMGRYPAQREAWNDISCESRTGFVCK 390          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000056362.1 (SMESG000056362.1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.394e-12
Identity = 42/107 (39.25%), Postives = 59/107 (55.14%), Query Frame = 1
Query:  628 LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLST-GKWNDIPC-YVKMNAVC 942
            L   +A+ YC+ +G ++   NN  EN L    A+++  +     L   DA+ EG W   +EN+ K   ++ GEPNGG  E+CL  YLS  G WND PC Y  + AVC
Sbjct:  289 LTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSD--LYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVC 393          

HSP 2 Score: 65.4698 bits (158), Expect = 2.080e-11
Identity = 36/103 (34.95%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  637 NDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMV-YLSTGKWNDIPCYVKMNAVC 942
            N+A ++C  RG+QL  + N+ +N L    AK++  N     +   D   EG W   + N  ++ NW   EPNG   E+C+   YL  G W DI C  K  A+C
Sbjct:  423 NEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVAN--LYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYLAIC 523          

HSP 3 Score: 56.9954 bits (136), Expect = 1.120e-8
Identity = 36/113 (31.86%), Postives = 61/113 (53.98%), Query Frame = 1
Query:  610 FHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVY-LSTGKWNDIPCYVKMNAVCR 945
            F  K  +  N+A + C+ RG +L  VN+ E+N +    A ++  +  +  +   D  +EG +     N   + N+   EPNGG +E+C+ VY L +G WNDI C  ++ A+C+
Sbjct:   30 FVTKTLVTYNEALQTCKSRGMRLVRVNSAEDNAVVNGFANKVLAD--SYWIDGNDETAEGIFVNSKGNLLTYKNFGTNEPNGGRSENCINVYRLPSGLWNDIQCGSRIWAICQ 140          

HSP 4 Score: 52.7582 bits (125), Expect = 2.365e-7
Identity = 30/109 (27.52%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  619 KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGK-WNDIPCYVKMNAVC 942
            K  +   DA+ YC  R  ++  + +  +N +    A++   N     +   D  +EG W   D  +  + N+  GEP GG  E+C   YL+    WND+PC+  +  +C
Sbjct:  161 KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARE--TNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC 267          

HSP 5 Score: 51.9878 bits (123), Expect = 5.228e-7
Identity = 36/122 (29.51%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  598 QSECFHF-KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFT--NWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHI 954
            Q+  FHF +  +  + A  YC+  G +L  V + E N L  +    +        +   D + EG  +W+D N+T  T  N+N GEP+GG  ++C+    ++G W D  C      VC G +
Sbjct:  532 QAIDFHFTRSKMTFDSATSYCKSIGLRLIRVADAESNRLINLAT--IRHKLDTYWIDGNDNDEEG--KWVDSNKTVLTYQNFNAGEPSGGRVKNCIQG-TNSGFWFDAQCSSSNAVVCYGAL 648          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000056362.1 (SMESG000056362.1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.402e-12
Identity = 42/107 (39.25%), Postives = 59/107 (55.14%), Query Frame = 1
Query:  628 LNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLST-GKWNDIPC-YVKMNAVC 942
            L   +A+ YC+ +G ++   NN  EN L    A+++  +     L   DA+ EG W   +EN+ K   ++ GEPNGG  E+CL  YLS  G WND PC Y  + AVC
Sbjct:  232 LTFQEAQDYCKAQGLKMVRANNAAENALVHGFARRITSD--LYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCSYKNLFAVC 336          

HSP 2 Score: 65.4698 bits (158), Expect = 2.329e-11
Identity = 36/103 (34.95%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  637 NDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMV-YLSTGKWNDIPCYVKMNAVC 942
            N+A ++C  RG+QL  + N+ +N L    AK++  N     +   D   EG W   + N  ++ NW   EPNG   E+C+   YL  G W DI C  K  A+C
Sbjct:  366 NEALQFCRTRGTQLVRIKNVADNGLVAAFAKKVVAN--LYWIDGNDHTEEGKWVDSNANLMQYKNWAATEPNGNRGENCIFSNYLEEGTWRDIACTNKYLAIC 466          

HSP 3 Score: 52.7582 bits (125), Expect = 2.601e-7
Identity = 30/109 (27.52%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  619 KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGK-WNDIPCYVKMNAVC 942
            K  +   DA+ YC  R  ++  + +  +N +    A++   N     +   D  +EG W   D  +  + N+  GEP GG  E+C   YL+    WND+PC+  +  +C
Sbjct:  104 KGKMTFADAQEYCSARSLKMIRIGHALDNAIVHSFARE--TNSDLYWVDGNDIVTEGKWVDSDGKDLIYKNFPVGEPGGGRVENCAHGYLNYDSLWNDLPCHFNLWVIC 210          

