Elongator complex protein 1

Overview
NameElongator complex protein 1
Smed IDSMED30024101
Length (bp)3928
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Elongator complex protein 1 (SMED30024101) t-SNE clustered cells

Violin plots show distribution of expression levels for Elongator complex protein 1 (SMED30024101) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Elongator complex protein 1 (SMED30024101) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Elongator complex protein 1 (SMED30024101) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024101

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024101h1SMcG0012007 SmedASXL_017690SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30024101h1SMcG0012007 dd_Smed_v4_10377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Elongator complex protein 1 vs. Ensembl Human
Match: ELP1 (elongator complex protein 1 [Source:HGNC Symbol;Acc:HGNC:5959])

HSP 1 Score: 374.4 bits (960), Expect = 2.119e-108
Identity = 296/1062 (27.87%), Postives = 518/1062 (48.78%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKV-VSCISFNSNDDICTVVILDLDNQ-----LTHVKLFTTNNYQWYSKKTISYEKLEK---ISLFW---SSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQL------DHQINSI-----CWLENNSFYCVVNNAL----FLYKLDQSNIVIRKLEIGDIQVGK----------ICYNSH---VYIQDISGQVYQYDNES----VKPLHKYSTFC------CEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIK-QKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI----WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVR 3343
            SPDQ ++++ T      +++ + + +    + Q  FG ++ ++VGWG+KETQFHG  G++A   ++        D   P + W+ DG +F +S +         E   R +R+++++  L STSEP   L   L W+   +LIA++       +IVFFE+NGL HG F L    F  ++V V+ + +N++  +  V + DL  +      T V+L+T  NY WY K+++S+    K   +SL W   +  RLH+  +   +  Y  +   DRS+ +N      +  L N V+VIDG++VL+T F   V+PPP C + + F H V+ V+       S D     ++  S+ I   +Y   +  S      +      G   CL TP  +   ++      D  +N +      W+E + F  V ++       ++ L  ++  + + E G + V            +C NS    V +Q   GQ+++Y  ES    +KP      F       C    + +  E  + +L L+ R  +F+IN +  +    S       L+ T+ +   +C  L + +   L   L       +    E +R +E G+ I+T V   +K+VL MPRGNLE ++ RALVL  ++  ++  ++ EA E MR+ R+NLNL+YDHNP  F+ N+   +K+ +  + + LF +EL  EDVT+TMY     +S+   +    +K++ VC A+  + E+     Y   ILT +VK T    +  LQ + + + N          ++ +KYL +L+ ++ELY  +L TYD +L L VA+K+Q DPKEY+ F+N L ++   NY+RF I+ +LKR  KA+  +++    ++ E + LI   +LY +A++L++  +  Y  IS  + EHL+   +  + A +++ R    E    A        +WK+ +  + +   ++++       L  +L +  +  +A  + E   +D   A  + L+G  + +A R++   +  D    N+   I    K Y  FL   +     +S+  +RL+ VR
Sbjct:  118 SPDQELVLLATGQQTLIMMTKDFEPILEQQIHQDDFGESKFITVGWGRKETQFHGSEGRQAAFQMQMHESALPWDDHRPQVTWRGDGQFFAVSVVC-------PETGARKVRVWNREFALQSTSEPVAGLGPALAWKPSGSLIASTQDKPNQQDIVFFEKNGLLHGHFTL---PFLKDEVKVNDLLWNADSSVLAVWLEDLQREESSIPKTCVQLWTVGNYHWYLKQSLSFSTCGKSKIVSLMWDPVTPYRLHVLCQGWHYLAYDWHWTTDRSVGDN------SSDLSN-VAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSND---LAVLDASNQIS--VYKCGDCPSADPTVKLGAVGGSGFKVCLRTPHLEKRYKIQFENNEDQDVNPLKLGLLTWIEEDVFLAVSHSEFSPRSVIHHLTAASSEMDE-EHGQLNVSSSAAVDGVIISLCCNSKTKSVVLQLADGQIFKYLWESPSLAIKPWKNSGGFPVRFPYPCTQTELAMIGE-EECVLGLTDRC-RFFINDIEVASNITSFAVYDEFLLLTTHSHTCQCFCLRDASFKTLQAGLSSN----HVSHGEVLRKVERGSRIVTVVPQDTKLVLQMPRGNLEVVHHRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIYDHNPKVFLGNVETFIKQIDSVNHINLFFTELKEEDVTKTMYPAPVTSSVYLSRDPDGNKIDLVCDAMRAVMESINPHKYCLSILTSHVKKTTPELEIVLQKVHELQGNAPSDPDAVSAEEALKYLLHLVDVNELYDHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNTLKKMET-NYQRFTIDKYLKRYEKAIGHLSKCGPEYFPECLNLIKDKNLYNEALKLYSPSSQQYQDISIAYGEHLM-QEHMYEPAGLMFARCGAHE---KALSAFLTCGNWKQALCVAAQLNFTKDQLVGLGRTLAGKLVEQRKHIDAAMVLEECAQDYEEAVLLLLEGAAWEEALRLVYKYNRLDIIETNVKPSILEAQKNYMAFL---DSQTATFSRHKKRLLVVR 1142          
BLAST of Elongator complex protein 1 vs. Ensembl Human
Match: ELP1 (elongator complex protein 1 [Source:HGNC Symbol;Acc:HGNC:5959])

HSP 1 Score: 251.521 bits (641), Expect = 3.249e-68
Identity = 220/812 (27.09%), Postives = 387/812 (47.66%), Query Frame = 2
Query: 1043 RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQL------DHQINSI-----CWLENNSFYCVVNNAL----FLYKLDQSNIVIRKLEIGDIQVGK----------ICYNSH---VYIQDISGQVYQYDNES----VKPLHKYSTFC------CEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIK-QKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI----WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVR 3343
            RLH+  +   +  Y  +   DRS+ +N      +  L N V+VIDG++VL+T F   V+PPP C + + F H V+ V+       S D     ++  S+ I   +Y   +  S      +      G   CL TP  +   ++      D  +N +      W+E + F  V ++       ++ L  ++  + + E G + V            +C NS    V +Q   GQ+++Y  ES    +KP      F       C    + +  E  + +L L+ R  +F+IN +  +    S       L+ T+ +   +C  L + +   L   L       +    E +R +E G+ I+T V   +K+VL MPRGNLE ++ RALVL  ++  ++  ++ EA E MR+ R+NLNL+YDHNP  F+ N+   +K+ +  + + LF +EL  EDVT+TMY     +S+   +    +K++ VC A+  + E+     Y   ILT +VK T    +  LQ + + + N          ++ +KYL +L+ ++ELY  +L TYD +L L VA+K+Q DPKEY+ F+N L ++   NY+RF I+ +LKR  KA+  +++    ++ E + LI   +LY +A++L++  +  Y  IS  + EHL+   +  + A +++ R    E    A        +WK+ +  + +   ++++       L  +L +  +  +A  + E   +D   A  + L+G  + +A R++   +  D    N+   I    K Y  FL   +     +S+  +RL+ VR
Sbjct:    9 RLHVLCQGWHYLAYDWHWTTDRSVGDN------SSDLSN-VAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSND---LAVLDASNQIS--VYKCGDCPSADPTVKLGAVGGSGFKVCLRTPHLEKRYKIQFENNEDQDVNPLKLGLLTWIEEDVFLAVSHSEFSPRSVIHHLTAASSEMDE-EHGQLNVSSSAAVDGVIISLCCNSKTKSVVLQLADGQIFKYLWESPSLAIKPWKNSGGFPVRFPYPCTQTELAMIGE-EECVLGLTDRC-RFFINDIEVASNITSFAVYDEFLLLTTHSHTCQCFCLRDASFKTLQAGLSSN----HVSHGEVLRKVERGSRIVTVVPQDTKLVLQMPRGNLEVVHHRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIYDHNPKVFLGNVETFIKQIDSVNHINLFFTELKEEDVTKTMYPAPVTSSVYLSRDPDGNKIDLVCDAMRAVMESINPHKYCLSILTSHVKKTTPELEIVLQKVHELQGNAPSDPDAVSAEEALKYLLHLVDVNELYDHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNTLKKMET-NYQRFTIDKYLKRYEKAIGHLSKCGPEYFPECLNLIKDKNLYNEALKLYSPSSQQYQDISIAYGEHLM-QEHMYEPAGLMFARCGAHE---KALSAFLTCGNWKQALCVAAQLNFTKDQLVGLGRTLAGKLVEQRKHIDAAMVLEECAQDYEEAVLLLLEGAAWEEALRLVYKYNRLDIIETNVKPSILEAQKNYMAFL---DSQTATFSRHKKRLLVVR 793          
BLAST of Elongator complex protein 1 vs. Ensembl Celegans
Match: elpc-1 (Elongator complex protein 1 [Source:UniProtKB/TrEMBL;Acc:Q9N595])

HSP 1 Score: 103.219 bits (256), Expect = 9.111e-22
Identity = 85/353 (24.08%), Postives = 158/353 (44.76%), Query Frame = 2
Query: 1970 ETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFENDFND----DYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDK-------GIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLF--------------WEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKE 2953
            E +R +E G E++ C    + ++L   RGNLETI PR  V+   ++L++   Y  + + M++ RV+++    +  D    ++   +K +N +  L   +  +S  +V E                  D  + +C  +A  +  D +D        L+LT  ++  P+  +  L+ +++      +KI D+        + ++ + +   EL+  ALSTYDL L  +VA+ +  DPKEY+  +N LN + C   R+++IN+  +       +I  V+ LF              W +  ++I    LY  A+ L   G   Y     L+A  L    +  + AA+ Y  + + E
Sbjct:  636 EDVRNVEAGCELVACDSQSANVILQAARGNLETIQPRRYVMAHTRDLLDRKEYIASFKWMKKHRVDMSFAMKYKGDDLEDDIPIWLKTSNDSQFLEQLL--ISCTEVFE------------------DAGSSLCMTVAR-YVRDLSDAEKTKMFPLLLTALLRSKPSKVNDCLKEVQEHV----EKIADRKDVFTRNSLHHISFFVPAKELFNCALSTYDLKLAQQVAEASNYDPKEYLPVLNKLNRVMCTLERQYRINVVRE------AWIDAVSSLFLLDSSKERGSEETWWNDIEDIIQREKLYQDALTLVKPGDRRYKQCCELYAAELERKVH-WREAALFYELSGNSE 956          

HSP 2 Score: 64.3142 bits (155), Expect = 6.899e-10
Identity = 67/287 (23.34%), Postives = 126/287 (43.90%), Query Frame = 2
Query:  449 PLSVGWGKKETQFHGKVGK-EARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNV-LENGLFWRTKSNLIATSCRSNKGLE-IVFFEQNGLRHGGFMLY--ENGFCDNKVVSCISFNSNDDICTVVILDLDNQLT---HVKLFTTNNYQWYSKKTISYEKL-EKISLFWSS---DRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVS---VIDGDKVLMTPFEFCVIPPPYCAFTINFQHDV 1264
            P++VGWG + TQF G  GK +    +E   +  +  S+   + W+ DG+   +S+ S       S+  TR + +F ++GE+ +     N+ L +    +  +NL+ ++ + N   + IV +E+NG     +++    N   D +++  I +NS     T  IL +   L     ++ +  +NY++  K    Y K  E I   WS+     + +  ESG      +                 T    +++S   V+  D++ M      V+PPP C ++I    D+
Sbjct:  151 PVNVGWGSESTQFRGSAGKLKPGEKIEKEKEQIEQHSRKTSVHWRWDGEIVAVSFYS-------SQNDTRNLTVFDRNGEILNNMNIRNIYLSHCFAHKPNANLLCSAIQENGSDDRIVIYERNGETRNSYVVKWPANQIEDRRIIEKIEWNS-----TGTILSMQTSLGKKHQLEFWHLSNYEFTRK---CYWKFSESIIWKWSTVECQNIEVLLESGQFFSVHITP---------------TASFSDVISQNVVVATDELRMYSLCRRVVPPPMCDYSIQCLSDI 407          
BLAST of Elongator complex protein 1 vs. Ensembl Fly
Match: Elp1 (gene:FBgn0037926 transcript:FBtr0335448)

HSP 1 Score: 209.149 bits (531), Expect = 2.126e-54
Identity = 147/461 (31.89%), Postives = 252/461 (54.66%), Query Frame = 2
Query: 1979 RLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFE---NDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDL-ERLIEVRLN 3349
            R IE G +I+T V   +++VL +PRGNLE I PR LVL+ + +L+E   Y +AIE  R+QR+NLN+++DH+  RF+ ++   + + N    L LF+SEL  ED T+ MY   Y+ S KQ   S  +V++    +  + E   N F   +   ++T YVK+     + ALQ++ K +      + D+ +++L YL+ +++LY VAL TYD  L L VAQK+Q DPKE++ ++NDL  LP  +YR+F+I+  LKR + AL  +A   +  +EE +E I  + LY   +  +         I   +A+HL A    L  A+++Y R    +   ++A +   TL W+  ++ +KK     ++  ++L+     L+  GR  EA  + + + +D    F+V L+G L++ A     + +    D++ + I   +  Y   L    + +++   D  +RL+++R N
Sbjct:  628 RNIERGAKIVTAVARKARVVLQLPRGNLEAICPRVLVLELVGDLLERGKYQKAIEMSRKQRINLNIIFDHDVKRFVSSVGAFLNDINEPQWLCLFLSELQNEDFTKGMYSSNYDAS-KQTYPSDYRVDQKVEYVCRLLEQQMNRFVSRFRLPLITAYVKL--GCLEMALQVIWK-EQQEDASLADQLLQHLLYLVDVNDLYNVALGTYDFGLVLFVAQKSQKDPKEFLPYLNDLKALPI-DYRKFRIDDHLKRYTSALSHLAACGEQHYEEALEYIRKHGLYTDGLAFYREHIEFQKNIYVAYADHLRA-IAKLDNASLMYERGGQLQQALLSAKH---TLDWQRVLVLAKKLSEPLDQVAQSLVGP---LQQQGRHMEAYELVKEHCQDRKRQFDVLLEGHLYSRAI----YEAGLEDDDVSEKIAPALLAYGVQLESSLQADLQLFLDYKQRLLDIRRN 1072          

HSP 2 Score: 142.124 bits (357), Expect = 1.102e-33
Identity = 97/381 (25.46%), Postives = 180/381 (47.24%), Query Frame = 2
Query:  164 DIKDVISYDFNEYLKIQNGLSLYCANKSSLISFDNYNGMQLXXXXXXXXXXXXTLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVE----------HVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQ-TRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTHVKLFTTNNYQWYSKKTISYEKLEKISLF-W-----SSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQ 1255
            D+ D++  +F   L++ N + +  +    +I  D   G   +       I     SP+Q ++  +T      ++++   ++    L+       + ++VGWGKKETQFHG  GK+A    E           +N+++  D     I+W+ DG++FV+S+++         AQ  R  +++  +G+L  T+E +  L++ + WR   N IA   +      I  FE+NGLRH   +L  +     + V  + ++ + DI  +     + Q   V L+T  NY WY K+ + +E+ + ++L  W     +   LH+  ESG H +Y+    +DR+               ++V VIDG ++L+T F+  ++PPP     + F+
Sbjct:   59 DLPDIVGVEF---LQLDNAICV-ASGAGEVILVDPQTGATSEGTFCDVGIESMAWSPNQEVVAFVTRTHNVVLMTSTFDVIAEQPLDAELDPDQQFVNVGWGKKETQFHGSEGKQAAKQKESDSTFIRDEQELNQFTPQDVS---ISWRGDGEFFVVSYVA---------AQLGRTFKVYDSEGKLNHTAEKSANLKDSVVWRPTGNWIAVPQQFPNKSTIALFEKNGLRHRELVLPFD--LQEEPVVQLRWSEDSDILAIRTCAKEEQ--RVYLYTIGNYHWYLKQVLIFEQADPLALLHWDTRCGAEHTLHVLKESGKHLVYRWAFAVDRN--------------NSIVGVIDGKRLLLTDFDEAIVPPPMSKIVLKFE 405          
BLAST of Elongator complex protein 1 vs. Ensembl Fly
Match: Elp1 (gene:FBgn0037926 transcript:FBtr0082420)

HSP 1 Score: 209.149 bits (531), Expect = 2.379e-54
Identity = 147/461 (31.89%), Postives = 252/461 (54.66%), Query Frame = 2
Query: 1979 RLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFE---NDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDL-ERLIEVRLN 3349
            R IE G +I+T V   +++VL +PRGNLE I PR LVL+ + +L+E   Y +AIE  R+QR+NLN+++DH+  RF+ ++   + + N    L LF+SEL  ED T+ MY   Y+ S KQ   S  +V++    +  + E   N F   +   ++T YVK+     + ALQ++ K +      + D+ +++L YL+ +++LY VAL TYD  L L VAQK+Q DPKE++ ++NDL  LP  +YR+F+I+  LKR + AL  +A   +  +EE +E I  + LY   +  +         I   +A+HL A    L  A+++Y R    +   ++A +   TL W+  ++ +KK     ++  ++L+     L+  GR  EA  + + + +D    F+V L+G L++ A     + +    D++ + I   +  Y   L    + +++   D  +RL+++R N
Sbjct:  624 RNIERGAKIVTAVARKARVVLQLPRGNLEAICPRVLVLELVGDLLERGKYQKAIEMSRKQRINLNIIFDHDVKRFVSSVGAFLNDINEPQWLCLFLSELQNEDFTKGMYSSNYDAS-KQTYPSDYRVDQKVEYVCRLLEQQMNRFVSRFRLPLITAYVKL--GCLEMALQVIWK-EQQEDASLADQLLQHLLYLVDVNDLYNVALGTYDFGLVLFVAQKSQKDPKEFLPYLNDLKALPI-DYRKFRIDDHLKRYTSALSHLAACGEQHYEEALEYIRKHGLYTDGLAFYREHIEFQKNIYVAYADHLRA-IAKLDNASLMYERGGQLQQALLSAKH---TLDWQRVLVLAKKLSEPLDQVAQSLVGP---LQQQGRHMEAYELVKEHCQDRKRQFDVLLEGHLYSRAI----YEAGLEDDDVSEKIAPALLAYGVQLESSLQADLQLFLDYKQRLLDIRRN 1068          

HSP 2 Score: 141.739 bits (356), Expect = 1.505e-33
Identity = 96/374 (25.67%), Postives = 179/374 (47.86%), Query Frame = 2
Query:  164 DIKDVISYDFNEYLKIQNGLSLYCANKSSLISFDNYNGMQLXXXXXXXXXXXXTLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKL---PIIAWKEDGDYFVISWISYSKIRNESEAQ-TRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTHVKLFTTNNYQWYSKKTISYEKLEKISLF-W-----SSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQ 1255
            D+ D++  +F   L++ N + +  +    +I  D   G   +       I     SP+Q ++  +T      ++++   ++    L+       + ++VGWGKKETQFHG  GK+A    E  + +   + +L     I+W+ DG++FV+S+++         AQ  R  +++  +G+L  T+E +  L++ + WR   N IA   +      I  FE+NGLRH   +L  +     + V  + ++ + DI  +     + Q   V L+T  NY WY K+ + +E+ + ++L  W     +   LH+  ESG H +Y+    +DR+               ++V VIDG ++L+T F+  ++PPP     + F+
Sbjct:   59 DLPDIVGVEF---LQLDNAICV-ASGAGEVILVDPQTGATSEGTFCDVGIESMAWSPNQEVVAFVTRTHNVVLMTSTFDVIAEQPLDAELDPDQQFVNVGWGKKETQFHGSEGKQAAKQKESDSTFIRDEQELNQDVSISWRGDGEFFVVSYVA---------AQLGRTFKVYDSEGKLNHTAEKSANLKDSVVWRPTGNWIAVPQQFPNKSTIALFEKNGLRHRELVLPFD--LQEEPVVQLRWSEDSDILAIRTCAKEEQ--RVYLYTIGNYHWYLKQVLIFEQADPLALLHWDTRCGAEHTLHVLKESGKHLVYRWAFAVDRN--------------NSIVGVIDGKRLLLTDFDEAIVPPPMSKIVLKFE 401          
BLAST of Elongator complex protein 1 vs. Ensembl Fly
Match: Elp1 (gene:FBgn0037926 transcript:FBtr0335447)

HSP 1 Score: 207.994 bits (528), Expect = 5.518e-54
Identity = 138/407 (33.91%), Postives = 229/407 (56.27%), Query Frame = 2
Query: 1979 RLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFE---NDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDA 3190
            R IE G +I+T V   +++VL +PRGNLE I PR LVL+ + +L+E   Y +AIE  R+QR+NLN+++DH+  RF+ ++   + + N    L LF+SEL  ED T+ MY   Y+ S KQ   S  +V++    +  + E   N F   +   ++T YVK+     + ALQ++ K +      + D+ +++L YL+ +++LY VAL TYD  L L VAQK+Q DPKE++ ++NDL  LP  +YR+F+I+  LKR + AL  +A   +  +EE +E I  + LY   +  +         I   +A+HL A    L  A+++Y R    +   ++A +   TL W+  ++ +KK     ++  ++L+     L+  GR  EA  + + + +D    F+V L+G L++ A
Sbjct:  624 RNIERGAKIVTAVARKARVVLQLPRGNLEAICPRVLVLELVGDLLERGKYQKAIEMSRKQRINLNIIFDHDVKRFVSSVGAFLNDINEPQWLCLFLSELQNEDFTKGMYSSNYDAS-KQTYPSDYRVDQKVEYVCRLLEQQMNRFVSRFRLPLITAYVKL--GCLEMALQVIWK-EQQEDASLADQLLQHLLYLVDVNDLYNVALGTYDFGLVLFVAQKSQKDPKEFLPYLNDLKALPI-DYRKFRIDDHLKRYTSALSHLAACGEQHYEEALEYIRKHGLYTDGLAFYREHIEFQKNIYVAYADHLRA-IAKLDNASLMYERGGQLQQALLSAKH---TLDWQRVLVLAKKLSEPLDQVAQSLVGP---LQQQGRHMEAYELVKEHCQDRKRQFDVLLEGHLYSRA 1018          

HSP 2 Score: 141.739 bits (356), Expect = 1.407e-33
Identity = 96/374 (25.67%), Postives = 179/374 (47.86%), Query Frame = 2
Query:  164 DIKDVISYDFNEYLKIQNGLSLYCANKSSLISFDNYNGMQLXXXXXXXXXXXXTLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKL---PIIAWKEDGDYFVISWISYSKIRNESEAQ-TRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTHVKLFTTNNYQWYSKKTISYEKLEKISLF-W-----SSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQ 1255
            D+ D++  +F   L++ N + +  +    +I  D   G   +       I     SP+Q ++  +T      ++++   ++    L+       + ++VGWGKKETQFHG  GK+A    E  + +   + +L     I+W+ DG++FV+S+++         AQ  R  +++  +G+L  T+E +  L++ + WR   N IA   +      I  FE+NGLRH   +L  +     + V  + ++ + DI  +     + Q   V L+T  NY WY K+ + +E+ + ++L  W     +   LH+  ESG H +Y+    +DR+               ++V VIDG ++L+T F+  ++PPP     + F+
Sbjct:   59 DLPDIVGVEF---LQLDNAICV-ASGAGEVILVDPQTGATSEGTFCDVGIESMAWSPNQEVVAFVTRTHNVVLMTSTFDVIAEQPLDAELDPDQQFVNVGWGKKETQFHGSEGKQAAKQKESDSTFIRDEQELNQDVSISWRGDGEFFVVSYVA---------AQLGRTFKVYDSEGKLNHTAEKSANLKDSVVWRPTGNWIAVPQQFPNKSTIALFEKNGLRHRELVLPFD--LQEEPVVQLRWSEDSDILAIRTCAKEEQ--RVYLYTIGNYHWYLKQVLIFEQADPLALLHWDTRCGAEHTLHVLKESGKHLVYRWAFAVDRN--------------NSIVGVIDGKRLLLTDFDEAIVPPPMSKIVLKFE 401          
BLAST of Elongator complex protein 1 vs. Ensembl Zebrafish
Match: elp1 (elongator complex protein 1 [Source:ZFIN;Acc:ZDB-GENE-071116-7])

HSP 1 Score: 223.787 bits (569), Expect = 8.424e-59
Identity = 137/416 (32.93%), Postives = 228/416 (54.81%), Query Frame = 2
Query: 1967 DETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDN---GKQKI-WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRIL 3202
            DET+R +E G+ I+T V   ++++L MPRGNLETI+ RALVL  L+  ++   + +A E MR+ R+NLNL+YDHNP  F+ N+   +K+ +  + + LF++EL  ED T TMY    ++++ ++     KV+ VC A+    E      Y   ILT +V+ T    + ALQ + + + N   G   +  ++ +KYL +L++++ELY  +L TYD +L L VA+K+Q DPKEY+ F+N L  L   NY+R+ I+  LKR  KAL  +++  +  + E + L+    LY  A+EL+  G+  Y T+S  +AE+LV      + A ++  R  +      A         W+  +  + +  +  ++       L  +L ++ R  EA    E Y KD   A +  + G  + +A R++
Sbjct:  669 DETVRKVERGSRIVTVVPQDTRLILQMPRGNLETIHHRALVLAQLRKWLDGLRFRDAFECMRKLRINLNLIYDHNPTVFLDNIEIFLKQIDSINHINLFLTELKEEDTTTTMYPCPSHSAVGKEG---KKVDVVCDALRSTMETLDPQKYCLCILTSHVRKTTPELETALQKVHELRVNPPGGTSSVSAEEALKYLLFLVNVNELYEHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNMLKTLE-PNYQRYTIDKHLKRYRKALHHLSKCGEEHFTEMLNLVKDQRLYSDALELYPSGSQQYKTLSVAYAEYLVEQ-QQAEQAGLLLWRCGESTR---ALQAFVSCTSWRNALAVAAQIPLPPQQLALLARDLAEKLLEARRHTEAALCLEQYAKDCEEAISALIQGAAWEEALRLI 1076          

HSP 2 Score: 171.014 bits (432), Expect = 2.152e-42
Identity = 111/332 (33.43%), Postives = 168/332 (50.60%), Query Frame = 2
Query:  323 TLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA--RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFML-YENGFCDNKVVSCISFNSNDDICTVVILDL-----DNQLTHVKLFTTNNYQWYSKKTISYEK---LEKISLFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVS 1276
            T SPDQ ++ + T      +++ + + +T  ++ Q  FG  + ++VGWGKKETQFHG  GK+A  R   E V      D + P I W+ DG +F +S +         +   R +RI++++  L +TSE  N LE  L W+   +LIA++ R      +VF E+NGL HG F L +E    D   V  + +NS+  +  V   DL     D+  T+++L+T +NY WY K+++ + K        + W  +   RLH+ +       Y       RS     D  D        V+VIDGDKVL+T F  CVIPPP CAF +     V+ V+
Sbjct:  116 TWSPDQELVTLTTGQESIIMMTKDFEPITEVAINQDDFGEDKFITVGWGKKETQFHGSEGKQAAQRKAAE-VQPALPWDDRKPRITWRGDGQFFAVSAVC-------PQTGARKVRIWNRECVLQTTSEVVNGLEQSLCWKPTGSLIASTQRHPNKHTVVFMEKNGLLHGDFTLPFEK---DQVKVKELLWNSDSTVLAVWAEDLKPKKNDHPNTYIQLWTVSNYHWYLKQSLHFGKDPIKAPACVCWDPEKALRLHILTSGLVSCTYDWGWSTQRS--HGLDCHDNAN-----VAVIDGDKVLVTTFRQCVIPPPMCAFELQLPVPVNLVT 429          
BLAST of Elongator complex protein 1 vs. Ensembl Zebrafish
Match: elp1 (elongator complex protein 1 [Source:ZFIN;Acc:ZDB-GENE-071116-7])

HSP 1 Score: 223.787 bits (569), Expect = 8.424e-59
Identity = 137/416 (32.93%), Postives = 228/416 (54.81%), Query Frame = 2
Query: 1967 DETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDN---GKQKI-WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRIL 3202
            DET+R +E G+ I+T V   ++++L MPRGNLETI+ RALVL  L+  ++   + +A E MR+ R+NLNL+YDHNP  F+ N+   +K+ +  + + LF++EL  ED T TMY    ++++ ++     KV+ VC A+    E      Y   ILT +V+ T    + ALQ + + + N   G   +  ++ +KYL +L++++ELY  +L TYD +L L VA+K+Q DPKEY+ F+N L  L   NY+R+ I+  LKR  KAL  +++  +  + E + L+    LY  A+EL+  G+  Y T+S  +AE+LV      + A ++  R  +      A         W+  +  + +  +  ++       L  +L ++ R  EA    E Y KD   A +  + G  + +A R++
Sbjct:  669 DETVRKVERGSRIVTVVPQDTRLILQMPRGNLETIHHRALVLAQLRKWLDGLRFRDAFECMRKLRINLNLIYDHNPTVFLDNIEIFLKQIDSINHINLFLTELKEEDTTTTMYPCPSHSAVGKEG---KKVDVVCDALRSTMETLDPQKYCLCILTSHVRKTTPELETALQKVHELRVNPPGGTSSVSAEEALKYLLFLVNVNELYEHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNMLKTLE-PNYQRYTIDKHLKRYRKALHHLSKCGEEHFTEMLNLVKDQRLYSDALELYPSGSQQYKTLSVAYAEYLVEQ-QQAEQAGLLLWRCGESTR---ALQAFVSCTSWRNALAVAAQIPLPPQQLALLARDLAEKLLEARRHTEAALCLEQYAKDCEEAISALIQGAAWEEALRLI 1076          

HSP 2 Score: 171.014 bits (432), Expect = 2.152e-42
Identity = 111/332 (33.43%), Postives = 168/332 (50.60%), Query Frame = 2
Query:  323 TLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA--RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFML-YENGFCDNKVVSCISFNSNDDICTVVILDL-----DNQLTHVKLFTTNNYQWYSKKTISYEK---LEKISLFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVS 1276
            T SPDQ ++ + T      +++ + + +T  ++ Q  FG  + ++VGWGKKETQFHG  GK+A  R   E V      D + P I W+ DG +F +S +         +   R +RI++++  L +TSE  N LE  L W+   +LIA++ R      +VF E+NGL HG F L +E    D   V  + +NS+  +  V   DL     D+  T+++L+T +NY WY K+++ + K        + W  +   RLH+ +       Y       RS     D  D        V+VIDGDKVL+T F  CVIPPP CAF +     V+ V+
Sbjct:  116 TWSPDQELVTLTTGQESIIMMTKDFEPITEVAINQDDFGEDKFITVGWGKKETQFHGSEGKQAAQRKAAE-VQPALPWDDRKPRITWRGDGQFFAVSAVC-------PQTGARKVRIWNRECVLQTTSEVVNGLEQSLCWKPTGSLIASTQRHPNKHTVVFMEKNGLLHGDFTLPFEK---DQVKVKELLWNSDSTVLAVWAEDLKPKKNDHPNTYIQLWTVSNYHWYLKQSLHFGKDPIKAPACVCWDPEKALRLHILTSGLVSCTYDWGWSTQRS--HGLDCHDNAN-----VAVIDGDKVLVTTFRQCVIPPPMCAFELQLPVPVNLVT 429          
BLAST of Elongator complex protein 1 vs. Ensembl Zebrafish
Match: elp1 (elongator complex protein 1 [Source:ZFIN;Acc:ZDB-GENE-071116-7])

HSP 1 Score: 214.157 bits (544), Expect = 4.280e-56
Identity = 133/396 (33.59%), Postives = 218/396 (55.05%), Query Frame = 2
Query: 1967 DETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDN---GKQKI-WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDL 3142
            DET+R +E G+ I+T V   ++++L MPRGNLETI+ RALVL  L+  ++   + +A E MR+ R+NLNL+YDHNP  F+ N+   +K+ +  + + LF++EL  ED T TMY    ++++ ++     KV+ VC A+    E      Y   ILT +V+ T    + ALQ + + + N   G   +  ++ +KYL +L++++ELY  +L TYD +L L VA+K+Q DPKEY+ F+N L  L   NY+R+ I+  LKR  KAL  +++  +  + E + L+    LY  A+EL+  G+  Y T+S  +AE+LV      + A ++  R  +      A         W+  +  + +  +  ++       L  +L ++ R  EA    E Y K L
Sbjct:  669 DETVRKVERGSRIVTVVPQDTRLILQMPRGNLETIHHRALVLAQLRKWLDGLRFRDAFECMRKLRINLNLIYDHNPTVFLDNIEIFLKQIDSINHINLFLTELKEEDTTTTMYPCPSHSAVGKEG---KKVDVVCDALRSTMETLDPQKYCLCILTSHVRKTTPELETALQKVHELRVNPPGGTSSVSAEEALKYLLFLVNVNELYEHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNMLKTLE-PNYQRYTIDKHLKRYRKALHHLSKCGEEHFTEMLNLVKDQRLYSDALELYPSGSQQYKTLSVAYAEYLVEQ-QQAEQAGLLLWRCGESTR---ALQAFVSCTSWRNALAVAAQIPLPPQQLALLARDLAEKLLEARRHTEAALCLEQYAKTL 1056          

HSP 2 Score: 171.014 bits (432), Expect = 1.393e-42
Identity = 111/332 (33.43%), Postives = 168/332 (50.60%), Query Frame = 2
Query:  323 TLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA--RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFML-YENGFCDNKVVSCISFNSNDDICTVVILDL-----DNQLTHVKLFTTNNYQWYSKKTISYEK---LEKISLFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVS 1276
            T SPDQ ++ + T      +++ + + +T  ++ Q  FG  + ++VGWGKKETQFHG  GK+A  R   E V      D + P I W+ DG +F +S +         +   R +RI++++  L +TSE  N LE  L W+   +LIA++ R      +VF E+NGL HG F L +E    D   V  + +NS+  +  V   DL     D+  T+++L+T +NY WY K+++ + K        + W  +   RLH+ +       Y       RS     D  D        V+VIDGDKVL+T F  CVIPPP CAF +     V+ V+
Sbjct:  116 TWSPDQELVTLTTGQESIIMMTKDFEPITEVAINQDDFGEDKFITVGWGKKETQFHGSEGKQAAQRKAAE-VQPALPWDDRKPRITWRGDGQFFAVSAVC-------PQTGARKVRIWNRECVLQTTSEVVNGLEQSLCWKPTGSLIASTQRHPNKHTVVFMEKNGLLHGDFTLPFEK---DQVKVKELLWNSDSTVLAVWAEDLKPKKNDHPNTYIQLWTVSNYHWYLKQSLHFGKDPIKAPACVCWDPEKALRLHILTSGLVSCTYDWGWSTQRS--HGLDCHDNAN-----VAVIDGDKVLVTTFRQCVIPPPMCAFELQLPVPVNLVT 429          
BLAST of Elongator complex protein 1 vs. Ensembl Zebrafish
Match: elp1 (elongator complex protein 1 [Source:ZFIN;Acc:ZDB-GENE-071116-7])

HSP 1 Score: 70.0922 bits (170), Expect = 2.705e-13
Identity = 46/145 (31.72%), Postives = 81/145 (55.86%), Query Frame = 2
Query: 2210 NLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDN---GKQKI-WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQ 2632
            N+   +K+ +  + + LF++EL  ED T TMY    ++++ ++     KV+ VC A+    E      Y   ILT +V+ T    + ALQ + + + N   G   +  ++ +KYL +L++++ELY  +L TYD +L L VA+K+Q
Sbjct:    1 NIEIFLKQIDSINHINLFLTELKEEDTTTTMYPCPSHSAVGKEG---KKVDVVCDALRSTMETLDPQKYCLCILTSHVRKTTPELETALQKVHELRVNPPGGTSSVSAEEALKYLLFLVNVNELYEHSLGTYDFDLVLMVAEKSQ 142          
BLAST of Elongator complex protein 1 vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:NCBI gene;Acc:100170442])

HSP 1 Score: 377.867 bits (969), Expect = 1.005e-109
Identity = 337/1188 (28.37%), Postives = 586/1188 (49.33%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA-RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFML-YENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTH----VKLFTTNNYQWYSKKTISY--EKLEKIS-LFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSI--------CWLENNSFYCV---------VNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNS---HVYIQDISGQVYQYDNESVKPL---------HKYSTFCCEMFSVKLKS-ESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQ-KTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI--WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLI---EVRLNFINGYKDLRIAGEDEALPDYMSDTIXXXXXXXXXXXXXXXXXXXXQNSSXXXXXXXXXXNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIW 3742
            SPDQ +++++T      +++ + + +   S+ Q  FG  + +++GWGKKETQFHG  GK+A +  +  V      D   P I W+ DG  F +S +         E   R +R+++++  L STSE    LE  L W+    LIA+S        I+F E+NGL HG F L +  G    K V  + +NS+  +  + + D++ + +     V+L+T  NY WY K+ + +   K+  +  L W  +   RLH+      +  +  +   D S     DG          V+VIDGDKVL+T F+  V+PPP   + I     V+ V+   LD     GL   I+ +++ +   IY   N         +      G      TP  +  L+L   +  +         W+++++F  +         + + +   ++D  +I +R +      V  +CY+S   H  IQ  +GQ+++Y  E+  P+         HK   F        L S E  + ++ L+ R ++ +INS   +    S    K  L+ T+ +   RC++L + +L  L   L+  +       DETIR +E G+ I+T V   +K++L MPRGNLET++ RALVL  ++  +++ L+ EA E MR+ R+NLNLLYDHNP  F+ N+   + +    + + LF++E+  EDVT+TMY      +++  +     KV+ +C A+    E      +   ILT YV+ T    + ALQ + + +++    +   D+ +KYL +L+ ++ELY  +L TYD +L + VA+K+Q DPKEY+ F+N L ++   NY+R+ I+  LKR  KAL  +++    ++ E + L+   +LY +A+EL+ +GT  Y  I+  + +HLV+     + A ++Y R +  E    A D    + +W + +  + + E S E+       +  +L +  +Q +A  + E Y +D   A  + LDG  + +A R++      D    N   L  +++    N +I  E  +  +++  ERL    E++     G  D  + G  EA  D  S+T S  ++ N+    +   S  S  SSK + K ++ K+  S K+GS  E++ L+E L  +++ +  + GD++ L+++L      + ++ L  A + LL+    SI  IW
Sbjct:  118 SPDQELVLLVTGQQTLILMTKDFEPIAEKSIYQDDFGEEKFITLGWGKKETQFHGSEGKKAAQQKIMAVQPALPWDDHKPRITWRGDGQLFAVSSVC-------KETGNRKIRVWNRELALQSTSESIEGLEQALSWKPSGALIASSQSKPNKNSIIFIEKNGLVHGEFTLPFIKG---QKKVKELLWNSDSTVLAIWLEDVEKEGSSSSCCVQLWTVGNYHWYLKQNLHFGNNKMNNVECLMWDPENAYRLHIICTGWHYFCFDWFWSTDCS-----DGGQGD------VAVIDGDKVLVTSFQHAVVPPPMSTYFIQLSCAVNEVAF-QLDPKESSGLA--ILDSANTLS--IYRYGNSTVNDPTVKLEAVGGNGFKTSYKTPKLEKKLRLPSNLCDVQPLNFRLLTWVQDDTFIAISQEPNSSISIVHQMTADQMDGQDINVRDVGTITGHVISLCYSSNTKHCAIQTSNGQLWKYLWENPTPVVEPWIDGMGHKVK-FPQPCLQTALTSIEGEEVVIGLTER-SRLFINSSEVASNITSFHLYKEFLLLTTHSHTCRCVSLQDTSLKALEAQLNSTSNPN----DETIRKVERGSRIVTVVPFDTKLILQMPRGNLETVHHRALVLAQIRKWLDSLLFKEAFECMRKLRINLNLLYDHNPKAFLDNVDLFITQIGSVNYINLFLTEIKDEDVTKTMYATASLITMQSSQGAKAKKVDIICDAVRTAMEKLDPQKFCLSILTSYVRKTKPELEIALQKVHELRESPSTTVVSADEALKYLLFLVDVNELYDYSLGTYDFDLVVMVAEKSQKDPKEYLPFLNKLKKMEI-NYQRYTIDKHLKRYRKALRNLSKCGSGYFAEFLNLVKDQNLYTEALELYQHGTVEYKAINAAYGDHLVSK-QQYELAGLIYARCDSTEK---ALDAFVASSNWHQVMCMASQLEYSGEKIAALARTVAGKLLEQRKQADAAVLLEQYAEDYEEAILLLLDGAHWEEALRLIYKYKRLDILETN---LKPALLDAQRNHMILFENQKTTFTRHKERLSVVREMKEKARQGLLDEDMTGCAEA--DLFSETSSIMTASNASGKYSQSNSRISSRSSKNRRKAERKKH--SLKEGSPLEDLALLEALAENIKMVDKLRGDVHSLLKVLILFEYDTMAKELQQAYDDLLQLFETSILDIW 1261          
BLAST of Elongator complex protein 1 vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:NCBI gene;Acc:100170442])