HSP 4 Score: 51.6026 bits (122), Expect = 6.397e-7
Identity = 36/125 (28.80%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  598 QSECFHF-KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFT--NWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHILYV 963
            Q+  FHF +  +  + A  YC+  G +L  V + E N L  +    +        +   D + EG  +W+D N+T  T  N+N GEP+GG  ++C+    ++G W D  C      VC G +  +
Sbjct:  475 QAIDFHFTRSKMTFDSATSYCKSIGLRLIRVADAESNRLINLAT--IRHKLDTYWIDGNDNDEEG--KWVDSNKTVLTYQNFNAGEPSGGRVKNCIQG-TNSGFWFDAQCSSSNAVVCYGALRKI 594          
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Match: SMESG000056365.1 (SMESG000056365.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.198e-10
Identity = 36/103 (34.95%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  637 NDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLM-VYLSTGKWNDIPCYVKMNAVC 942
            N+A ++C  RG+QLA VN+  +N +    AK++  +     +   D   EG W   + N   + NW   EPNG   E+C+   YL  G W DI C  K  A+C
Sbjct:  119 NEALQFCRTRGTQLARVNSQVDNAMLAAFAKKVVADY--YWIDGNDHTEEGKWVDSNANVLPYKNWAATEPNGNRGENCIFSYYLEEGTWRDIACTNKYLAIC 219          

HSP 2 Score: 58.5362 bits (140), Expect = 2.183e-9
Identity = 38/100 (38.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  676 LASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLST-GKWNDIPC-YVKMNAVCRGHILYVKN 969
            +   NN  EN L    A+++  +     L   DA+ EG W   +EN+ K   ++ GEPNGG  E+CL  YLS  G WND PC Y  + A+C    L +K+
Sbjct:    1 MVRANNAAENALIHGFARRITSD--LYWLDGNDAKLEGKWVDSEENDLKHKGFHPGEPNGGVNENCLNGYLSLDGLWNDFPCPYKNLFAICAKDSLKIKD 98          