HSP 1 Score: 352.829 bits (904), Expect = 1.636e-101
Identity = 270/935 (28.88%), Postives = 465/935 (49.73%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFML-YENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTH----VKLFTTNNYQWYSKKTISY--EKLEKIS-LFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSI--------CWLENNSFYCV---------VNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNS---HVYIQDISGQVYQY---DNESVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIK-QKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI--WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWI-MAS 3019
            SPDQ +++++T      +++ + + +   S+ Q  FG  + +++GWGKKETQFHG  GK+A    + +      D   P I W+ DG  F +S +         E   R +R+++++  L STSE    LE  L W+    LIA+S        I+F E+NGL HG F L +  G    K V  + +NS+  +  + + D++ + +     V+L+T  NY WY K+ + +   K+  +  L W  +   RLH+      +  +  +   D S     DG          V+VIDGDKVL+T F+  V+PPP   + I     V+ V+   LD     GL   I+ +++ +   IY   N         +      G      TP  +  L+L   +  +         W+++++F  +         + + +   ++D  +I +R +      V  +CY+S   H  IQ  +GQ+++Y      ++ P+                      ++ L+ R ++ +INS   +    S    K  L+ T+ +   RC++L + +L  L   L+  +       DETIR +E G+ I+T V   +K++L MPRGNLET++ RALVL  ++  +++ L+ EA E MR+ R+NLNLLYDHNP  F+ N+   + +    + + LF++E+  EDVT+TMY      +++  +     KV+ +C A+    E      +   ILT YV+ T    + ALQ + + +++    +   D+ +KYL +L+ ++ELY  +L TYD +L + VA+K+Q DPKEY+ F+N L ++   NY+R+ I+  LKR  KAL  +++    ++ E + L+   +LY +A+EL+ +GT  Y  I+  + +HLV+     + A ++Y R +  E    A D    + +W + + MAS
Sbjct:  118 SPDQELVLLVTGQQTLILMTKDFEPIAEKSIYQDDFGEEKFITLGWGKKETQFHGSEGKKAAQ--QKIMPALPWDDHKPRITWRGDGQLFAVSSVC-------KETGNRKIRVWNRELALQSTSESIEGLEQALSWKPSGALIASSQSKPNKNSIIFIEKNGLVHGEFTLPFIKG---QKKVKELLWNSDSTVLAIWLEDVEKEGSSSSCCVQLWTVGNYHWYLKQNLHFGNNKMNNVECLMWDPENAYRLHIICTGWHYFCFDWFWSTDCS-----DGGQGD------VAVIDGDKVLVTSFQHAVVPPPMSTYFIQLSCAVNEVAF-QLDPKESSGLA--ILDSANTLS--IYRYGNSTVNDPTVKLEAVGGNGFKTSYKTPKLEKKLRLPSNLCDVQPLNFRLLTWVQDDTFIAISQEPNSSISIVHQMTADQMDGQDINVRDVGTITGHVISLCYSSNTKHCAIQTSNGQLWKYLWGKFGNILPM----------------------VIGLTER-SRLFINSSEVASNITSFHLYKEFLLLTTHSHTCRCVSLQDTSLKALEAQLNSTSNPN----DETIRKVERGSRIVTVVPFDTKLILQMPRGNLETVHHRALVLAQIRKWLDSLLFKEAFECMRKLRINLNLLYDHNPKAFLDNVDLFITQIGSVNYINLFLTEIKDEDVTKTMYATASLITMQSSQGAKAKKVDIICDAVRTAMEKLDPQKFCLSILTSYVRKTKPELEIALQKVHELRESPSTTVVSADEALKYLLFLVDVNELYDYSLGTYDFDLVVMVAEKSQKDPKEYLPFLNKLKKMEI-NYQRYTIDKHLKRYRKALRNLSKCGSGYFAEFLNLVKDQNLYTEALELYQHGTVEYKAINAAYGDHLVSK-QQYELAGLIYARCDSTEK---ALDAFVASSNWHQVMCMAS 992          
BLAST of Elongator complex protein 1 vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:NCBI gene;Acc:100170442])

HSP 1 Score: 349.747 bits (896), Expect = 2.649e-100
Identity = 272/938 (29.00%), Postives = 467/938 (49.79%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA-RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFML-YENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTH----VKLFTTNNYQWYSKKTISY--EKLEKIS-LFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGL--------LSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSICWLENNSFYCV---------VNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNS---HVYIQDISGQVYQYDNESVKPLHKYSTFCCEMF------SVKLKSESNDTILALSSRFNQFYINSVS-----QSGTYLSILPL-KHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIK-QKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI-WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKE 3004
            SPDQ +++++T      +++ + + +   S+ Q  FG  + +++GWGKKETQFHG  GK+A +  +  V      D   P I W+ DG  F +S +         E   R +R+++++  L STSE    LE  L W+    LIA+S        I+F E+NGL HG F L +  G    K V  + +NS+  +  + + D++ + +     V+L+T  NY WY K+ + +   K+  +  L W  +   RLH+      +  +  +   D S     DG          V+VIDGDKVL+T F+  V+PPP   + I     V+ V+   LD     GL        LSF+   ++ +C  I +  +P  +     +P+ L      C   P++            + W+++++F  +         + + +   ++D  +I +R +      V  +CY+S   H  IQ  +GQ+++Y          +  F  E +       VK       T + +    + F++++++     Q  + ++   L K  L+ T+ +   RC++L + +L  L   L+  +       DETIR +E G+ I+T V   +K++L MPRGNLET++ RALVL  ++  +++ L+ EA E MR+ R+NLNLLYDHNP  F+ N+   + +    + + LF++E+  EDVT+TMY      +++  +     KV+ +C A+    E      +   ILT YV+ T    + ALQ   K  D     +  D+ +KYL +L+ ++ELY  +L TYD +L + VA+K+Q DPKEY+ F+N L ++   NY+R+ I+  LKR  KAL  +++    ++ E + L+   +LY +A+EL+ +GT  Y  I+  + +HLV+     + A ++Y R +  E    A D    + +W +
Sbjct:  118 SPDQELVLLVTGQQTLILMTKDFEPIAEKSIYQDDFGEEKFITLGWGKKETQFHGSEGKKAAQQKIMAVQPALPWDDHKPRITWRGDGQLFAVSSVC-------KETGNRKIRVWNRELALQSTSESIEGLEQALSWKPSGALIASSQSKPNKNSIIFIEKNGLVHGEFTLPFIKG---QKKVKELLWNSDSTVLAIWLEDVEKEGSSSSCCVQLWTVGNYHWYLKQNLHFGNNKMNNVECLMWDPENAYRLHIICTGWHYFCFDWFWSTDCS-----DGGQGD------VAVIDGDKVLVTSFQHAVVPPPMSTYFIQLSCAVNEVAF-QLDPKESSGLAILDSYLILSFL---NNVVCLIIVMLVSPFFR-----LPSNL------CDVQPLN---------FRLLTWVQDDTFIAISQEPNSSISIVHQMTADQMDGQDINVRDVGTITGHVISLCYSSNTKHCAIQTSNGQLWKY---------LWGKFVVEPWIDGMGHKVKFPQPCLQTFVFVHFVISCFFVSTMTFFFVLQVASNITSFHLYKEFLLLTTHSHTCRCVSLQDTSLKALEAQLNSTSNPN----DETIRKVERGSRIVTVVPFDTKLILQMPRGNLETVHHRALVLAQIRKWLDSLLFKEAFECMRKLRINLNLLYDHNPKAFLDNVDLFITQIGSVNYINLFLTEIKDEDVTKTMYATASLITMQSSQGAKAKKVDIICDAVRTAMEKLDPQKFCLSILTSYVRKTKPELEIALQ---KVHDPSTTVVSADEALKYLLFLVDVNELYDYSLGTYDFDLVVMVAEKSQKDPKEYLPFLNKLKKMEI-NYQRYTIDKHLKRYRKALRNLSKCGSGYFAEFLNLVKDQNLYTEALELYQHGTVEYKAINAAYGDHLVSK-QQYELAGLIYARCDSTEK---ALDAFVASSNWHQ 989          
BLAST of Elongator complex protein 1 vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:NCBI gene;Acc:100170442])

HSP 1 Score: 347.051 bits (889), Expect = 1.147e-99
Identity = 271/935 (28.98%), Postives = 458/935 (48.98%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFML-YENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTH----VKLFTTNNYQWYSKKTISY--EKLEKIS-LFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSIC-----------WLENNSFYCV---------VNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNS---HVYIQDISGQVYQYDNESVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIK-QKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI--------WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKE 3004
            SPDQ +++++T      +++ + + +   S+ Q  FG  + +++GWGKKETQFHG  GK+A      V      D   P I W+ DG  F +S +         E   R +R+++++  L STSE    LE  L W+    LIA+S        I+F E+NGL HG F L +  G    K V  + +NS+  +  + + D++ + +     V+L+T  NY WY K+ + +   K+  +  L W  +   RLH+      +  +  +   D S     DG          V+VIDGDKVL+T F+  V+PPP   + I     V+ V+   LD     GL   I+ +++ +   IY   N  +   E +     K           S  T +L+ +++++C           W+++++F  +         + + +   ++D  +I +R +      V  +CY+S   H  IQ  +GQ+++Y         K+       F   L+  SN T   L   F                       L+ T+ +   RC++L + +L  L   L+  +       DETIR +E G+ I+T V   +K++L MPRGNLET++ RALVL  ++  +++ L+ EA E MR+ R+NLNLLYDHNP  F+ N+   + +    + + LF++E+  EDVT+TMY      +++  +     KV+ +C A+    E      +   ILT YV+ T    + ALQ + + +  GK+ +         D+ +KYL +L+ ++ELY  +L TYD +L + VA+K+Q DPKEY+ F+N L ++   NY+R+ I+  LKR  KAL  +++    ++ E + L+   +LY +A+EL+ +GT  Y  I+  + +HLV+     + A ++Y R +  E    A D    + +W +
Sbjct:  118 SPDQELVLLVTGQQTLILMTKDFEPIAEKSIYQDDFGEEKFITLGWGKKETQFHGSEGKKAA-----VQPALPWDDHKPRITWRGDGQLFAVSSVC-------KETGNRKIRVWNRELALQSTSESIEGLEQALSWKPSGALIASSQSKPNKNSIIFIEKNGLVHGEFTLPFIKG---QKKVKELLWNSDSTVLAIWLEDVEKEGSSSSCCVQLWTVGNYHWYLKQNLHFGNNKMNNVECLMWDPENAYRLHIICTGWHYFCFDWFWSTDCS-----DGGQGD------VAVIDGDKVLVTSFQHAVVPPPMSTYFIQLSCAVNEVAF-QLDPKESSGLA--ILDSANTLS--IYRYVNDPTVKLEAVGGNGFK----------TSYKTPKLEKKLSNLCDVQPLNFRLLTWVQDDTFIAISQEPNSSISIVHQMTADQMDGQDINVRDVGTITGHVISLCYSSNTKHCAIQTSNGQLWKY------LWGKFGNIFTMTFFFVLQVASNITSFHLYKEF-----------------------LLLTTHSHTCRCVSLQDTSLKALEAQLNSTSNPN----DETIRKVERGSRIVTVVPFDTKLILQMPRGNLETVHHRALVLAQIRKWLDSLLFKEAFECMRKLRINLNLLYDHNPKAFLDNVDLFITQIGSVNYINLFLTEIKDEDVTKTMYATASLITMQSSQGAKAKKVDIICDAVRTAMEKLDPQKFCLSILTSYVRKTKPELEIALQKVHELR--GKKYLNPSTTVVSADEALKYLLFLVDVNELYDYSLGTYDFDLVVMVAEKSQKDPKEYLPFLNKLKKMEI-NYQRYTIDKHLKRYRKALRNLSKCGSGYFAEFLNLVKDQNLYTEALELYQHGTVEYKAINAAYGDHLVSK-QQYELAGLIYARCDSTEK---ALDAFVASSNWHQ 971          
BLAST of Elongator complex protein 1 vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:NCBI gene;Acc:100170442])

HSP 1 Score: 345.125 bits (884), Expect = 9.604e-99
Identity = 271/930 (29.14%), Postives = 453/930 (48.71%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFML-YENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTH----VKLFTTNNYQWYSKKTISY--EKLEKIS-LFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSI--------CWLENNSFYCV---------VNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNS---HVYIQDISGQVYQYDNESVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIK-QKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWI-MAS 3019
            SPDQ +++++T      +++ + + +   S+ Q  FG  + +++GWGKKETQFHG  GK+A      V      D   P I W+ DG  F +S +         E   R +R+++++  L STSE    LE  L W+    LIA+S        I+F E+NGL HG F L +  G    K V  + +NS+  +  + + D++ + +     V+L+T  NY WY K+ + +   K+  +  L W  +   RLH+      +  +  +   D S     DG          V+VIDGDKVL+T F+  V+PPP   + I     V+ V+   LD     GL   I+ +++ +   IY   N         +      G      TP  +  L+L   +  +         W+++++F  +         + + +   ++D  +I +R +      V  +CY+S   H  IQ  +GQ+++Y         K+       F   L+  SN T   L   F                       L+ T+ +   RC++L + +L  L   L+  +       DETIR +E G+ I+T V   +K++L MPRGNLET++ RALVL  ++  +++ L+ EA E MR+ R+NLNLLYDHNP  F+ N+   + +    + + LF++E+  EDVT+TMY      +++  +     KV+ +C A+    E      +   ILT YV+ T    + ALQ + + +        D+ +KYL +L+ ++ELY  +L TYD +L + VA+K+Q DPKEY+ F+N L ++   NY+R+ I+  LKR  KAL  +++    ++ E + L+   +LY +A+EL+ +GT  Y  I+  + +HLV+     + A ++Y R +  E    A D    + +W + + MAS
Sbjct:  118 SPDQELVLLVTGQQTLILMTKDFEPIAEKSIYQDDFGEEKFITLGWGKKETQFHGSEGKKA------VQPALPWDDHKPRITWRGDGQLFAVSSVC-------KETGNRKIRVWNRELALQSTSESIEGLEQALSWKPSGALIASSQSKPNKNSIIFIEKNGLVHGEFTLPFIKG---QKKVKELLWNSDSTVLAIWLEDVEKEGSSSSCCVQLWTVGNYHWYLKQNLHFGNNKMNNVECLMWDPENAYRLHIICTGWHYFCFDWFWSTDCS-----DGGQGD------VAVIDGDKVLVTSFQHAVVPPPMSTYFIQLSCAVNEVAF-QLDPKESSGLA--ILDSANTLS--IYRYGNSTVNDPTVKLEAVGGNGFKTSYKTPKLEKKLRLPSNLCDVQPLNFRLLTWVQDDTFIAISQEPNSSISIVHQMTADQMDGQDINVRDVGTITGHVISLCYSSNTKHCAIQTSNGQLWKY------LWGKFGNIFTMTFFFVLQVASNITSFHLYKEF-----------------------LLLTTHSHTCRCVSLQDTSLKALEAQLNSTSNPN----DETIRKVERGSRIVTVVPFDTKLILQMPRGNLETVHHRALVLAQIRKWLDSLLFKEAFECMRKLRINLNLLYDHNPKAFLDNVDLFITQIGSVNYINLFLTEIKDEDVTKTMYATASLITMQSSQGAKAKKVDIICDAVRTAMEKLDPQKFCLSILTSYVRKTKPELEIALQKVHELRVVSA----DEALKYLLFLVDVNELYDYSLGTYDFDLVVMVAEKSQKDPKEYLPFLNKLKKMEI-NYQRYTIDKHLKRYRKALRNLSKCGSGYFAEFLNLVKDQNLYTEALELYQHGTVEYKAINAAYGDHLVSK-QQYELAGLIYARCDSTEK---ALDAFVASSNWHQVMCMAS 973          
BLAST of Elongator complex protein 1 vs. Ensembl Mouse
Match: Elp1 (elongator complex protein 1 [Source:MGI Symbol;Acc:MGI:1914544])

HSP 1 Score: 324.324 bits (830), Expect = 2.546e-91
Identity = 287/1105 (25.97%), Postives = 519/1105 (46.97%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKV-VSCISFNSNDDICTVVILDLDNQ-----LTHVKLFTTNNYQWYSKKTISYEKLEK---ISLFW---SSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMT-------PFEFC----VIPPPY--CAFTINFQHDVSFVSL------------PTLDNISEDGLLS---FIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSICWLENNSFYCVVNNALFLYKL-------------DQSNI-VIRKLEIGDIQVGKICYNS--HVYIQDISGQVYQYDNES----VKPLH-------KYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLS-IDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDN----GKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGEDEALPDYMSDT 3421
            SPDQ +L++ T+     +++ + +++    + Q  FG  + ++VGWG K+TQFHG  G+     V+        D + P I W+ DG YF +S +         + + R +R+++++  L STSE    L   L W+   +LIA++       ++VFFE+NGL HG F L    F  ++V V+ + +N++  +  + + DL  +      ++V+L+T  NY WY K+++ +    K   +SL W   +  RLH+      +     +   DRS        +    L N V+VIDG++VL+T       P   C    +IP P     F+ +  +D++ +              P +D+  + G +    F V           LT   + K Y       ++FG  +        A      Q++ + W+E+++F  +  +      +             +Q  + V   + +  + +G  C +    + +Q   GQV +Y  ES    V+P         ++   C +M    +  E  + +L L+ R  +F+IN    +    S       L+ T+ +   +  +L+  +L  L   L   +        E +R +E G+ I+T V   +K++L MPRGNLE ++ RALVL  ++  ++  ++ EA E MR+ R+NLNL++DHNP  F+ N+   VK+ +  + + LF +EL  EDVT+TMY      S++  T     K++ +C A+    E      +   ILT +VK T    +  LQ +++ + N     +    ++ +KYL  L+ ++EL+  +L TYD NL L VA+K+Q DPKEY+ F+N L ++   NY+RF I+ +LKR  KAL  +++    ++ E + LI   +LY +A++L+   +  Y  +S  + EHL+   +  + A +V+ R   +E    A +       W++ +  + + ++S+++       L  +L +  +  EA  + E Y +D   A  + L+G  + +A R++      D    ++   I    K Y +FL       I++   L+ +  +R      + D  +A   E+  D  S+T
Sbjct:  118 SPDQELLLLATAQQTLIMMTKDFEVIAEEQIHQDDFGEGKFVTVGWGSKQTQFHGSEGRPTAFPVQLPENALPWDDRRPHITWRGDGQYFAVSVVC-------RQTEARKIRVWNREFALQSTSESVPGLGPALAWKPSGSLIASTQDKPNQQDVVFFEKNGLLHGHFTL---PFLKDEVKVNDLLWNADSSVLAIWLEDLPKEDSSTLKSYVQLWTVGNYHWYLKQSLPFSTTGKNQIVSLLWDPVTPCRLHVLCTGWRYLCCDWHWTTDRS------SGNSANDLAN-VAVIDGNRVLVTVFRQTVVPPPMCTYRLLIPHPVNQVIFSAHLGNDLAVLDASNQISVYKCGDKPNMDSTVKLGAVGGNGFKVP----------LTTPHLEKRYS------IQFGNNEEEEEEEVNAL-----QLSFLTWVEDDTFLAISYSHSSSQSIIHHLTVTHSEVDEEQGQLDVSSSVTVDGVVIGLCCCSKTKSLAVQLADGQVLKYLWESPSLAVEPWKNSEGIPVRFVHPCTQMEVATIGGE--ECVLGLTDRC-RFFINDTEVASNITSFAVCDDFLLVTTHSHTCQVFSLSGASLKMLQAALSGSHEASG----EILRKVERGSRIVTVVPQDTKLILQMPRGNLEVVHHRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIHDHNPKVFLENVETFVKQIDSVNHINLFFTELREEDVTKTMYPPPITKSVQVSTHPDGKKLDLICDAMRAAMEAINPRKFCLSILTSHVKKTTPELEIVLQKVQELQGNLPFDPESVSVEEALKYLLLLVDVNELFNHSLGTYDFNLVLMVAEKSQKDPKEYLPFLNTLKKMET-NYQRFTIDKYLKRYEKALGHLSKCGPEYFTECLNLIKDKNLYKEALKLYRPDSPQYQAVSMAYGEHLM-QEHLYEPAGLVFARCGAQE---KALEAFLACGSWQQALCVAAQLQMSKDKVAGLARTLAGKLVEQRKHSEAATVLEQYAQDYEEAVLLLLEGSAWEEALRLVYKYDRVDIIETSVKPSILEAQKNYMDFLDSETATFIRHKNRLQVVRALRRQAPQVHVDHEVAHGPES--DLFSET 1170          
BLAST of Elongator complex protein 1 vs. UniProt/SwissProt
Match: sp|O95163|ELP1_HUMAN (Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3)

HSP 1 Score: 374.4 bits (960), Expect = 1.018e-107
Identity = 296/1062 (27.87%), Postives = 518/1062 (48.78%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKV-VSCISFNSNDDICTVVILDLDNQ-----LTHVKLFTTNNYQWYSKKTISYEKLEK---ISLFW---SSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQL------DHQINSI-----CWLENNSFYCVVNNAL----FLYKLDQSNIVIRKLEIGDIQVGK----------ICYNSH---VYIQDISGQVYQYDNES----VKPLHKYSTFC------CEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIK-QKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI----WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVR 3343
            SPDQ ++++ T      +++ + + +    + Q  FG ++ ++VGWG+KETQFHG  G++A   ++        D   P + W+ DG +F +S +         E   R +R+++++  L STSEP   L   L W+   +LIA++       +IVFFE+NGL HG F L    F  ++V V+ + +N++  +  V + DL  +      T V+L+T  NY WY K+++S+    K   +SL W   +  RLH+  +   +  Y  +   DRS+ +N      +  L N V+VIDG++VL+T F   V+PPP C + + F H V+ V+       S D     ++  S+ I   +Y   +  S      +      G   CL TP  +   ++      D  +N +      W+E + F  V ++       ++ L  ++  + + E G + V            +C NS    V +Q   GQ+++Y  ES    +KP      F       C    + +  E  + +L L+ R  +F+IN +  +    S       L+ T+ +   +C  L + +   L   L       +    E +R +E G+ I+T V   +K+VL MPRGNLE ++ RALVL  ++  ++  ++ EA E MR+ R+NLNL+YDHNP  F+ N+   +K+ +  + + LF +EL  EDVT+TMY     +S+   +    +K++ VC A+  + E+     Y   ILT +VK T    +  LQ + + + N          ++ +KYL +L+ ++ELY  +L TYD +L L VA+K+Q DPKEY+ F+N L ++   NY+RF I+ +LKR  KA+  +++    ++ E + LI   +LY +A++L++  +  Y  IS  + EHL+   +  + A +++ R    E    A        +WK+ +  + +   ++++       L  +L +  +  +A  + E   +D   A  + L+G  + +A R++   +  D    N+   I    K Y  FL   +     +S+  +RL+ VR
Sbjct:  118 SPDQELVLLATGQQTLIMMTKDFEPILEQQIHQDDFGESKFITVGWGRKETQFHGSEGRQAAFQMQMHESALPWDDHRPQVTWRGDGQFFAVSVVC-------PETGARKVRVWNREFALQSTSEPVAGLGPALAWKPSGSLIASTQDKPNQQDIVFFEKNGLLHGHFTL---PFLKDEVKVNDLLWNADSSVLAVWLEDLQREESSIPKTCVQLWTVGNYHWYLKQSLSFSTCGKSKIVSLMWDPVTPYRLHVLCQGWHYLAYDWHWTTDRSVGDN------SSDLSN-VAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSND---LAVLDASNQIS--VYKCGDCPSADPTVKLGAVGGSGFKVCLRTPHLEKRYKIQFENNEDQDVNPLKLGLLTWIEEDVFLAVSHSEFSPRSVIHHLTAASSEMDE-EHGQLNVSSSAAVDGVIISLCCNSKTKSVVLQLADGQIFKYLWESPSLAIKPWKNSGGFPVRFPYPCTQTELAMIGE-EECVLGLTDRC-RFFINDIEVASNITSFAVYDEFLLLTTHSHTCQCFCLRDASFKTLQAGLSSN----HVSHGEVLRKVERGSRIVTVVPQDTKLVLQMPRGNLEVVHHRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIYDHNPKVFLGNVETFIKQIDSVNHINLFFTELKEEDVTKTMYPAPVTSSVYLSRDPDGNKIDLVCDAMRAVMESINPHKYCLSILTSHVKKTTPELEIVLQKVHELQGNAPSDPDAVSAEEALKYLLHLVDVNELYDHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNTLKKMET-NYQRFTIDKYLKRYEKAIGHLSKCGPEYFPECLNLIKDKNLYNEALKLYSPSSQQYQDISIAYGEHLM-QEHMYEPAGLMFARCGAHE---KALSAFLTCGNWKQALCVAAQLNFTKDQLVGLGRTLAGKLVEQRKHIDAAMVLEECAQDYEEAVLLLLEGAAWEEALRLVYKYNRLDIIETNVKPSILEAQKNYMAFL---DSQTATFSRHKKRLLVVR 1142          
BLAST of Elongator complex protein 1 vs. UniProt/SwissProt
Match: sp|Q8WND5|ELP1_RABIT (Elongator complex protein 1 OS=Oryctolagus cuniculus OX=9986 GN=ELP1 PE=2 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 2.035e-107
Identity = 298/1072 (27.80%), Postives = 521/1072 (48.60%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKV-VSCISFNSNDDICTVVILDLDNQ-----LTHVKLFTTNNYQWYSKKTI---SYEKLEKISLFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRAD------CLYTPISKATLQLDHQINS-----------ICWLENNSFYCVVNNALFLYKLDQSNIVIRKL---------EIGDIQVGK----------ICYNSH---VYIQDISGQVYQYDNES----VKPLHKYSTFCCEMFSVKLKSE-----SNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQ-KTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI----WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVR 3343
            SPDQ ++++ T      +++ + + +    + Q  FG ++ ++VGWGKKETQFHG  G++A   ++        D   P + W+ DG +F +S +         E   R +R+++++  L STSEP   L   L W+   +LIA++       ++VFFE+NGL HG F L    F  ++V V+ + +N++  +  V + DL  +      T+V+L+T  NY WY  + +   +Y K + +SL W      RLH+  +   +  Y      DRS        D    L N V+VIDG+++L+T F+  V+PPP C + +   H V+ V+   L   S D  L+ +     +  N I + +   S S +   PT +K G          L TP  +   ++  + N            + W+E + F  + ++     +      VI +L         E G + V            +C NS    V +Q   GQ+ +Y  ES    V+P      F  +     +++E       + +L L+ R  +F+IN    +    S       L+ T+ +   +C  L + ++  L   L       +    E +R +E G+ I+T V   +K++L MPRGNLE ++ RALVL  ++  ++  ++ EA E MR+ R+NLNL++DHNP+ F+ N+   +++ +  + + LF +EL  EDVT+TMY     +S++Q +     K++ +C A+    EN     Y   ILT +VK T    +  LQ + + + N          ++ +KYL  L+ ++ELY  +L TYD +L L VA+K+Q DPKEY+ F+N L ++   NY+RF I+ +LKR  KA+  +++    ++ E + LI   +LY +A++L+   +  Y  IS  + EHL+   +  + A +V+ R    E    A         W++ +  + +  ++EE+       L  +L +  +  +A  + E Y +D   A  + L+G  + +A R++   +  D    N+     S+++ Y+N++  +E     +S+  ERL+EVR
Sbjct:  118 SPDQELVLLATGQQTLIMMTKDFEPIMEQQIHQDDFGESKFITVGWGKKETQFHGSEGRQAAFQIQTHESALPWDDHRPRVTWRGDGQFFAVSVVC-------PETGARKVRVWNREFALQSTSEPVPGLGPALAWKPSGSLIASTQNKPNQQDVVFFEKNGLLHGQFTL---PFLKDEVKVNDLLWNADSSVLAVWLEDLQREEDSVLKTYVQLWTVGNYHWYLNECLPFSTYGKSKIVSLMWDPVIPYRLHVLCQGWHYLCYDWRWTTDRS------SGDNESDLAN-VAVIDGNRILVTVFQQTVVPPPMCTYRLLLPHPVNQVTFCALPKKSND--LAVL-----DASNQISVYKCGDSPSMD---PT-VKLGAVGGNGFKVSLRTPHLEKRYKIQFESNEDQETNPLKLSLLSWIEEDIFLAICHS-----QCSPQQSVIHRLTVVPCEVDEEQGQLSVSSSISVDGIIISMCCNSKTKSVALQLADGQILKYIWESPSLAVEPWKNPGGFPIQFPYPCIQTELAMIGGEECVLGLTDRC-RFFINDTEVASNITSFAVYDEFLLLTTHSHTCQCYCLKDASIKTLQAGLSSS----HVSNGEILRKVERGSRIVTVVPQDTKLILQMPRGNLEVVHHRALVLAQIRKWLDKIMFKEAFECMRKLRINLNLIHDHNPEVFLQNVETFIRQIDCVNHINLFFTELKEEDVTKTMYPPPVPSSVQQSRDPGGTKLDLICDALRVAMENINPHKYCLPILTSHVKKTTPELEIVLQKVHELQGNAPSDPDAVSAEEALKYLLLLVDVNELYDHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNTLKKMET-NYQRFTIDKYLKRYEKAIGHLSKCGPEYFSECLNLIKDKNLYNEALKLYPPTSQEYKDISIAYGEHLMEE-HQYEPAGLVFARCGAHEK---ALSAFLTCGSWQQTLCMAAQLNMTEEQLAGLGRTLAGKLAEQRKHSDAAIVLEQYTQDYEEAVLLLLEGAAWEEALRLVYKYNRLDIIETNIK---PSILEAYKNYMAFLESQSATFSRHKERLLEVR 1143          
BLAST of Elongator complex protein 1 vs. UniProt/SwissProt
Match: sp|Q2TAQ1|ELP1_XENLA (Putative elongator complex protein 1 OS=Xenopus laevis OX=8355 GN=elp1 PE=2 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 8.766e-102
Identity = 293/1008 (29.07%), Postives = 501/1008 (49.70%), Query Frame = 2
Query:  458 VGWGKKETQFHGKVGKEA-RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKV-VSCISFNSNDDICTVVILDLDNQLTH----VKLFTTNNYQWYSKKTISY--EKLEKIS-LFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQL-----DHQINS---ICWLENNSFYCVVNNA---------LFLYKLDQSNIVIRKLEIGDIQVGKICYNS---HVYIQDISGQVY----QYDNESVKP----LHKYSTFCCEMFSVKLKS-ESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIK-QKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI--WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRIL--AFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVR 3343
            +G  KKETQFHG  GK+A +  +  V      D   P I W+ DG  F +S +         E+ TR +R+++++  L STSE    LE  L W+    LIA+S        ++FFE+NGL HG F L    F   ++ V  + +NS+  I  + + D +   +     V+L+T  NY WY K+++++  ++++KI  L W  +   RLH+ S    +  +  +   D S     DG          V+VIDGDKVL+T F+  V+PPP   + I     V+ V+   L+     G+    +  S NI +      + ++    KL        R     TP  +  L+L     D Q+ S   + W+++++F  V   +         +   ++D  +I +R +      +  +CY+    H  +Q  +G+++    +Y   +V+P    + +   F        L S E  D ++ L+ R ++ +IN+   +    S    +  L+ T+ +   RC++L + +L  L   L+      +   DETIR +E G+ IIT V   +K++L MPRGNLETI+ RALVL  ++  ++  L+ EA E MR+ R+NLNLLYDHNP  F+ N+   +K+    + + LF++E+  EDVT+TMY     ++++  +     KV+ VC A+    E      +   ILT YV+ T    + ALQ + + +++    I   D+ +KYL +L+ ++ELY  +L TYD +L + VA+K+Q DPKEY+ F+N L ++   NY+R+ I+  LKR  KAL  +++    ++ E +  +   SLY +A+EL+ +GT  Y  I+  + +HLV+     + A ++Y R N  E    A D    + +W + +  + + E S E+       +  +L +  +Q +A  + E Y +D   A  + L+G  + +A R++      D    N   L  +++    N +I  +  +  +++  ERL  VR
Sbjct:   11 LGGAKKETQFHGSEGKQAAQQKIMVVKPALPWDDHKPRITWRGDGQLFAVSSVC-------KESGTRKIRVWNRELALQSTSESIEGLEQALSWKPSGALIASSQSKPNKHSVIFFEKNGLVHGEFTL---PFTKGQIKVKELLWNSDSTILAIWLEDNEKDESSSGCCVQLWTVGNYHWYLKQSLNFGTDEMKKIECLMWDPENAYRLHVFSTGWHYFCFDWFWGTDHS-----DGGQGD------VAVIDGDKVLVTSFQQAVVPPPMSTYFIQLSCAVNEVTF-QLEPKKNSGI---AILDSTNILSIYRYGNSTVNDPTVKLGAVSGNGFRTSS-QTPKLEKKLRLPRNACDVQLRSFRLLTWVQDDTFLAVSQESNSSISTVHHMNTDQMDGQDINVRDVGTITGHIISLCYSPNTKHCALQTSNGKIWKYLCEYPTPAVEPWIDSMGQEVKFPQPCVQTALASIEGEDMVIGLTER-SRLFINNSEVASNITSFHLYEEFLLLTTHSHTCRCVSLRDTSLKALETQLN----SASNPNDETIRKVERGSRIITVVPCDTKLILQMPRGNLETIHHRALVLAQIRKWLDRLLFKEAFECMRKLRINLNLLYDHNPKAFLDNVDLFIKQIGSVNYINLFLTEIKEEDVTKTMYPTHALSTMQSSEGAKAKKVDIVCDAVRAAMEKWDPQKFCLSILTSYVRRTIPQLEIALQKVHELRESPSTTIVSADEALKYLLFLVDVNELYDHSLGTYDFDLVVMVAEKSQKDPKEYLPFLNKLKKMET-NYQRYTIDKHLKRYKKALSNLSKCGPDYFTEFLSFVKDQSLYTEALELYPHGTVEYKAINAAYGDHLVSK-QQYELAGLIYARCNSIEK---ALDAFIASGNWHQVMCMASQLEYSGEKIAALARTVAGKLVEQRKQADAAVLLEQYAEDYEEAILLLLEGAHWEEALRLIYKYIRLDILETN---LKPALLDAQRNHMILFDNQKTTFTRHKERLSVVR 979          
BLAST of Elongator complex protein 1 vs. UniProt/SwissProt
Match: sp|Q8VHU4|ELP1_RAT (Elongator complex protein 1 OS=Rattus norvegicus OX=10116 GN=Elp1 PE=2 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.474e-98
Identity = 327/1203 (27.18%), Postives = 568/1203 (47.22%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKV-VSCISFNSNDDICTVVILDLDNQ-----LTHVKLFTTNNYQWYSKKTISYEKLEK---ISLFW---SSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFV-SLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDH------------QINSICWLENNSFYCVVNNALFLYKLDQSNIVIRKLEI----GDIQVGKICYNSHVYIQDI------------------SGQVYQYDNES----VKPLH-------KYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKT-LSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDN----GKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGEDEALPDYMSDTIXXXXXXXXXXXXXXXXXXXXQNSSXXXXXXXXXXNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIW 3742
            SPDQ +L++ T+     +++ + +++T   + Q  FG  + ++VGWG K+TQFHG  G+     V+        D   P I W+ DG +F +S +        S+   R +R+++++  L STSE    L   L W+   +LIA++       ++VFFE+NGL HG F L    F  ++V V+ + +N++  +  V + DL  +      ++V+L+T  NY WY K+++ +    K   +SL W   +  RLH+  +   +     +   DRS   + D       L N V+VIDG+KVL+T F+  V PPP C + +   H V+ V S   L N  +  +L    Q S   C+       P   S  KL       G    L TP  +   ++              Q   + W+E ++F  + ++    +   QS  +I  L +    GD + G++  +S V +  +                   GQV +Y  ES    V+P         +++  C +M +  +  E  + +L L+ R  +F+IN    +    S       L+ T+ +   +C +L+  +L  L   L            E +R +E G+ I+T V   +K++L MPRGNLE ++ RALVL  ++  ++  ++ EA E MR+ R+NLNL++DHNP  F+ N+   +K+ +  + L LF +EL  EDVT+TMY      S++  T     KV+ +C A+    E      +   ILT +VK T    D  LQ + + +       +    ++ +KYL  L+ ++EL+  +L TYD +L L VA+K+Q DPKEY+ F+N L ++   NY+RF I+ +LKR  KAL  +++    ++ E + LI   +LY +A++L+   +  Y  +S  + EHLV      + A +V+ R    E    A +       W++ +  + + ++++++       L  +L +  +  EA  + E Y  D   A  + L+G  + +A R++      D    ++   I    K Y +FL       I++   L+ + E++      + D  +A   E   D  S+T S  S        +   S  S  SSK + K ++ K+  S K+GS  E + L+E L   V+ I+ +  +++ ++++L       ++R L  A    L+    ++  IW
Sbjct:  118 SPDQELLLLATAQQTLIMMTRDYEVITEQQIHQDDFGEGKFITVGWGSKDTQFHGSEGRPITFPVQMHESALSWDDHRPQITWRGDGQFFAVSVVC-------SQTGARKIRVWNREFALQSTSESVPGLGPSLAWKPSGSLIASTQDKPNQQDVVFFEKNGLLHGYFTL---PFLKDEVKVNDLLWNADSSVLAVWLEDLPKEGSSTLKSYVQLWTVGNYHWYLKQSLPFSTTGKNQIVSLLWDPVTPGRLHVLCQGWRYLCCDWHWTTDRSSGNSAD------DLAN-VAVIDGNKVLVTVFQRTVTPPPMCTYRLLIPHPVNQVMSSAHLGN--DLAVLDASNQISVYKCD-----DKPDMDSTVKLGAVG-GTGFKVPLRTPHLEKRYRIQFGNKEEEEDVSPLQFRFLTWIEGDAFLAISHS----HSSPQS--IIHHLTMAGSEGDEEQGQLNVSSSVTVDGVVIGLCCCSKTKSSAVQLADGQVLKYLWESPSSAVEPWKNSEGRPVRFARPCTQMEAAAIGGE--ECVLGLTDRC-RFFINDTEVASNITSFAVCDDFLLVTTHSHTCQCFSLSGASLKMLQAGLCGSQVPSG----EILRKVERGSRIVTVVPQDTKLILQMPRGNLEVVHHRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIHDHNPKVFLENVETFIKQIDSVNHLNLFFTELKEEDVTKTMYPPPVTKSVQVSTNPDGKKVDLICDAMRVAMETINPRKFCLSILTSHVKKTTPELDIVLQKVHELQGKIPFVPESVSAEEALKYLLLLVDVNELFNHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNTLKKMET-NYQRFTIDKYLKRYEKALGHLSKCGPEYFTECLNLIKDKNLYKEALKLYRPDSPQYQAVSVAYGEHLVQELL-YEPAGLVFARCGAHEK---ALEAFLACGSWQQALCMAAQLQMAKDKVAGLARTLAGKLVEQRKHSEAATVLEQYALDYEEAVLLLLEGSAWEEALRLVYKYDRVDIIETSVKPSILEAQKNYMDFLDSQTATFIRHKNRLKVVRELKSQRPRVHVDHEVAHGRET--DLFSETSSIRSGSEMSGRYSHSNSRISARSSKNRRKAERKKH--SLKEGSPLEGLALLEALSEVVQSIEKLKDEVHAILKVLFLFEFEEQARELQRAFESTLQLMGTALPDIW 1273          
BLAST of Elongator complex protein 1 vs. UniProt/SwissProt
Match: sp|Q7TT37|ELP1_MOUSE (Elongator complex protein 1 OS=Mus musculus OX=10090 GN=Elp1 PE=1 SV=2)