HSP 3 Score: 49.2914 bits (116), Expect = 2.271e-6
Identity = 37/119 (31.09%), Postives = 53/119 (44.54%), Query Frame = 1
Query:  610 FHF-KPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYENEGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLSTGKWNDIPCYVKMNAVCRGHILYV 963
            +HF K  +    A  YC+  G ++  V NL  N L    AK L  +  +  L   D   EG W   + +   + N+    PNGG  ++CL  + +TG W D  C    + VC G I  V
Sbjct:  232 YHFTKVKMTFEAAALYCKSVGLKVVRVRNLNSNRLLADSAKYLKLD--SYWLDGNDNAEEGKWVDTNNSTLLYKNFAAEAPNGGRDKNCLQSF-ATGLWVDSKCDDFNSVVCYGSIKRV 347          
The following BLAST results are available for this feature:
BLAST of C-type lectin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACAN4.842e-1432.56aggrecan [Source:HGNC Symbol;Acc:HGNC:319][more]
ACAN4.940e-1432.56aggrecan [Source:HGNC Symbol;Acc:HGNC:319][more]
ACAN4.949e-1432.56aggrecan [Source:HGNC Symbol;Acc:HGNC:319][more]
ACAN4.953e-1432.56aggrecan [Source:HGNC Symbol;Acc:HGNC:319][more]
ACAN4.961e-1432.56aggrecan [Source:HGNC Symbol;Acc:HGNC:319][more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clec-523.385e-929.79C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q17452... [more]
clec-532.440e-830.30C-type LECtin [Source:UniProtKB/TrEMBL;Acc:P91429... [more]
clec-492.665e-830.51C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9XUL6... [more]
Y38H6C.85.737e-825.83pep chromosome:WBcel235:V:20514637:20515706:1 gene... [more]
clec-501.072e-729.23C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9XUL7... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tfc3.613e-1034.86gene:FBgn0035199 transcript:FBtr0072661[more]
tfc3.613e-1034.86gene:FBgn0035199 transcript:FBtr0072660[more]
tfc1.392e-934.86gene:FBgn0035199 transcript:FBtr0072659[more]
lectin-24Db2.396e-630.10gene:FBgn0040102 transcript:FBtr0077469[more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-75b4.103.420e-1331.25si:dkeyp-75b4.10 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
si:dkeyp-75b4.103.420e-1331.25si:dkeyp-75b4.10 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
si:dkey-241l7.44.565e-1333.59si:dkey-241l7.4 [Source:ZFIN;Acc:ZDB-GENE-041014-2... [more]
si:dkey-241l7.44.565e-1333.59si:dkey-241l7.4 [Source:ZFIN;Acc:ZDB-GENE-041014-2... [more]
si:dkey-241l7.44.565e-1333.59si:dkey-241l7.4 [Source:ZFIN;Acc:ZDB-GENE-041014-2... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vrk22.515e-1431.25VRK serine/threonine kinase 2 [Source:Xenbase;Acc:... [more]
ENSXETT00000044886.13.864e-1328.28regenerating family member 1 beta [Source:NCBI gen... [more]
ENSXETT00000001317.19.345e-1333.33pep primary_assembly:Xenopus_tropicalis_v9.1:3:125... [more]
ENSXETT00000044866.11.639e-1127.33regenerating family member 1 beta [Source:NCBI gen... [more]
ENSXETT00000044902.12.059e-1127.70regenerating family member 1 beta [Source:NCBI gen... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acan1.391e-1431.21aggrecan [Source:MGI Symbol;Acc:MGI:99602][more]
Ncan7.405e-1430.60neurocan [Source:MGI Symbol;Acc:MGI:104694][more]
Mbl21.467e-1336.79mannose-binding lectin (protein C) 2 [Source:MGI S... [more]
Clec4d2.666e-1328.57C-type lectin domain family 4, member d [Source:MG... [more]
Cd209g7.373e-1333.60CD209g antigen [Source:MGI Symbol;Acc:MGI:1917442][more]
back to top
BLAST of C-type lectin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P86854|PLCL_MYTGA1.900e-1531.40Perlucin-like protein OS=Mytilus galloprovincialis... [more]
sp|Q61282|PGCA_MOUSE9.729e-1431.21Aggrecan core protein OS=Mus musculus OX=10090 GN=... [more]
sp|Q01758|ISP2_OSMMO1.077e-1333.08Type-2 ice-structuring protein OS=Osmerus mordax O... [more]
sp|P07897|PGCA_RAT1.797e-1332.33Aggrecan core protein OS=Rattus norvegicus OX=1011... [more]
sp|P16112|PGCA_HUMAN2.382e-1332.56Aggrecan core protein OS=Homo sapiens OX=9606 GN=A... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I3KXG22.680e-1532.82C-type lectin domain-containing protein OS=Oreochr... [more]
A0A3P8NPD73.661e-1530.99C-type lectin domain-containing protein OS=Astatot... [more]
V9L2094.938e-1530.10C-type lectin domain family 4 member E-like protei... [more]
A0A3P8QSB45.767e-1533.08C-type lectin domain-containing protein OS=Astatot... [more]
A0A060YWB06.749e-1536.43C-type lectin domain-containing protein OS=Oncorhy... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030897.13.434e-1430.53pep primary_assembly:Astyanax_mexicanus-2.0:16:189... [more]
ENSAMXT00000017124.28.528e-1432.03pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000046950.18.602e-1429.92lactose-binding lectin l-2-like [Source:NCBI gene;... [more]
acana1.443e-1329.32aggrecan core protein-like [Source:NCBI gene;Acc:1... [more]
acana1.690e-1329.32aggrecan core protein-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001836.12.864e-1431.58pep scaffold:Pmarinus_7.0:GL478684:172:28670:1 gen... [more]
ENSPMAT00000003237.16.897e-1027.08pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 ge... [more]
ENSPMAT00000004493.12.231e-930.88pep scaffold:Pmarinus_7.0:GL476717:442705:443808:1... [more]
mrc23.042e-929.06mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000004490.15.293e-827.74pep scaffold:Pmarinus_7.0:GL476717:438077:441513:1... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495122.674e-1330.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384329.211e-1327.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495091.141e-1231.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386141.452e-1228.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278963.159e-1128.80pep supercontig:ASM20922v1:NEMVEscaffold_3035:5431... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033058.12.228e-1530.43pep primary_assembly:ASM223467v1:21:6426657:643802... [more]
ENSORLT00000037766.13.049e-1429.60pep primary_assembly:ASM223467v1:21:6513805:652923... [more]
ENSORLT00000032282.12.368e-1333.09pep primary_assembly:ASM223467v1:11:9656740:965799... [more]
ENSORLT00000044179.13.047e-1328.15pep primary_assembly:ASM223467v1:21:6141420:616987... [more]
ENSORLT00000040391.13.411e-1327.72pep primary_assembly:ASM223467v1:21:5982169:598496... [more]
back to top
BLAST of C-type lectin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028600.14.763e-16499.53SMESG000028600.1[more]
SMESG000034284.17.098e-1328.57SMESG000034284.1[more]
SMESG000056362.12.394e-1239.25SMESG000056362.1[more]
SMESG000056362.12.402e-1239.25SMESG000056362.1[more]
SMESG000056365.11.198e-1034.95SMESG000056365.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024104 ID=SMED30024104|Name=C-type lectin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1080bp
GTACACTGTACACAATTTAGAGATTTAATATACCATATGATATAGAGACT
CGACTCATATAAATATACGTCAAACTATAAAAAATAATTATTAAAATGAG
TTACTTGATCATTATCACTTTGATATTAGTCCCAAGTGTTCTTATTGAAG
CGGCATATAAACAGCATCCAAAATGCGTATTTCCATTTAAATATCAAGGA
AGAGTTTATGATGATTGCGTCGTGAAAGATGCCGGCGCACCTTGGTGCTC
AGAGGATGCAGAATACAAAGGATTATTTCACTATTGTAACAACAATGAAG
GTGATACACAGGAATCAAATGGAGCATTTTTAAGTGCTCAAAAAAAAATT
AGCTGAAAACAGTGAAATTTTGAAAAACAAATCTTTTATTTCTGGAGATA
GCTGCGAGACGTGTGGTACACAATTTTATATAACTGAAAGCTCCATGACG
CAATTATCAAAAATAAGTGACGACAACAATCGTCACATAGACTATCTGTT
GAATGTTGAGAACGAAAACTTCAAGGATGCGTTAGGGATTAGTTTCAATG
ATATCAAAGACTATCTGAACTGTCCAAGTGGTTGGTACAAACTTTATCAG
AGTGAATGCTTTCATTTTAAGCCAAATCTTAATCTTAACGACGCTAGACG
ATATTGCGAGGAAAGAGGATCTCAATTAGCATCAGTTAATAATCTCGAAG
AAAACAACCTTTTCACAATGAAAGCTAAACAGCTTTACGAAAACGAAGGT
GCAATTATGCTTGGATACACCGATGCTGAGAGTGAAGGAAACTGGCAATG
GTTGGATGAAAATGAAACGAAATTCACGAATTGGAATGGAGGTGAACCGA
ATGGTGGAACCACTGAAAGTTGTCTTATGGTTTATTTAAGTACAGGAAAA
TGGAATGATATTCCATGTTATGTCAAAATGAATGCCGTATGTCGGGGACA
CATTCTCTACGTTAAAAACTTATAAAATAAAAAATAATTTGTATATAAGC
AATCGTATTCGTTTTGGAAACAATTTTTGTTGTGTATCGTGATTCAAATT
CAAGAGGTTTAAACATGTCAACATTTTATT
back to top