HSP 1 Score: 324.324 bits (830), Expect = 1.781e-90
Identity = 287/1105 (25.97%), Postives = 519/1105 (46.97%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKV-VSCISFNSNDDICTVVILDLDNQ-----LTHVKLFTTNNYQWYSKKTISYEKLEK---ISLFW---SSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMT-------PFEFC----VIPPPY--CAFTINFQHDVSFVSL------------PTLDNISEDGLLS---FIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSICWLENNSFYCVVNNALFLYKL-------------DQSNI-VIRKLEIGDIQVGKICYNS--HVYIQDISGQVYQYDNES----VKPLH-------KYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLS-IDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDN----GKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGEDEALPDYMSDT 3421
            SPDQ +L++ T+     +++ + +++    + Q  FG  + ++VGWG K+TQFHG  G+     V+        D + P I W+ DG YF +S +         + + R +R+++++  L STSE    L   L W+   +LIA++       ++VFFE+NGL HG F L    F  ++V V+ + +N++  +  + + DL  +      ++V+L+T  NY WY K+++ +    K   +SL W   +  RLH+      +     +   DRS        +    L N V+VIDG++VL+T       P   C    +IP P     F+ +  +D++ +              P +D+  + G +    F V           LT   + K Y       ++FG  +        A      Q++ + W+E+++F  +  +      +             +Q  + V   + +  + +G  C +    + +Q   GQV +Y  ES    V+P         ++   C +M    +  E  + +L L+ R  +F+IN    +    S       L+ T+ +   +  +L+  +L  L   L   +        E +R +E G+ I+T V   +K++L MPRGNLE ++ RALVL  ++  ++  ++ EA E MR+ R+NLNL++DHNP  F+ N+   VK+ +  + + LF +EL  EDVT+TMY      S++  T     K++ +C A+    E      +   ILT +VK T    +  LQ +++ + N     +    ++ +KYL  L+ ++EL+  +L TYD NL L VA+K+Q DPKEY+ F+N L ++   NY+RF I+ +LKR  KAL  +++    ++ E + LI   +LY +A++L+   +  Y  +S  + EHL+   +  + A +V+ R   +E    A +       W++ +  + + ++S+++       L  +L +  +  EA  + E Y +D   A  + L+G  + +A R++      D    ++   I    K Y +FL       I++   L+ +  +R      + D  +A   E+  D  S+T
Sbjct:  118 SPDQELLLLATAQQTLIMMTKDFEVIAEEQIHQDDFGEGKFVTVGWGSKQTQFHGSEGRPTAFPVQLPENALPWDDRRPHITWRGDGQYFAVSVVC-------RQTEARKIRVWNREFALQSTSESVPGLGPALAWKPSGSLIASTQDKPNQQDVVFFEKNGLLHGHFTL---PFLKDEVKVNDLLWNADSSVLAIWLEDLPKEDSSTLKSYVQLWTVGNYHWYLKQSLPFSTTGKNQIVSLLWDPVTPCRLHVLCTGWRYLCCDWHWTTDRS------SGNSANDLAN-VAVIDGNRVLVTVFRQTVVPPPMCTYRLLIPHPVNQVIFSAHLGNDLAVLDASNQISVYKCGDKPNMDSTVKLGAVGGNGFKVP----------LTTPHLEKRYS------IQFGNNEEEEEEEVNAL-----QLSFLTWVEDDTFLAISYSHSSSQSIIHHLTVTHSEVDEEQGQLDVSSSVTVDGVVIGLCCCSKTKSLAVQLADGQVLKYLWESPSLAVEPWKNSEGIPVRFVHPCTQMEVATIGGE--ECVLGLTDRC-RFFINDTEVASNITSFAVCDDFLLVTTHSHTCQVFSLSGASLKMLQAALSGSHEASG----EILRKVERGSRIVTVVPQDTKLILQMPRGNLEVVHHRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIHDHNPKVFLENVETFVKQIDSVNHINLFFTELREEDVTKTMYPPPITKSVQVSTHPDGKKLDLICDAMRAAMEAINPRKFCLSILTSHVKKTTPELEIVLQKVQELQGNLPFDPESVSVEEALKYLLLLVDVNELFNHSLGTYDFNLVLMVAEKSQKDPKEYLPFLNTLKKMET-NYQRFTIDKYLKRYEKALGHLSKCGPEYFTECLNLIKDKNLYKEALKLYRPDSPQYQAVSMAYGEHLM-QEHLYEPAGLVFARCGAQE---KALEAFLACGSWQQALCVAAQLQMSKDKVAGLARTLAGKLVEQRKHSEAATVLEQYAQDYEEAVLLLLEGSAWEEALRLVYKYDRVDIIETSVKPSILEAQKNYMDFLDSETATFIRHKNRLQVVRALRRQAPQVHVDHEVAHGPES--DLFSET 1170          
BLAST of Elongator complex protein 1 vs. TrEMBL
Match: A0A1S3H0H9 (Elongator complex protein 1 OS=Lingula unguis OX=7574 GN=LOC106150996 PE=3 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 5.226e-127
Identity = 356/1217 (29.25%), Postives = 591/1217 (48.56%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNV-VEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGF-MLYENGFCDNKVVSCISFNSNDDICTVVILDLDNQL------THVKLFTTNNYQWYSKKTISYEKLE---KISLFWSSDR---LHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVS---FVSLPTLDNIS---EDGLLS---FIVQTSDNICNWIYLTRNPISKSYE-------KLIPTQLKFGRADCLYTPISKATLQLDHQ--INSICW---------LENNSFYCVVNNALFLYKLDQSNIVIRKLEIGDIQVGKICY----NSHVYIQDISGQV--YQYDNESVKPLHK-------YSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSID-----KVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFL--SDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEV-------RLNFINGYKDLRIAGEDEALPDYMSDTIXXXXXXXXXXXXXXXXXXXXQNSSXXXXXXXXXXNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIWDDFLLRRNSIS 3775
            SPDQ ++++ T +    +++ +   LT   +   GFG  + ++VGWGKKETQFHG  GK A  +  E +      D  +P I+W+ DG +FV+S IS        +   R +R++S+D  L STSE  + LE+ L WR   NLIA+  R     ++V FE+NGL+HG F M ++    D  +++ + +N++  +  VV   L+N        ++V+L+T NNY WY K+T+ ++K +     S+ W  +    LH+ S  G++  Y      D S+  + + +         V+VIDG +VL+TPF   V+PPP CA+ I     V    F   P  + ++    DG ++   F  +  D+  N   +T +   K            +P +L    +      + +++ Q +H   I+ + W         + +NS    +  A  +   D     +R  E  +++   IC     ++HV IQ  SG +  YQ+D+  V P          +   C +M    +  E  + ++ L+ R+ + Y+N +  +    S    +  L+ T+++  LRC++ +    +       +        FDE+IR IE G+ I+T V   +K++L MPRGNLETI+PRAL+L  ++  ++   +  AIE M + R+N+NL+YDHNP+ F+ N+ K ++  +    + LF+++L  EDVT TMY   Y    + K +  D     KV+RVC A+    E    D Y   ILT +VK      D ALQ ++  K N    + ++ +++L YL+ ++ELY VAL TYD +L L VA+K+Q DPKEY+ F+N L  L   NY++F I+  LKR S AL  IA+     + E + L+  +SLY +A++LF   T  Y  I+  +  HL ++    + A ++Y +  D E    A +   K L W+  ++ + K +  E +  +    L   LK++GR  EA  I E Y+KD+  A  V ++G  + +A R++     +D    N+   +    +   NF   IE+ +  + K   RL+ V       RL  + G      A  D    D  S T     S    +S          +    K ++K  +  WS K+GS  E++ L+E L   +   + +  +I  L+ +L       ++  L    ++LL+    SI  IWD  +   N  S
Sbjct:  117 SPDQELVVLSTGNNTLIMMTKDFDPLTEVPMNPEGFGEDQFITVGWGKKETQFHGSAGKAAAVLKKEALTPALPWDDGMPCISWRGDGQFFVVSSIS-------PDTGARKLRVWSRDCVLQSTSENLDGLEHTLSWRPSGNLIASVQRKPNKYDVVLFEKNGLKHGEFTMPFQR---DEVLITELQWNNDSTVLAVVCEKLNNGAEEESSRSYVQLWTVNNYHWYLKQTLIWDKSQFDKATSILWDPEHALTLHIVSSEGNYMQYTWSFATDCSLGGSENDQAN-------VAVIDGSRVLITPFRSMVVPPPMCAYHIQLPEPVDQVVFAQHPHSERMAILMADGRIAIYNFSKEDQDSFRNKSAITHDASVKIQAGGNGFQMPCVPPRL----SGIFSAQVEESSNQSNHPLGISHLVWVNPTCILFVMPSNSGNSSLCQAELIENADNKTYTVR--ETFELEEKVICMCNCPSAHVAIQLASGSLLKYQHDSGLVLPWESLDGHEVHFPQPCMQMAVCTIGEE--EVVIGLTERY-RCYVNEMEVASNCTSFAIHESFLLLTTLSHTLRCISRSIRIKDLPSLSDGKA-----HPFDESIRRIERGSRIVTVVPDDTKLILQMPRGNLETIHPRALLLSAIRKYLDRLEFKLAIELMMKHRINMNLIYDHNPEVFLENVKKFIQLVDSPTHINLFLADLQEEDVTITMYPGIYG---RVKPMEDDDSKPVKVDRVCDAVRTALEQLNADKYFLCILTTHVKKRVPELDLALQKIKDLKGNNPVGM-NESLRHLLYLVDVNELYDVALGTYDFHLVLMVAEKSQKDPKEYLPFLNHLQSLE-SNYQKFTIDNHLKRYSSALGHIAKCGPSHFSECLTLVKDHSLYAQALQLFDKTTQEYMEIASAYGTHL-SDKKQYEDAGLMYSKAGDHEK---ALNAFVKALSWRMALIMAAKLQYEETKMNDLSRMLVTELKNAGRFTEAACILEQYIKDIEEAVVVLIEGCQWEEALRLMHKWKRTDFIESNLKAALLEKCEQQLNF---IEDTQEVFQKHKTRLVIVRKEKERQRLELLEGCGTYNDADAD-LFSDASSATGESIQSSKYTTSSQRSSVASRTSGKSSKNRRKTERKKWSLKEGSAHEDLALVEALSNYITCTEQMKDEIKSLLHMLVMFDYEDQASKLQKNFDQLLQLIERSIPTIWDGSMEGTNQTS 1289          
BLAST of Elongator complex protein 1 vs. TrEMBL
Match: K1Q1G2 (Elongator complex protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10014872 PE=4 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 2.527e-119
Identity = 343/1192 (28.78%), Postives = 585/1192 (49.08%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA-RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLD------NQLTHVKLFTTNNYQWYSKKTISYEKLEKISLFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKA---------TLQLDHQINSICWLENNS-FYCVVN------NALFLYKLDQSNIVIRKLEIGDIQVGKIC-----YNSHVYIQDISGQVYQYD--NESVKPLHKYS------TFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNS-IKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIW---DKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFR------ILAFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGE-DEALPDYMSD--TIXXXXXXXXXXXXXXXXXXXXQNSSXXXXXXXXXXNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIWDD 3748
            SPDQ IL++ T      +++ E   +T  S+    FG  E ++VGWGKKETQFHG +GKEA +   E +      D K P I+W+ DG YFV+S I             R +R+++++    STSE  + +E  L WR   +LIA++ R     ++VFFE+NGLRHG F L   G  D +V   + +NS+  +  +   D+       N  ++++L++ NNY WY K++I +E+    SL W  +   RLH+   SG +     +     S   N            LV+VIDG ++LMTPF   V+PPP  A+ +     V+ VS     N   D +L  +    D+    +Y  ++  +K     +          C  TP  +          T QL   ++ + W        C V+      + L+  K D  ++V+R   + D  V  +       +S + +Q   G V ++D  ++ + P    S         C+  ++    E    +L L+SR+ +FY+N+   +    S    K +L+ T++   +RC+               +        FDE+IR +E G+ I+T V   +K+VL MPRGNLETI+PRALVL  ++  ++   + EA+  MRR R+N+NL+YDHNPD+F+ N+   V++ N    + LF+++L  EDVT TMY   YN S + + +   +KV+ VC A+ +    +  + YI  ILT YVK +    ++AL L+R  +DN  +         +KYL +L+ ++E++ VAL TYD +L L VA+K+Q DPKEY+ F+N L  L   +Y+ + I+ +LKR S+AL+ I++  D F +E + LI+ + LY +A+ LFT G++ Y  I++L+ ++L+      + A +VY++  + +L   A D      +W++    + K + + E   +   KL  +L+++ +  +A  + E Y  D   A    ++G  + +A R       + F+          L  ++++ YE+ +  +E   + + K  +RL  VR        + + +G  ++A  D  SD  + +  S  +S+ S +   +         + ++K  +  W  K+GS  E+  LI  L + +  +  +  ++  L++++   +   E+  L       L     SI  IW D
Sbjct:  312 SPDQEILVLATGQDTLIMMTREFDPITEKSIHPDSFGAEEFVNVGWGKKETQFHGSLGKEAAKQKSEAIQAALPWDDKHPRISWRGDGQYFVVSSIC-------PNTGARKLRVWNRECGHQSTSENVDAIEQALAWRPSGSLIASTQRKPNKHDVVFFEKNGLRHGEFSL-PFGVKDVQVKELL-WNSDSTVLALWCEDMVTEDSKVNPKSYIQLWSMNNYHWYLKQSIPFEEDRVSSLTWDPEHVYRLHVLCNSGKYLQCTWHWATHSS--NN-----------ALVAVIDGSRLLMTPFRQLVVPPPMSAYYLQLPAPVNLVSFCCHGNT--DDVLVLL----DDGRVAVYRFKDIDTKEESVKLDGAGGNSFQTCCKTPKLEGIFRITGLSQTSQLSKLVHHVIWYSPEQVLLCCVDPQRSQHSTLYSCKFDGESLVVRSQTLVDGSVYTMSCDPESEDSVLAVQLTDGFVLKFDIGSDLIMPWELSSGEELSFPIPCQQMALCTIGEQR-VVLGLTSRY-RFYVNNTEIASNCTSFCVHKEYLLLTTLTHTVRCICRKTKVEVLPTLSDGKA-----HPFDESIRRVERGSRIVTVVPDDTKLVLQMPRGNLETIHPRALVLSAVRRNLDELRFLEAMTAMRRHRINMNLIYDHNPDKFLTNVQLFVQQINNVSHINLFLTDLQEEDVTCTMYTAAYNRSPVTEDSEQTNKVDTVCDALRKALLQEDENKYILCILTSYVKKSTPELEEALLLVRSLRDNPNKNAVISPADALKYLLFLVDVNEMFDVALGTYDFDLVLMVAEKSQKDPKEYIPFLNSLRRLE-GSYQHYTIDKYLKRYSRALQNISKCPDHF-DECLTLISDHHLYKEALPLFTLGSDKYKEIAKLYGKYLIEKKKP-EEAGLVYVKAEEWQL---ALDAFKSCSNWRQAFCMAAKLKYNRENEVDLGQKLANQLRNNKKYMDAAIVLEEYANDTEEAIVCLIEGCHWEEALRRMYKHTRMDFIET-------NLKPAMVENYESLMESLETMRVDFDKYRKRLKVVREEKERERLEFQESGGINDADADLFSDASSATGESIQSSKYSSSQSSAYSRSTGRTSRNRRKAEQKKWKLKEGSPYEDFALIAALSKIITAVDIMRDEVRGLVKVMIQFNSDKEASKLQETFGSFLSLIDTSIPSIWMD 1455          
BLAST of Elongator complex protein 1 vs. TrEMBL
Match: A0A3Q0G5X9 (Elongator complex protein 1 OS=Alligator sinensis OX=38654 GN=ELP1 PE=3 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 4.481e-117
Identity = 352/1203 (29.26%), Postives = 580/1203 (48.21%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA--RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISY-SKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKV-VSCISFNSNDDICTVVILDLDNQ-----LTHVKLFTTNNYQWYSKKTI---SYEKLEKISLFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDH-----------QINSICWLENNSFYCVVNNAL----FLYKLD----QSNIVIRK---LEIG-----DIQVGKICYNSH---VYIQDISGQVYQYDNESVKPLHK-----------YSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTL--SIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKI----WDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDL-KTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGEDEALPDYMSDTIXXXXXXXXXXXXXXXXXXXXQNSSXXXXXXXXXXNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIW 3742
            SPDQ +++++T      +++ + + +T   + Q  FG  + + +GWGKKETQFHG  GK+A  R  +E V   S  D   P + W+ DG +  +  +   + I  +     R +R++S++  L STSEP   LE  L W+   +LIA++       +IVFFE+NGL HG F L    F   +V V+ + +NS+  I  V + DL N+      T+V+L++T NY WY K+++   S +K + + L W S+   RLH+      +  Y  +   D S      G++        V+VIDGDKVL+T F+  V+PPP C F +     V+ V        S D      +  +DN  +        +  S  KL       G    + TP    T ++D            ++  + WL++++F  V    L     L+ L+     +   + +   L++G     D +V  +CYN     V +Q   GQ+ +Y  E+++P  +           + T C +   V +  E  D IL LS R  +F+IN +  +    S +     L+ T+ +   +CL+L +  L  L           +    E++R +E G+ ++T V   +K+VL MPRGNLETI+ R LVL  ++  ++  ++ EA E MR+ R+NLNLLYDHNP  F+ N+   +K+ +  + + LF +EL  ED T+TMY      SI Q  L  +  KV+ VC A+    E      Y   ILT YVK +    + ALQ + + ++           +  +KYL +L+ ++ELY  +L TYD +L + VA+K+Q DPKEY+ F+N L ++   NY+R+ I+  LKR  KAL  +++     + E + L+   +LY +A+ L+   T  Y  IS  + EHL  N   L + A +++ R      C  A D    +  W++ +    + + +  +    +  +  +L D  R  EA  + E Y +D   A    LDG L+ +A R++   S  D    N    I    K +  FL   +     Y K L  + E++     G  D  +A   E+  D +S+T S   +  + S  +   S  S  SSK + K ++ ++  S K+GS  E++ L+E L   VR    + G++++L++ L      +++R L  A+   L+    S+  IW
Sbjct:  118 SPDQELVLLVTGQQTLIMMTKDFEPITESLIHQDDFGEGQFIGLGWGKKETQFHGSEGKQAAHRKQME-VPLASPWDDGRPRVTWRGDGQFVAVGAVCLKTGIGRQGSLGARKVRVWSRELVLQSTSEPVPGLEQALAWKPSGSLIASTQEKPNKHDIVFFEKNGLLHGEFTL---SFQKGQVKVNELLWNSDSTILAVWLEDLQNKNCSKPSTYVQLWSTGNYHWYLKQSLHFGSSKKSQLVLLLWDSEIPYRLHVLCRGWRYLCYDWHWSTDHST-----GEESCHSAS--VAVIDGDKVLVTAFQHAVVPPPMCTFQLQLPQAVNQVMFHADPWASRD----LAIFDADNRISVYRYGECTVQDSTVKLAALG-GSGFKAAVETPCLVKTYRVDLDCCEDGEMNPLKLRLLTWLQDDTFLAVSQGKLVSQSILHHLNVAPSSAGATVEEEGILDLGLAVPVDGEVISLCYNPKTKTVALQLADGQILKYLWEALRPALEPWRNSSGSAVHFPTPCVQTALVTIDRE--DAILGLSDRC-RFFINDIEVACNITSFVTYDEFLLVTTHSHTCQCLSLKDALLKGLQASES----GISIPNSESLRKVERGSRVVTVVPQDTKLVLQMPRGNLETIHHRVLVLAQIRKWLDRLMFREAFECMRKLRINLNLLYDHNPKVFLENVETFIKQIDSVNYINLFFTELKDEDFTKTMYPSPV-GSIVQPVLCPTQKKVDLVCDAMRAAMEKINPHKYCLSILTSYVKKSTPELEVALQKVHELRETASLDTETISAEAALKYLLFLVDVNELYDHSLGTYDFDLVIMVAEKSQKDPKEYLPFLNALRKMET-NYQRYTIDKHLKRYKKALYHLSKCGSKHFSEFLNLVKDQNLYNEALHLYPTNTQEYKDISIAYGEHL--NQKHLYEQAGLIFARCG---ACERALDAFLSSGSWQQALCMVSQLDYAPNKFASLVKSMAGKLIDQRRHAEAAVLLEQYTQDYEEAVLQLLDGALWEEALRLIHKYSRQDILETNFRPAILEAQKNHLVFLNSQQTTFACYKKRLLVVRELKEQARQGLLDDEVARCPES--DLLSETGSVMMASEASSKYSHSNSRISVCSSKNRRKAERKRH--SLKEGSPLEDIALLEALGDIVRATDALKGEVHNLLKELVLFGYDAQARELQQALEEALQLMERSLPEIW 1286          
BLAST of Elongator complex protein 1 vs. TrEMBL
Match: V4A9R2 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_112482 PE=4 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 1.187e-116
Identity = 358/1199 (29.86%), Postives = 600/1199 (50.04%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA-RNVVEHVNKYSDLDSKLPIIAWK-EDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFML-YENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTHVKLFTTNNYQWYSKKTISYEKLEKIS-LFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNIS-------EDGLLSF----IVQTSDNICNWIYLTR-NPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSICWLENNSFYCVV----NNALFLYKLDQSNIVIRKLEIG---DIQ-----VGKICYNSHVYIQDISGQVYQYDNESVKPLH---------KYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYN--NSIKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDN---GKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRIL------AFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGEDEAL-----PDYMSDTIXXXXXXXXXXXXXXXXXXXXQNSSXXXXXXXXXXNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTG---DINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIWDD 3748
            SPD  +L++ T + +F +++ E   +    L+   FG AE ++VGWGKKETQFHG  GK+A +   + +    + D     I+W+ +DG YFV S+I+            R +++++++G L STSEP + L+  L W+   +LIA++ +S+   EI+FFE+NGLRHG F+L ++NG    KV   I +N +  I  V   D+++  ++V+L+T NNY WY K+++ +   E++S + W  +   RLH+ +  G++  Y  ++ +  S     D KD+      LV VIDG  VLMTPF   V+PPP  A+ +     V  V     D  S       +D  ++F    I Q  +  C  + +T       S +  +P        + L +  S+  L L H I    W++++    +      +   LYK    N    KL++    DI+     + K   + ++ +Q I G + QYD ES   L          K+ + C  +   KL  +    +L L+ R+ +FY+N++  +    S +     L+ T+++  LRC+NL     +       +        FDE+IR +E G+ I+  V    K++L MPRGNLE IYPRALVL  +++ ++   Y +A   M++ R+N+NLLYDHNP  F+ ++   +++ +    L + V+ L  EDVT TMY   Y   N  + K  S  KV+ +C +I         D ++  ILT YV+      + AL+L+++ ++N    K    ++ +KYL +L+ ++ELY VAL TYD +L L VA+K+Q DPKEY+ F+N+L  L  +NYR++ I+  L+R +KAL+ I+      + E ++LI    LYV+ ++ +   ++ Y  I+     +L+   N    A +++++  + EL   A +      +W +    +     + +   E   KL ++LK+S + REA  I E Y+KD+  A    ++G  + +A R++       F+       + + I + +++ EN    ++ + IKY     RL  VR    N  ++ R+A  +  +      D  SDT S A                  +    K +K+     W+ K+GSQ E+  LIE L    + I TVTG   DIN L++IL   +   ++  + G  + LL     SID IW +
Sbjct:   48 SPDLELLILATGEEKFILMTREYDPIIESPLQDEQFGEAEFVTVGWGKKETQFHGSAGKQAAQQKQKEITVAVEGDDCKTRISWRGDDGLYFVTSFIN-------KNTGARQLKVWTREGTLHSTSEPVDGLQQPLSWKPSGSLIASAKKSDNKQEIIFFEKNGLRHGEFILPFQNGQI--KVKELI-WNIDSSILCVWCEDIEHN-SYVQLWTVNNYHWYLKQSLMFGDKEQVSAVHWDPEHTYRLHVTTRGGNYHQY-TWTWVTNSSSGTSD-KDQA-----LVGVIDGKNVLMTPFRKMVVPPPMSAYNLTLPQFVQQVMFCLEDQYSNNIAVLLQDNTVAFYSYHISQGKE--CTGVNVTAAGGTGFSIKCQLPVFTGIYHIEGLES--SQHPLSLYHTI----WVKSDILVLITISEDGSCSTLYKT-HVNSTNNKLDVKCKTDIENHVYNISKCQASDNLVLQLIDGTLLQYDLESDSILPWVDSNGDEVKFPSPCSTLSVCKLGGQV--VVLGLTDRY-RFYVNNIEVASNCSSFIVHSEFLLLTTLSHTLRCINLHTQLKDLPSLSDGK-----EHPFDESIRRVERGSRIVLVVPDDIKLILQMPRGNLEGIYPRALVLSAVRHHLDRFEYKKAYTIMKKHRINMNLLYDHNPTLFLNHITDFIQQIDHVTDLNIIVTGLQEEDVTVTMYTAAYQQTNQKQDKKESESKVDVICDSIRSALNKLDADRFLLSILTTYVRKRKPELEAALELIQQLRENPVKNKTVSAEEALKYLLFLVDVNELYNVALGTYDFDLVLMVAEKSQKDPKEYIPFLNELRRLE-DNYRKYSIDKHLRRFNKALQHISHCGPNHFNECLKLIEDQKLYVEGLKCYPISSSEYKNIATNNGNYLLEK-NRQDEAGVMFIKAEEWEL---ALEAFITCKNWCQVFCMTALLGYTADREAEIGRKLAVQLKESRQHREAAVIFEQYVKDIEEAIVTLIEGEQWDEALRLMYRYKRQDFVETNLKPALEEKIANELESLEN----LKSDYIKYKT---RLGVVR----NTKENERLAVLEGGVGNMGDSDLFSDTSSAAGESVHSKYTYDSSRSTVFSKMTGKSRKRGSVRKWNLKEGSQFEDCALIEAL---AKIITTVTGFKEDINSLLKILVQYNYDDKASDIQGEYDELLTIIDTSIDEIWSN 1192          
BLAST of Elongator complex protein 1 vs. TrEMBL
Match: A0A210QGQ6 (Elongator complex protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15543 PE=3 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 2.764e-116
Identity = 339/1213 (27.95%), Postives = 579/1213 (47.73%), Query Frame = 2
Query:  323 TLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA-RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVS-CISFNSNDDICTVVILDLDNQL----------THVKLFTTNNYQWYSKKTISYEKLEK---ISLFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDN------ISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDH----------QINSICWLENNSF-YC----------VVNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNSH---VYIQDISGQVYQYDN--ESVKPLH-------KYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNS---IKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKAL---QLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRIL------AFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGED--EALPDYMSDTIXXXXXXXXXXXXXXXXXXXXQNSSXXXXXXXXXXNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIWDD 3748
            T SPD  +L++ T    F +++ E   +T  +L    FG A+ ++VGWGKKETQFHG VGKEA +  +E V      D +LP ++W+ DG  FV+S IS        +   R +R+++++ E  STSE  + +E  L WR   NLIA++ R     E++FFE+NGLRHG F L   G  D +V   C + +S     TV++L L++ +          T+V+++T NNY WY K+++ ++       +S+ W  +   RLH+    G +  Y        S   + D +        LV+VIDGD+VL+TP    V PPP  A+ +     V+ V+     N      I  DG +S      D+  +   L R+   K         L  G + C  TP  + T  ++             +   WL +    +C          V++ A      D+ ++ ++     +  V K+  N+    V IQ  SG V ++D   + V P          +   C  M    +  E  + ++ L+ R+ + Y+N    +    S+   K +L+ TS+    RC++      +       +        FDE++R +E G+ I+  +   +K+VL MPRGNLETI+PRALVL  ++  +++  + +A   MR+ R+NLNL+YDH P  F+ N+ K V++    D + LF+++L  ED T TMY   YN S   + + T    KV++VC  + +   ++    Y+  ILT YV+ +    + AL   + LR    + +    ++ +KYL +L+ ++E++ VAL TYD +L L VA+K+Q DPKEY+ F+N L +L   +++ + I+  LKR S AL  I++     +E    LI  + LY +A++LF   +  Y +I++L+ ++L      L+ A ++YL  N +E  R   D+    L W++    + + + S +   +   KL  ++K   +  +A  + E Y KD   A    +DG L+ +A R++       F+     + + +     M+T EN   + ++ + + +   E   + RL F+        A  D          ++I  +   +  +           + S  K ++K     W  K+GSQ E+  LI  L + ++ +  +  ++N L+ +L   H+  ++  +  A +RLL      I  IW D
Sbjct:  116 TWSPDLELLILTTGQNTFIMMTREFDPITENTLHPENFGEAKFVTVGWGKKETQFHGSVGKEAAKQKLEEVKPALPWDDQLPRVSWRGDGQLFVVSTIS-------PDTGARKLRVWNRECEHQSTSENVDGVEQALTWRPSGNLIASTLRRPNKHEVIFFEKNGLRHGEFTL-PFGVNDIQVKEMCWNLDS-----TVLMLQLEDLVQNPGGQTTPRTYVQIWTMNNYHWYLKQSLPFDGTADDKIVSVVWDPEHVYRLHIICSGGKYLQYTWSWATHFSTGISKDNQ-------ALVAVIDGDRVLLTPMRDMVTPPPMSAYYLQLPCPVNQVAFCLQGNPNNMALILADGRVSVYTFAQDS--DGKDLPRDSTVK-----FDATLGEGFSLCCQTPTHRGTYSIEGLPIDVRKVPTATHHFVWLTSELLMFCTQDRGHAQNSVLHCAELKLDADKPHLTVKSSIDIESFVYKMAVNAESGSVAIQLCSGSVLKFDPGCDMVLPWEIKSGGELTFPVPCPYMCVCDIGGE--EVVVGLTDRY-RLYVNDTEIASNCTSLAVHKDYLLLTSLTHTCRCISRQTKVQDLPTLSDGKA-----HPFDESVRRVERGSRIVCVIQGETKLVLQMPRGNLETIHPRALVLSAVRKYLDSLEFGQAFVCMRKHRLNLNLIYDHCPQSFLDNVQKFVQQVKLVDYINLFLTDLREEDCTVTMYTAAYNRSAPVVDEGTNRPSKVDKVCEVVRQALVSEDEKKYLLSILTSYVRKSTPELEAALLMVKTLRAMPSDQQTMSAEEVLKYLVFLVDVNEMFDVALGTYDFDLVLMVAEKSQKDPKEYIPFLNKLRKLE-GHFQLYTIDEHLKRYSNALGHISKCGPEHFETCKTLIQKHKLYTEALQLFPVSSEEYKSIAKLYGDYLSDKRRHLE-AGIIYL--NAEEWERALQDFQV-CLQWRQVFCMTARLKYSCDTEADIARKLAEQMKMKKQYLDAAHVLEQYAKDTEEAIVCLIDGCLWEEALRMMYKYGRTDFIETHLMEALTENYNQQMETLENCKSEFDKYKKRLAVVREEKEKARLEFLESGGAGNFADADLFSDTSSATGESIQSSRYSSESARSGRSSLYSKSSGSSVKNRRKAEHKRWKLKEGSQFEDFALIAALAKLIKMVDDMRDEMNALLRVLLQFHQYKQAADIQRAYDRLLTQMDRGIPEIWQD 1288          
BLAST of Elongator complex protein 1 vs. Ensembl Cavefish
Match: elp1 (elongator complex protein 1 [Source:ZFIN;Acc:ZDB-GENE-071116-7])

HSP 1 Score: 339.732 bits (870), Expect = 6.713e-98
Identity = 278/984 (28.25%), Postives = 475/984 (48.27%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA-RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLD-----NQLTHVKLFTTNNYQWYSKKTISY--EKLEKIS-LFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDV---SFVSLPTLDN----ISEDGLLSFIVQTSDNICNWIYLTRNPI-SKSY------EKLIPTQLKFGRADCLYTPISKAT---------LQLDHQINSICWLENNSFYCVVNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNSHVYI---QDISGQVYQYDNESVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSI----DKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQK----IWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDL 3142
            SPDQ +++  T      +++ + + +T   + Q+ FG  + ++VGWGKKETQFHG  GK+A +     V      D + P I W+ DG  F +S I         +   R +R+++++  L +TSE  N LE  L W+   +LIA+S R      +VF E+NGL HG F L    F   KV   + +NS+  +  V + D++      + T+++L+T  NY WY K+++ +  + L+  + L W  +   RLHL + + +   Y      DRS  +  D +D        V+VIDGDKVL+T F  CV+PPP C++ +     V   +F S P   N    ++ D  L            +  +++  +  K+Y      E ++  +L     + ++  ++            L+      S   LE  S   V  + + L    +S+ +  +LE G I+    C ++ V +   +D +G    +      PL    T  C +          + ++ L+ R++  YI     +    S +     L+ T+     RCL+LA  +L          +     D  E+ R +E G+ I+T V   ++++L MPRGNLETI+ RALVL  L+  +++  + +A E MR+ R+NLNL+YDHNP  F+ N+   + + +  + + LF++EL  +D T+TMY    + + +  + S      KV+ +C A+    E      +   ILT +V+ T    + ALQ + + + N   +      ++ +KYL +L++++ELY  +L TYD +L L VA+K+Q DPKEY+ F+N L  L   NY+R+ I+  LKR  KAL  +++  +  + E + L+    LY +A++L+   +  Y  +S  +AEHLV      + A ++  R    E+ R A       + W+  +  +    +  E+  +    L  +L +  R  EA  + E Y K L
Sbjct:  126 SPDQEVVVFCTGQETIILMTKDFEPITEVDIHQNEFGEGKFITVGWGKKETQFHGSEGKQAAQKKAAEVQPAVPWDDRRPRITWRGDGQLFAVSAIC-------PQTGARKVRVWNRECVLQATSEAVNGLEQPLCWKPSGSLIASSQRHPNKHSVVFMEKNGLLHGDFTL---PFAKEKVKELL-WNSDSSVLAVWLEDMNPGEDGKRNTYIQLWTVGNYHWYLKQSLHFGNDPLKAPACLCWDPEKPLRLHLLTRAWASYTYDWGWCTDRSPGD--DSQDNAN-----VAVIDGDKVLVTTFRQCVVPPPMCSYELQLPAAVNMVTFHSQPQRTNELAALTADSRLHIYAGNGKGAPGFRVVSKPSVLQKTYSVAVDQEGVLAMRLLLWLKEDVFVAVAGGDGLNQSSLLFLKPAETEGSDNRLEIRSKVEVEGHVISLCHSPKSDTLALQLEDGQIRRVH-CDSTEVTVSEWKDSTGYTVNF------PLPCVHTALCTI-------NGQEHVVGLTERYH-LYIGDSEVASNVSSFVVYDEFLLLTTHAHTCRCLHLATMSLKGETIDAALSSEATQND--ESTRRVERGSRIVTVVPQDTRLILQMPRGNLETIHHRALVLAQLRKWLDDLKFRDAFECMRKLRINLNLIYDHNPKVFLENVETFLNQIDSINNVNLFLTELKEDDTTKTMYPNPASAACQSASASGADGKKKVDTICDALRSAMETLDPLKFCLCILTSHVRKTTPELEIALQKVHELRVNPPSEKNAVSAEEALKYLLFLVNVNELYEHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNMLKTLE-PNYQRYTIDKHLKRYKKALHHLSKCGEEHFTEVLNLVKDQRLYTEALQLYPAESQQYKMLSVAYAEHLVEQ-QQAEQAGLLLWRCG--EMPR-ALQAFVSCISWRHALAVAVHIPLPPEQLAQLARDLAEKLIEVRRHAEAAVLLEQYAKVL 1069          
BLAST of Elongator complex protein 1 vs. Ensembl Cavefish
Match: elp1 (elongator complex protein 1 [Source:ZFIN;Acc:ZDB-GENE-071116-7])