protein sequence of SMED30024104-orf-1

>SMED30024104-orf-1 ID=SMED30024104-orf-1|Name=SMED30024104-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MTQLSKISDDNNRHIDYLLNVENENFKDALGISFNDIKDYLNCPSGWYKL
YQSECFHFKPNLNLNDARRYCEERGSQLASVNNLEENNLFTMKAKQLYEN
EGAIMLGYTDAESEGNWQWLDENETKFTNWNGGEPNGGTTESCLMVYLST
GKWNDIPCYVKMNAVCRGHILYVKNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036943FN_type2_sf
IPR001304C-type_lectin-like
IPR016186C-type_lectin-like/link_sf
IPR018378C-type_lectin_CS
IPR016187CTDL_fold
IPR000562FN_type2_dom
IPR013806Kringle-like
Vocabulary: molecular function
TermDefinition
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000562Fibronectin type II domainSMARTSM00059FN2_2coord: 20..64
e-value: 6.1E-7
score: 38.5
IPR000562Fibronectin type II domainPFAMPF00040fn2coord: 27..64
e-value: 6.3E-12
score: 45.6
IPR000562Fibronectin type II domainPROSITEPS51092FN2_2coord: 22..66
score: 13.364
IPR036943Fibronectin type II domain superfamilyGENE3DG3DSA:2.10.10.10coord: 26..64
e-value: 9.9E-13
score: 49.7
NoneNo IPR availablePANTHERPTHR22918:SF11coord: 18..68
NoneNo IPR availablePANTHERPTHR22918SEMINAL PLASMA PROTEINcoord: 18..68
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.801
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 26..67