HSP 1 Score: 339.732 bits (870), Expect = 7.899e-97
Identity = 262/914 (28.67%), Postives = 449/914 (49.12%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA-RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLD-----NQLTHVKLFTTNNYQWYSKKTISY--EKLEKIS-LFWSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDV---SFVSLPTLDN----ISEDGLLSFIVQTSDNICNWIYLTRNPI-SKSY------EKLIPTQLKFGRADCLYTPISKAT---------LQLDHQINSICWLENNSFYCVVNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNSHVYI---QDISGQVYQYDNESVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSI----DKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQK----IWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVY 2932
            SPDQ +++  T      +++ + + +T   + Q+ FG  + ++VGWGKKETQFHG  GK+A +     V      D + P I W+ DG  F +S I         +   R +R+++++  L +TSE  N LE  L W+   +LIA+S R      +VF E+NGL HG F L    F   KV   + +NS+  +  V + D++      + T+++L+T  NY WY K+++ +  + L+  + L W  +   RLHL + + +   Y      DRS  +  D +D        V+VIDGDKVL+T F  CV+PPP C++ +     V   +F S P   N    ++ D  L            +  +++  +  K+Y      E ++  +L     + ++  ++            L+      S   LE  S   V  + + L    +S+ +  +LE G I+    C ++ V +   +D +G    +      PL    T  C +          + ++ L+ R++  YI     +    S +     L+ T+     RCL+LA  +L          +     D  E+ R +E G+ I+T V   ++++L MPRGNLETI+ RALVL  L+  +++  + +A E MR+ R+NLNL+YDHNP  F+ N+   + + +  + + LF++EL  +D T+TMY    + + +  + S      KV+ +C A+    E      +   ILT +V+ T    + ALQ + + + N   +      ++ +KYL +L++++ELY  +L TYD +L L VA+K+Q DPKEY+ F+N L  L   NY+R+ I+  LKR  KAL  +++  +  + E + L+    LY +A++L+   +  Y  +S  +AEHLV      +   +++
Sbjct:  126 SPDQEVVVFCTGQETIILMTKDFEPITEVDIHQNEFGEGKFITVGWGKKETQFHGSEGKQAAQKKAAEVQPAVPWDDRRPRITWRGDGQLFAVSAIC-------PQTGARKVRVWNRECVLQATSEAVNGLEQPLCWKPSGSLIASSQRHPNKHSVVFMEKNGLLHGDFTL---PFAKEKVKELL-WNSDSSVLAVWLEDMNPGEDGKRNTYIQLWTVGNYHWYLKQSLHFGNDPLKAPACLCWDPEKPLRLHLLTRAWASYTYDWGWCTDRSPGD--DSQDNAN-----VAVIDGDKVLVTTFRQCVVPPPMCSYELQLPAAVNMVTFHSQPQRTNELAALTADSRLHIYAGNGKGAPGFRVVSKPSVLQKTYSVAVDQEGVLAMRLLLWLKEDVFVAVAGGDGLNQSSLLFLKPAETEGSDNRLEIRSKVEVEGHVISLCHSPKSDTLALQLEDGQIRRVH-CDSTEVTVSEWKDSTGYTVNF------PLPCVHTALCTI-------NGQEHVVGLTERYH-LYIGDSEVASNVSSFVVYDEFLLLTTHAHTCRCLHLATMSLKGETIDAALSSEATQND--ESTRRVERGSRIVTVVPQDTRLILQMPRGNLETIHHRALVLAQLRKWLDDLKFRDAFECMRKLRINLNLIYDHNPKVFLENVETFLNQIDSINNVNLFLTELKEDDTTKTMYPNPASAACQSASASGADGKKKVDTICDALRSAMETLDPLKFCLCILTSHVRKTTPELEIALQKVHELRVNPPSEKNAVSAEEALKYLLFLVNVNELYEHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNMLKTLE-PNYQRYTIDKHLKRYKKALHHLSKCGEEHFTEVLNLVKDQRLYTEALQLYPAESQQYKMLSVAYAEHLVEQQQAEQAGLLLW 1003          
BLAST of Elongator complex protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009319.1 (pep scaffold:Pmarinus_7.0:GL476696:206113:223182:-1 gene:ENSPMAG00000008423.1 transcript:ENSPMAT00000009319.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.846 bits (538), Expect = 1.941e-57
Identity = 179/622 (28.78%), Postives = 284/622 (45.66%), Query Frame = 2
Query: 1955 NFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTL-----------SIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDN-----------GKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRI-AGEDEALP-DYMSDTIXXXXXXXXXXXXXXXXXXXXQNSSXXXXXXXXXXNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIW 3742
            +   DET+R +E G+ I+  V S  ++VL MPRGNLETI PRAL+L  ++  +++  + EA E M++QR+NLNLLYDHNP  FM N+ + + +      + LF++EL  EDV  TMY   Y  +    T            S  KVN VC  +    E    D +   ILT  V+      + AL  +R   +              ++   + + YL  L+   ELY  AL TYD  L L VAQ++Q DPKEY+ F+N+L ++   NY+R+ I+  LKR  KAL  ++      + E + L+ + +LY +A+ LF  G   Y  +S  F  HL+        A +V+ R     L + A         W++ + A+ +      E       +  +L    +  EA  + E Y +D   A     +G  + +A R++   +  D    N+ K      K +   +  +      + + + RL  VR +      DL    G DE    D  SD  S ASS    S  +   S  S  SSK + K  + +   S ++GS  EE  L++ +    R +   T ++  L+ +L      +E + L   ++ LL     ++  +W
Sbjct:   54 DLPGDETVRRVERGSRIVALVPSDCRLVLQMPRGNLETIQPRALLLSQVRKWLDSLKFKEAFECMKKQRINLNLLYDHNPKAFMDNIGEFLTQAQSAGNVNLFLTELRDEDVARTMYPVPYGWAQPPATAATAATEPFVARSTGKVNAVCDGLRAAMEALDPDRFFLSILTALVRRKEPDVETALMRVRDVAERAAEGAGDGGAEEAERRAQEALGYLLLLVDEGELYECALGTYDFRLVLMVAQRSQKDPKEYLPFLNELKKMET-NYQRYSIDNHLKRYGKALVHLSRCGPDRFPELLSLVRSRALYREALRLFPCGGEEYTALSEAFGRHLLEERRQGAEAGLVFARAA---LWQAALPAFRDAGCWRQALCAATRLGYPALELTRLARDMAEKLAAQRKHVEAACLLEQYAEDHEEAVVTLTEGGAWEEAMRLIHKHNRLDLLETNL-KPAVKEDKAHGQQVAGVRAQAALFERHVARLAVVRADKERARLDLLADGGNDEGAECDLYSDASSVASSGVLGSKYSQSNSRISGRSSKNRRKAARKR--LSLREGSPSEEPALLDAIGDIARAVDARTAEVGPLLRMLLLFDWEAEGQELQAELSSLLLRVERALPEVW 668          
BLAST of Elongator complex protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005950.1 (pep scaffold:Pmarinus_7.0:GL492210:1447:4189:1 gene:ENSPMAG00000005382.1 transcript:ENSPMAT00000005950.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 6.090e-10
Identity = 27/70 (38.57%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNK 538
            SPDQ ++++ T       ++ +   LT   + Q  FG A+ ++VGWG+KETQFHG  GK+A +  + VN 
Sbjct:  118 SPDQDVMVLTTGADTIIAMTRDFDPLTEVPMHQDDFGEAKFVTVGWGQKETQFHGSEGKQAAHKKQEVNA 187          
BLAST of Elongator complex protein 1 vs. Ensembl Yeast
Match: IKI3 (Subunit of Elongator complex; Elongator is required for modification of wobble nucleosides in tRNA; maintains structural integrity of Elongator; homolog of human IKAP, mutations in which cause familial dysautonomia (FD) [Source:SGD;Acc:S000004376])

HSP 1 Score: 172.94 bits (437), Expect = 5.730e-44
Identity = 112/336 (33.33%), Postives = 185/336 (55.06%), Query Frame = 2
Query: 1967 DETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSI------------------KQKTL--SIDKVNRVCSAIAEMF--ENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNE-LPCENYRRFKINIFLKRPSKALEFIAEV--ADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVAN 2899
            DE +R IE G+ +++ + S S +VL   RGNLETIYPR +VL +++  +    Y EA    R  R+NL++L+D+ P+ F+ NL   + +  R D L LF+S LS +DVT+T YK    + I                  K+K       KVN++C A+  +     ++   Y+  I+T Y    P     AL+L+ +  +N ++K  D  + YL +L  ++ +Y+ ALS YD++L L VAQK+Q+DP+EY+ F+ +L +  P    R+F I+ +L    KALE ++E+       EE ++ + ++ LY   + L+ Y +   N I  ++A+HL +N
Sbjct:  705 DERVRAIERGSILVSVIPSKSSVVLQATRGNLETIYPRIMVLAEVRKNIMAKRYKEAFIVCRTHRINLDILHDYAPELFIENLEVFINQIGRVDYLNLFISCLSEDDVTKTKYKETLYSGISKSFGMEPAPLTEMQIYMKKKMFDPKTSKVNKICDAVLNVLLSNPEYKKKYLQTIITAYASQNPQNLSAALKLISEL-ENSEEK--DSCVTYLCFLQDVNVVYKSALSLYDVSLALLVAQKSQMDPREYLPFLQELQDNEPLR--RKFLIDDYLGNYEKALEHLSEIDKDGNVSEEVIDYVESHDLYKHGLALYRYDSEKQNVIYNIYAKHLSSN 1035          

HSP 2 Score: 132.109 bits (331), Expect = 2.388e-31
Identity = 92/330 (27.88%), Postives = 155/330 (46.97%), Query Frame = 2
Query:  335 DQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGK------------------VGKEARNV----VEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEA----QTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCR-----SNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTHVKLFTTNNYQWYSKKTISYEKLEKISLFWSSDRLHLCSESGSHSIYQL-YSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPP 1228
            D+  L ++T D    +LS   + ++ + LE      ++ ++VGWGKKETQF GK                  VG + R+     +      + LDS    I+W+ D DYF +S  S  ++ +E +     + R  R+FS++G+L S SEP   +E+ L W+ + +LIA+  R         ++++FFE+NGLRHG F   +     ++ V  + +NSN +   VV+ +       ++L+T+ NY WY K+ +    +  +      D   + S++G  +I    Y       +E FD             V+DG  V +TP     +PPP
Sbjct:  153 DEETLAMVTKDRNVVVLSKLFEPISEYHLEVDDLKISKHVTVGWGKKETQFRGKGARAMEREALASLKASGLVGNQLRDPTMPYMVDTGDVTALDSHEITISWRGDCDYFAVS--SVEEVPDEDDETKSIKRRAFRVFSREGQLDSASEPVTGMEHQLSWKPQGSLIASIQRKTDLGEEDSVDVIFFERNGLRHGEF---DTRLPLDEKVESVCWNSNSEALAVVLAN------RIQLWTSKNYHWYLKQELYASDISYVKWHPEKDFTLMFSDAGFINIVDFAYKMAQGPTLEPFDNGTSL--------VVDGRTVNITPLALANVPPP 463          
BLAST of Elongator complex protein 1 vs. Ensembl Nematostella
Match: EDO37251 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD5])

HSP 1 Score: 292.738 bits (748), Expect = 1.700e-81
Identity = 269/1058 (25.43%), Postives = 491/1058 (46.41%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEH-VNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDL---DNQ----LTHVKLFTTNNYQWYSKKTISYEKL--EKISLF-WSSD---RLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQ---HDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYT---PISKATLQLDHQINSICWLENNSFYCVVNNALFLYKL-----------DQSNIVIRKLEIGDIQVGKICYN---SHVYIQDISGQVYQYDNE-----------SVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDR-FMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLS-IDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFK----DNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLS--DCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVR 3343
            SPD  +++  T +    +++ +   +T F +  + FG  EP++VGWGKKETQFHG  GK +   ++  V      D     I+W+ DG YFV+S I       E     R +R++S++G L ++SE  + LE  L W+   +LIA++ R     ++VFFE+NGLRHG F L      + KV+  + ++++  +  + I ++   D Q     ++++L+T NNY WY K+ +++     ++++ F W  +   +LHL +  G ++ Y+               +  +    + V+VIDG  +L+TP ++ V+PPP  A T+        V+F   P  ++      ++ ++ + D     I + R P + +  + IP      R   +Y+   P      +    ++ + W  ++    VV NA+   +              + +V+  +   D    ++  N     + IQ +SG + +Y+++            +         C +M   ++ ++  + IL L+S + + Y +    +    S       L+ ++     RC++L  ++    + L D    K N   DE+IR +E G++I+  V   +K++L +         P  L  D    ++   +Y E +  M   RV +        +R F+ N+   +K+      + LF+S+L  ED T TMY  FY  + K+ + S   K++ VC A  E  +N   + Y+  IL  Y K T    +  L ++R  K    D       ++ +KY+ +L+ +++++ VAL  YD  L L VA+K+Q DPKEY+ F+N+L ++   NY+R+ I+  LKR +KA++ ++      + E V L+   SLY +A++L++  T  Y  IS  + +HL       + A +V+ R         A +   +   W+     S + E +EE+  E    +   LK+  R  EA  + E Y KD   A    LDG  + +A R++   +  D    N+   +    ++  +   Q  EN  KY + L  + E +
Sbjct:  118 SPDLELVVFTTGENTVIMMTKDFDPITEFPIHTAEFGQDEPINVGWGKKETQFHGSAGKPSTETLKPTVTPSFPWDDHHCRISWRGDGQYFVVSAI-------EPATDARKLRVWSREGVLMTSSEEVDGLEQSLCWKPSGSLIASTQRKPHRHDVVFFERNGLRHGEFTLPFQRM-EVKVIE-MQWSTDSTVLAIRIEEMLPEDRQNAIPRSYIQLWTVNNYHWYLKQELAFPASASDRVACFSWDPENALKLHLITGGGQYASYEW-------TWSTLHSQSHSTHNISTVAVIDGANLLLTPMKYMVVPPPMAAQTVAMPAAIQSVTFAPPPACND------MAVLLSSGD-----IAILRMPSAPA--EFIPPG-SPPRLQGVYSIIDPDLPGLWRGPGALHHVTWWRDDKLVGVVWNAMSQSEALCEITIKDKGEGGTELVVSHVTELDEPAMRVTSNPDTGSLAIQLVSGVILKYNSDKDGARVSQWLNEIGQQVSLPQTCVQMRIAQIGNK--EIILGLTSHY-RLYADDKEVATNCTSFAVHDEFLLLSTHAHTCRCISLLPSSQGLPVLLED----KPNA-LDESIRRVERGSQIVVAVTQDTKVILQV-SAEFNHSLPLILNPDVNYRVLSGTIYRE-LYYMESARVRILFTSSAKNERLFLANIETFLKQVESVAFINLFLSDLRDEDTTITMYGDFYPCATKRGSSSDKTKIDTVCDACREALQNLGKEKYLLSILMSYAKKTEPELETVLSIIRDLKNKQVDTSLGVTSEEALKYVLFLVDVNQMFDVALGMYDFQLVLMVAEKSQKDPKEYLPFLNNLRQMET-NYQRYMIDKHLKRFTKAIKNLSLCGSEHFHELVTLVKEKSLYKEALKLYSKTTKEYQDISICYGKHLFEK-KKYEEAGIVFSRVGAHSQ---ALEAFQRCCSWRHAFCVSSQLEETEEKKMERARGMAAYLKEHHRFTEAATVLEDYAKDPEEAIVSLLDGSEWDEALRMIYKHNRVDIIETNLKPALVEGCRSERSITAQHSENFTKYKERLHIVRETK 1130          
BLAST of Elongator complex protein 1 vs. Ensembl Nematostella
Match: EDO27313 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9L1])

HSP 1 Score: 73.9442 bits (180), Expect = 3.819e-14
Identity = 51/183 (27.87%), Postives = 87/183 (47.54%), Query Frame = 2
Query: 2354 KVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFK----DNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHL 2890
            K++ VC A  E  +N   + Y+  ILT Y K T    +  L ++R  K    D       ++ +KY+ +L+ +++++ VAL  YD  L L VA+K+Q   K      +D N   C   +R      +    + L   ++     + E V L+   SLY +A++L++  T  Y  IS  + +HL
Sbjct:    8 KIDTVCDACREALQNLGKEKYLLSILTSYAKKTEPELETVLSIIRDLKNKQADTSLGVTSEEALKYVLFLVDVNQMFDVALGMYDFQLVLMVAEKSQKSTKRRKNR-SDANNNCC---KRHMTRTVIPSSKRDLRVWSKPGSEHFHELVTLVKEKSLYKEALKLYSKTTKEYQDISICYGKHL 186          
BLAST of Elongator complex protein 1 vs. Ensembl Nematostella
Match: EDO37252 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD6])

HSP 1 Score: 44.669 bits (104), Expect = 5.705e-6
Identity = 21/57 (36.84%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  569 IAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWR 739
            I+W+ DG YFV+S I       E     R +R++S++G L ++SE  + LE  L W+
Sbjct:   19 ISWRGDGQYFVVSAI-------EPATGARKLRVWSREGVLMTSSEEVDGLEQSLCWK 68          
BLAST of Elongator complex protein 1 vs. Ensembl Medaka
Match: elp1 (elongator complex protein 1 [Source:NCBI gene;Acc:101168380])

HSP 1 Score: 343.969 bits (881), Expect = 3.808e-98
Identity = 283/1056 (26.80%), Postives = 495/1056 (46.88%), Query Frame = 2
Query:  329 SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEA-RNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKV-VSCISFNSNDDICTVVILDLDNQ-----LTHVKLFTTNNYQWYSKKTISYEKLEK---ISLFWSSDR---LHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHD---VSFVSLP----TLDNISEDGLLSFIV----QTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSICWLENNSFYCVV------NNALFLYKLDQSNIVIRKLEIGDIQVGKICY---NSHVYIQDISGQVYQYDNESVKPLHK-----------YSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLS-IDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKG----IKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAF--LSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVR 3343
            SPD+ ++++ T      +++ + + +T   + Q  FG  + ++VGWGKKETQFHG  GK+A +  ++ V      D + P + W+ DG  F +S I         +   R +RI+S++G L +TSE  N LE  L W+   +L+ +S R      +VF E+NGL HG F L    F  ++V V  + +N +  +  V + D+  +      ++++L+T  NY WY K+++ + +  +    S+ W  +R   LH+ + S +   Y      DRS      G D T      V+VIDGD++L+T F   V+PPP  +F +    +   V+F+  P     L  ++ DG +        + +D   +   +   P+      ++   L+      +  P   A  QL        WL++  F CV       ++AL L + +   + +R     +  V  + +      V +Q   G++ +      +P  +           +   C +    ++  E  + +L LS R +  Y      +    S       L+ T+ +   RCL L+   L  L   L     +     DET R +E G+ I+T V   ++++L MPRGNLE+I+ RALVL  ++  ++   + EA E MR+ R+NLNL+YDHNP  F+ N+   + + +    + LF++EL  ED T +MY       ++  + S   KV+ V  A+ +  E+     +   ILT +VK +    + ALQ + + + N        G    +KYL +L+++++LY  +L TYD +L L VA+K+Q DPKEY+ F+N L  L   +Y+R+ I+  LKR  KAL  +++  +  + E ++L+T   LY +A+ LF   +  +  ++  +AE+LV      + A ++  R    EL R A      +  W+  I  +++  +  ++       L  +L +  R  EA  + + Y KD   A    + G  + +A R++      D +  N+   +     +   FL   E   + + +   RL  VR
Sbjct:  118 SPDEELVLLTTGQETVVMMTKDFEPITEVGIHQDDFGEGKFITVGWGKKETQFHGSEGKKAAQRKIQEVEPAVAWDDRRPRVTWRGDGQLFAVSAIC-------PQTGARKVRIWSREGVLQATSELINGLEQALCWKPSGSLLTSSQRQPNKHSVVFLEKNGLLHGDFTLP---FAKDRVKVKELLWNGDSTVLGVWLEDVTAEGGGGGSSYIQLWTVGNYHWYLKQSLDFGRDPQKAPASVCWDPERPLRLHVVTRSWTCITYDWSWTTDRSA-----GSDATDNAN--VAVIDGDRILVTTFRQTVVPPPMSSFQLQSTSNINQVAFLCRPGGFNQLAALTSDGQVCLYTPDAGEAADGSADGFRVASRPL------VLHKTLRLA----VDEPAPLALRQL-------LWLQDELFACVTAGLLPGSSALLLLRPEGDALAVRARVEVEGVVVGVTHCPQTGTVALQLQDGRIRRLLWGGAEPSVEEWRDSSGCSIDFPASCAQTALCRIGRE--EQLLGLSDR-SHLYAGDTELASNVSSFAVCNDFLLLTTHSHCCRCLRLSALTLKGLQAALASDGDQ----NDETFRRVERGSRIVTVVPQDTRVILQMPRGNLESIHHRALVLAQIRKWLDGLRFREAFECMRKLRINLNLMYDHNPKVFLENVETFITQLDSISHINLFLTELKEEDTTSSMYPPPEGGPVQTSSGSGPKKVDVVSEALLKAMESMDPHKFCLSILTAHVKKSVPELEVALQKVHELRVNPPGAPGAVGAEEALKYLLFLVNVNDLYEHSLGTYDFDLVLMVAEKSQKDPKEYLPFLNKLKSLE-PHYQRYTIDRHLKRYRKALLHLSKCGEQHFPEVLQLVTEQQLYGEALRLFAAHSPQHKALTGAYAEYLV-EQQQAEQAGLLLWRCG--ELVR-ALQAFTSSSSWRNAICVAQEIPLPPDQLALLARDLAEKLTEQRRYSEAALLLDQYAKDCEEAILALITGAAWEEALRLVHVHNRQDITETNLKPALLEAFSSQTAFL---ETQTVTFVRHRSRLAVVR 1124          
BLAST of Elongator complex protein 1 vs. Planmine SMEST
Match: SMESG000075698.1 (SMESG000075698.1)

HSP 1 Score: 2439.45 bits (6321), Expect = 0.000e+0
Identity = 1274/1274 (100.00%), Postives = 1274/1274 (100.00%), Query Frame = 2
Query:  104 DYNDGLFCMTINSIIVSSGKDIKDVISYDFNEYLKIQNGLSLYCANKSSLISFDNYNGMQLXXXXXXXXXXXXTLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTHVKLFTTNNYQWYSKKTISYEKLEKISLFWSSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSICWLENNSFYCVVNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNSHVYIQDISGQVYQYDNESVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCXXXXXXXXXXXXXXXXXXXYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASXXXXXXXXXXXXXXXXXCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGEDEALPDYMSDTIXXXXXXXXXXXXXXXXXXXXQNSSXXXXXXXXXXNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIWDDFLLRRNSISWDNEVQISNHIQICRSEQFAGRRRYLLDEEFLKSSPPMITLSVTSHIGAL 3925
            DYNDGLFCMTINSIIVSSGKDIKDVISYDFNEYLKIQNGLSLYCANKSSLISFDNYNGMQLDSIEFSDDIIDFTLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTHVKLFTTNNYQWYSKKTISYEKLEKISLFWSSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSICWLENNSFYCVVNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNSHVYIQDISGQVYQYDNESVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCLNLAENNLNDLINLLDEKNYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASKKSEISEEETKETLIKLCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGEDEALPDYMSDTISEASSVNSRSSINSRMSIGSQNSSKFKLKKKKVKNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIWDDFLLRRNSISWDNEVQISNHIQICRSEQFAGRRRYLLDEEFLKSSPPMITLSVTSHIGAL
Sbjct:   26 DYNDGLFCMTINSIIVSSGKDIKDVISYDFNEYLKIQNGLSLYCANKSSLISFDNYNGMQLDSIEFSDDIIDFTLSPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKETQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKIRNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSNKGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDLDNQLTHVKLFTTNNYQWYSKKTISYEKLEKISLFWSSDRLHLCSESGSHSIYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPPYCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPISKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSICWLENNSFYCVVNNALFLYKLDQSNIVIRKLEIGDIQVGKICYNSHVYIQDISGQVYQYDNESVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYLSILPLKHHLICTSVNQKLRCLNLAENNLNDLINLLDEKNYKCNFDFDETIRLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLYTEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELSPEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLILTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRVALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKRPSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLFAEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASKKSEISEEETKETLIKLCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRLFTDAFRILAFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLERLIEVRLNFINGYKDLRIAGEDEALPDYMSDTISEASSVNSRSSINSRMSIGSQNSSKFKLKKKKVKNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDINDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIWDDFLLRRNSISWDNEVQISNHIQICRSEQFAGRRRYLLDEEFLKSSPPMITLSVTSHIGAL 1299          
The following BLAST results are available for this feature:
BLAST of Elongator complex protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ELP12.119e-10827.87elongator complex protein 1 [Source:HGNC Symbol;Ac... [more]
ELP13.249e-6827.09elongator complex protein 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
elpc-19.111e-2224.08Elongator complex protein 1 [Source:UniProtKB/TrE... [more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Elp12.126e-5431.89gene:FBgn0037926 transcript:FBtr0335448[more]
Elp12.379e-5431.89gene:FBgn0037926 transcript:FBtr0082420[more]
Elp15.518e-5433.91gene:FBgn0037926 transcript:FBtr0335447[more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
elp18.424e-5932.93elongator complex protein 1 [Source:ZFIN;Acc:ZDB-G... [more]
elp18.424e-5932.93elongator complex protein 1 [Source:ZFIN;Acc:ZDB-G... [more]
elp14.280e-5633.59elongator complex protein 1 [Source:ZFIN;Acc:ZDB-G... [more]
elp12.705e-1331.72elongator complex protein 1 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elp11.005e-10928.37elongator complex protein 1 [Source:NCBI gene;Acc:... [more]
elp11.636e-10128.88elongator complex protein 1 [Source:NCBI gene;Acc:... [more]
elp12.649e-10029.00elongator complex protein 1 [Source:NCBI gene;Acc:... [more]
elp11.147e-9928.98elongator complex protein 1 [Source:NCBI gene;Acc:... [more]
elp19.604e-9929.14elongator complex protein 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Elp12.546e-9125.97elongator complex protein 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Elongator complex protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95163|ELP1_HUMAN1.018e-10727.87Elongator complex protein 1 OS=Homo sapiens OX=960... [more]
sp|Q8WND5|ELP1_RABIT2.035e-10727.80Elongator complex protein 1 OS=Oryctolagus cunicul... [more]
sp|Q2TAQ1|ELP1_XENLA8.766e-10229.07Putative elongator complex protein 1 OS=Xenopus la... [more]
sp|Q8VHU4|ELP1_RAT1.474e-9827.18Elongator complex protein 1 OS=Rattus norvegicus O... [more]
sp|Q7TT37|ELP1_MOUSE1.781e-9025.97Elongator complex protein 1 OS=Mus musculus OX=100... [more]
back to top
BLAST of Elongator complex protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H0H95.226e-12729.25Elongator complex protein 1 OS=Lingula unguis OX=7... [more]
K1Q1G22.527e-11928.78Elongator complex protein 1 OS=Crassostrea gigas O... [more]
A0A3Q0G5X94.481e-11729.26Elongator complex protein 1 OS=Alligator sinensis ... [more]
V4A9R21.187e-11629.86Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A210QGQ62.764e-11627.95Elongator complex protein 1 OS=Mizuhopecten yessoe... [more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
elp16.713e-9828.25elongator complex protein 1 [Source:ZFIN;Acc:ZDB-G... [more]
elp17.899e-9728.67elongator complex protein 1 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009319.11.941e-5728.78pep scaffold:Pmarinus_7.0:GL476696:206113:223182:-... [more]
ENSPMAT00000005950.16.090e-1038.57pep scaffold:Pmarinus_7.0:GL492210:1447:4189:1 gen... [more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
IKI35.730e-4433.33Subunit of Elongator complex; Elongator is require... [more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO372511.700e-8125.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273133.819e-1427.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372525.705e-636.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Elongator complex protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
elp13.808e-9826.80elongator complex protein 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Elongator complex protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000075698.10.000e+0100.00SMESG000075698.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024101 ID=SMED30024101|Name=Elongator complex protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3928bp
GATTTTTTTAAGTCACAATTATTGAAAAATGAAGAATTTGAAGTTATTAA
ATCAAATAATTTGTAACCTCAATAGCAATGTACTGTCATCTTGCTTATCA
AATGATTATAATGATGGATTATTTTGTATGACTATAAATTCTATAATTGT
TAGCAGCGGGAAAGACATAAAAGATGTTATTTCTTATGATTTTAATGAAT
ATTTAAAAATCCAAAATGGTTTATCCTTATATTGCGCTAATAAAAGTTCG
TTAATTTCGTTTGACAATTACAACGGGATGCAATTGGATTCCATTGAATT
TTCTGATGATATAATTGATTTTACCCTTTCACCCGATCAATCAATTTTAA
TGGTTTTAACTAGTGATATGCAATTTACTATTCTTTCCAACGAATGTCAA
ATTTTGACAAGTTTTAGTCTTGAACAATCTGGTTTTGGTACAGCCGAGCC
ATTATCCGTTGGTTGGGGGAAGAAAGAAACACAATTTCATGGAAAAGTAG
GAAAGGAAGCAAGAAATGTAGTCGAACACGTTAATAAATATTCTGATCTC
GATTCTAAATTGCCGATCATAGCATGGAAAGAAGATGGGGATTATTTTGT
TATAAGCTGGATCAGTTATTCTAAGATTCGAAATGAATCTGAAGCACAAA
CAAGAATGATGAGAATTTTCAGTAAAGACGGAGAATTGTTTTCTACATCT
GAACCTACAAATGTTCTGGAAAACGGATTGTTTTGGAGGACCAAATCCAA
TTTGATTGCCACCAGTTGCAGAAGTAATAAGGGATTAGAAATCGTATTCT
TTGAACAAAATGGTCTTCGTCACGGAGGATTTATGTTATACGAAAACGGA
TTTTGTGATAACAAGGTCGTCTCGTGCATAAGCTTCAATTCCAATGATGA
TATTTGCACAGTTGTGATTCTAGATCTTGATAACCAGCTCACACATGTCA
AATTATTTACCACCAATAACTATCAATGGTATTCAAAGAAAACAATATCA
TATGAAAAGCTAGAAAAAATTTCTCTATTTTGGTCATCGGATCGATTGCA
TTTGTGTTCAGAAAGTGGCAGTCATAGCATTTATCAATTATATTCGGAAA
TCGATAGAAGCATCGTAGAAAACTTTGATGGAAAAGACAAAACTTTCAAA
TTACCGAATTTAGTCAGTGTTATTGATGGGGATAAAGTCTTGATGACACC
ATTTGAATTTTGTGTCATCCCTCCACCGTATTGTGCCTTTACGATAAATT
TCCAACACGATGTTTCGTTTGTCTCACTCCCTACTCTTGATAATATCAGT
GAGGATGGACTATTGTCATTCATCGTACAAACGTCTGATAACATCTGCAA
TTGGATTTATCTTACAAGAAATCCTATTTCCAAATCTTATGAGAAACTTA
TTCCAACACAGTTGAAATTCGGAAGAGCTGATTGTCTTTACACGCCAATA
TCGAAAGCTACTTTGCAGCTGGATCATCAAATTAACTCTATTTGTTGGTT
GGAAAATAACTCTTTTTATTGTGTTGTCAACAATGCTCTTTTCCTCTACA
AATTGGACCAATCAAATATCGTAATAAGAAAATTGGAAATCGGCGACATT
CAAGTTGGAAAAATCTGTTATAACAGTCATGTGTATATACAAGATATTTC
AGGACAAGTCTATCAATATGATAACGAGTCAGTCAAACCTTTACATAAAT
ATTCTACATTTTGTTGTGAAATGTTCTCAGTGAAATTGAAATCCGAATCC
AACGATACAATTTTGGCATTATCGAGTAGATTTAACCAATTCTATATCAA
TTCTGTATCTCAGTCAGGGACTTATCTATCGATTTTACCCCTAAAACATC
ACCTCATCTGTACAAGTGTGAATCAAAAGCTACGTTGCCTAAACCTGGCT
GAAAATAATTTGAATGATCTCATTAATCTATTGGATGAAAAGAACTATAA
GTGCAATTTTGATTTCGATGAGACAATTAGATTAATTGAACCGGGAACAG
AAATAATCACTTGTGTAATATCACATTCAAAAATTGTCCTAATGATGCCA
CGGGGAAATCTGGAAACAATTTATCCAAGAGCATTAGTTTTAGATGATCT
GAAAAATCTCATGGAAAATTGTCTCTATACTGAAGCTATTGAAAAAATGA
GACGACAGCGGGTCAATCTCAATCTATTGTATGATCACAATCCCGATAGG
TTCATGTTTAATTTGGCTAAGCTGGTTAAAGAAAATAATAGAAATGATCG
ACTGGTATTATTTGTATCAGAATTGTCTCCGGAAGATGTTACTGAAACAA
TGTATAAAAGATTTTATAATAATTCCATTAAGCAGAAAACGTTATCAATA
GATAAAGTTAATAGAGTTTGTTCAGCTATTGCTGAAATGTTCGAAAACGA
TTTTAATGATGATTATATTAACCTTATTCTAACTTGCTATGTAAAAATGA
CTCCTACAGCCTCTGACAAAGCTTTGCAACTGCTGCGAAAATTTAAAGAT
AATGGTAAGCAAAAGATCTGGGATAAAGGCATAAAGTATTTACAGTATCT
GATTTCAATTGACGAGCTGTATCGCGTTGCTTTATCAACTTATGATCTTA
ATCTCACCCTCAAAGTAGCTCAAAAAACTCAGCTAGATCCTAAAGAATAT
GTCACATTTATTAACGATTTAAACGAATTACCTTGTGAAAATTACCGAAG
ATTTAAAATAAACATTTTCCTAAAGCGCCCATCTAAGGCACTGGAATTTA
TTGCTGAAGTCGCTGACTTGTTCTGGGAAGAAACCGTTGAATTGATAACA
GCTAATAGTCTTTACGTCAAAGCAATCGAATTATTTACTTACGGCACAAA
TCACTACAATACAATCAGCAGACTGTTTGCCGAGCATTTGGTAGCTAATA
CTAATGATTTGAAGACAGCTGCAATGGTTTATTTGAGAACAAATGATAAA
GAGTTGTGTAGAATTGCTGCCGATTACCTTTTCAAAACTCTTCATTGGAA
AGAGTGGATAATGGCTTCGAAAAAATCTGAAATTAGTGAAGAAGAAACCA
AAGAAACTCTTATCAAACTCTGTATAAGATTGAAAGATTCCGGGCGACAG
AGAGAAGCCCTATTTATCAATGAGGTGTATTTGAAGGATTTATATAGTGC
TTTCAATGTCGCACTCGATGGCAGATTATTCACTGATGCTTTCAGAATAT
TGGCTTTTCTTTCTGATTGCTCCGGCGACAACATGGGAAAATTGATTACC
TCTGTAATGAAAACCTACGAAAATTTCCTCATACAAATTGAGGAAAACGA
AATCAAGTATTCTAAAGATCTGGAAAGACTTATTGAAGTTCGTTTGAATT
TCATAAACGGATATAAAGATCTGAGGATTGCCGGAGAAGATGAAGCCCTT
CCCGACTACATGTCAGACACAATCAGTGAGGCCAGCTCTGTCAATTCCAG
ATCATCAATCAATTCCAGAATGTCGATCGGATCGCAGAATTCCTCGAAAT
TTAAATTGAAAAAGAAAAAAGTGAAAAATCCTTGGTCAGACAAGAAAGGA
AGCCAAAAGGAAGAAGTCGGCCTTATTGAGAATCTTTATCGTAGCGTTAG
GCACATTCAAACCGTAACGGGCGATATTAATGATTTGATCGAAATTCTCA
GTTTTATTCATAGAGCGAGCGAATCGAGATTGCTACTAGGAGCGATCAAT
AGACTGTTAAAGTTCCAACTCGATTCGATCGATATAATTTGGGATGATTT
CCTTCTGAGAAGAAATTCGATTTCATGGGATAATGAAGTGCAAATATCCA
ATCACATCCAAATCTGTCGATCGGAGCAATTCGCTGGCAGACGGAGATAT
TTATTAGATGAGGAGTTTTTGAAATCGTCTCCACCAATGATTACATTGTC
CGTGACGAGTCACATTGGAGCTTTGTGA
back to top

protein sequence of SMED30024101-orf-1

>SMED30024101-orf-1 ID=SMED30024101-orf-1|Name=SMED30024101-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1300bp
MKNLKLLNQIICNLNSNVLSSCLSNDYNDGLFCMTINSIIVSSGKDIKDV
ISYDFNEYLKIQNGLSLYCANKSSLISFDNYNGMQLDSIEFSDDIIDFTL
SPDQSILMVLTSDMQFTILSNECQILTSFSLEQSGFGTAEPLSVGWGKKE
TQFHGKVGKEARNVVEHVNKYSDLDSKLPIIAWKEDGDYFVISWISYSKI
RNESEAQTRMMRIFSKDGELFSTSEPTNVLENGLFWRTKSNLIATSCRSN
KGLEIVFFEQNGLRHGGFMLYENGFCDNKVVSCISFNSNDDICTVVILDL
DNQLTHVKLFTTNNYQWYSKKTISYEKLEKISLFWSSDRLHLCSESGSHS
IYQLYSEIDRSIVENFDGKDKTFKLPNLVSVIDGDKVLMTPFEFCVIPPP
YCAFTINFQHDVSFVSLPTLDNISEDGLLSFIVQTSDNICNWIYLTRNPI
SKSYEKLIPTQLKFGRADCLYTPISKATLQLDHQINSICWLENNSFYCVV
NNALFLYKLDQSNIVIRKLEIGDIQVGKICYNSHVYIQDISGQVYQYDNE
SVKPLHKYSTFCCEMFSVKLKSESNDTILALSSRFNQFYINSVSQSGTYL
SILPLKHHLICTSVNQKLRCLNLAENNLNDLINLLDEKNYKCNFDFDETI
RLIEPGTEIITCVISHSKIVLMMPRGNLETIYPRALVLDDLKNLMENCLY
TEAIEKMRRQRVNLNLLYDHNPDRFMFNLAKLVKENNRNDRLVLFVSELS
PEDVTETMYKRFYNNSIKQKTLSIDKVNRVCSAIAEMFENDFNDDYINLI
LTCYVKMTPTASDKALQLLRKFKDNGKQKIWDKGIKYLQYLISIDELYRV
ALSTYDLNLTLKVAQKTQLDPKEYVTFINDLNELPCENYRRFKINIFLKR
PSKALEFIAEVADLFWEETVELITANSLYVKAIELFTYGTNHYNTISRLF
AEHLVANTNDLKTAAMVYLRTNDKELCRIAADYLFKTLHWKEWIMASKKS
EISEEETKETLIKLCIRLKDSGRQREALFINEVYLKDLYSAFNVALDGRL
FTDAFRILAFLSDCSGDNMGKLITSVMKTYENFLIQIEENEIKYSKDLER
LIEVRLNFINGYKDLRIAGEDEALPDYMSDTISEASSVNSRSSINSRMSI
GSQNSSKFKLKKKKVKNPWSDKKGSQKEEVGLIENLYRSVRHIQTVTGDI
NDLIEILSFIHRASESRLLLGAINRLLKFQLDSIDIIWDDFLLRRNSISW
DNEVQISNHIQICRSEQFAGRRRYLLDEEFLKSSPPMITLSVTSHIGAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR006849Elp1
IPR001611Leu-rich_rpt
Vocabulary: biological process
TermDefinition
GO:0002098tRNA wobble uridine modification
GO:0006355regulation of transcription, DNA-templated
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0033588Elongator holoenzyme complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 621..641
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..22
score: 6.0
NoneNo IPR availableSUPERFAMILYSSF101908Putative isomerase YbhEcoord: 477..626
NoneNo IPR availableSUPERFAMILYSSF69322Tricorn protease domain 2coord: 66..354
IPR006849Elongator complex protein 1PFAMPF04762IKI3coord: 97..910
e-value: 6.7E-165
score: 550.6
IPR006849Elongator complex protein 1PIRSFPIRSF017233IKAPcoord: 50..1277
e-value: 3.5E-176
score: 585.4
IPR006849Elongator complex protein 1PANTHERPTHR12747IKAPPAB KINASE COMPLEX-ASSOCIATED PROTEINcoord: 95..1238
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 617..638
score: 7.82