Phosphoribosylaminoimidazole-succinocarboxamide synthase

Overview
NamePhosphoribosylaminoimidazole-succinocarboxamide synthase
Smed IDSMED30024082
Length (bp)1387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoribosylaminoimidazole-succinocarboxamide synthase (SMED30024082) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoribosylaminoimidazole-succinocarboxamide synthase (SMED30024082) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoribosylaminoimidazole-succinocarboxamide synthase (SMED30024082) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoribosylaminoimidazole-succinocarboxamide synthase (SMED30024082) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024082

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30024082h1SMcG0001042 Contig48889uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024082h1SMcG0001042 Contig48889newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30024082h1SMcG0001042 dd_Smed_v4_1421_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024082h1SMcG0001042 dd_Smed_v4_1421_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024082h1SMcG0001042 Contig48889uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024082h1SMcG0001042 Contig48889newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30024082h1SMcG0001042 dd_Smed_v4_1421_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024082h1SMcG0001042 dd_Smed_v4_1421_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Human
Match: PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase [Source:HGNC Symbol;Acc:HGNC:8587])

HSP 1 Score: 438.343 bits (1126), Expect = 3.174e-151
Identity = 215/405 (53.09%), Postives = 282/405 (69.63%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ DS    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + ++  + +FIA +C MIPIEWV RRIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   NC L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+  ++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V +AVAGRSN LGP+++G +  PVI+CPPL P+W  QD+WSSL +PSGLGC+TVLS E + Q AA I  LS+H +WSK+R   L   ++L ++D+
Sbjct:   16 GKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFA--GLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Human
Match: PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase [Source:HGNC Symbol;Acc:HGNC:8587])

HSP 1 Score: 438.343 bits (1126), Expect = 3.174e-151
Identity = 215/405 (53.09%), Postives = 282/405 (69.63%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ DS    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + ++  + +FIA +C MIPIEWV RRIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   NC L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+  ++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V +AVAGRSN LGP+++G +  PVI+CPPL P+W  QD+WSSL +PSGLGC+TVLS E + Q AA I  LS+H +WSK+R   L   ++L ++D+
Sbjct:   16 GKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFA--GLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Human
Match: PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase [Source:HGNC Symbol;Acc:HGNC:8587])

HSP 1 Score: 436.032 bits (1120), Expect = 1.688e-150
Identity = 214/400 (53.50%), Postives = 278/400 (69.50%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNL 1339
            GKTK VYE+ DS    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + ++  + +FIA +C MIPIEWV RRIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   NC L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+  ++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V +AVAGRSN LGP+++G +  PVI+CPPL P+W  QD+WSSL +PSGLGC+TVLS E + Q AA I  LS+H +WSK+R   L   ++L
Sbjct:   16 GKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFA--GLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISL 413          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Human
Match: PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase [Source:HGNC Symbol;Acc:HGNC:8587])

HSP 1 Score: 430.254 bits (1105), Expect = 5.815e-148
Identity = 216/412 (52.43%), Postives = 284/412 (68.93%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDIL--SFSGFKHHYIK-----QNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ DS    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  + + +K + IK     +  + +FIA +C MIPIEWV RRIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   NC L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+  ++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V +AVAGRSN LGP+++G +  PVI+CPPL P+W  QD+WSSL +PSGLGC+TVLS E + Q AA I  LS+H +WSK+R   L   ++L ++D+
Sbjct:   16 GKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAVTSYKSNRIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFA--GLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADK 425          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Human
Match: PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase [Source:HGNC Symbol;Acc:HGNC:8587])

HSP 1 Score: 373.629 bits (958), Expect = 3.182e-127
Identity = 183/328 (55.79%), Postives = 232/328 (70.73%), Query Frame = 2
Query:  377 MIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            MIPIEWV RRIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   NC L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+  ++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V +AVAGRSN LGP+++G +  PVI+CPPL P+W  QD+WSSL +PSGLGC+TVLS E + Q AA I  LS+H +WSK+R   L   ++L ++D+
Sbjct:    1 MIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFA--GLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADK 326          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Celegans
Match: pacs-1 (Probable multifunctional protein ADE2 Phosphoribosylaminoimidazole-succinocarboxamide synthase Phosphoribosylaminoimidazole carboxylase [Source:UniProtKB/Swiss-Prot;Acc:Q10457])

HSP 1 Score: 381.333 bits (978), Expect = 2.152e-129
Identity = 197/403 (48.88%), Postives = 274/403 (67.99%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIEN-QLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSD 1351
            GKTK +++IK  KD  LI SKD +TA + V++++++GK++I++KT +++F+ L   G   H+ K  S+  F+A+KC+MIPIEWVARR+ATGSFLKRNPGV EG++F  +K ETFFKDDAN DP W+ EQ+VS  L I   +  I   +I +M + T  +F  LEK W   N  LIDMKIEFGV   GEI+LAD+ID+DSWR+WPE D+RL  DKQVYRDM EVT +GL  V  N+  + +    F K   K  ++V MGS +D  F +K+   + K+G+E  L+V+S HK   +   +++ +E +  P V+IAVAGRSN LGP++AG S LPVINCPP   E  S DIWSSL +P+G+GCTTVL    A  +AA ILA  +H ++ K+   +L+  +N+  ++
Sbjct:   20 GKTKQIFDIKGEKDYVLIRSKDSLTAFNAVRKNELEGKSRIASKTTSNVFEYLQLLGLPTHFEKSISETEFVARKCTMIPIEWVARRVATGSFLKRNPGVKEGFRFNDLKLETFFKDDANDDPQWTDEQIVSNGLMI--DHLKIGREEISLMKKMTKLVFRALEKGWALSNSALIDMKIEFGVTVEGEILLADVIDNDSWRVWPENDRRLQLDKQVYRDMKEVTEEGLALVLKNYTKVMDITATFSKHQQKCHVLVIMGSGSDGVFARKISDEAKKFGLETTLKVSSAHKTTSDTLEVIADFEESGVPTVVIAVAGRSNGLGPVIAGNSSLPVINCPP-PSESTSLDIWSSLRMPNGIGCTTVLDPSEAALAAAKILASHNHIVFGKVLTAQLKNQINIYNAN 419          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Fly
Match: Paics (gene:FBgn0020513 transcript:FBtr0333799)

HSP 1 Score: 439.499 bits (1129), Expect = 4.812e-152
Identity = 208/403 (51.61%), Postives = 280/403 (69.48%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VY++ +    CL++SKD+ITAGDGVK HD+ GKA+IS  T   +F +L+ +G +  Y+KQ    +FIA+KC MIPIEWV RR+ATGSFLKRN GV EGY+F P KQETFFKDDANHDP WS EQ+VSA  ++     +I + ++ +M  TT+ +FEILE+ W + NC LIDMK+EFG+ + G I+LADIIDSDSWRLWP GDKRLM DKQVYR+++ VT   L+ VK NFIW+  QL  + P     +V+ MGS +D+   +K+       G+  +LRV+S HK P E   I+  YE  +  ++ +AVAGRSN LGP+++G++  PVINCPP+  + +  D+WSSL++PSGLGC TVL  E A   AA IL L +  +WSK+R   L   + L ++D+
Sbjct:   20 GKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLAGKAEISNTTNGQVFRLLNEAGIRTAYVKQCGAKAFIARKCQMIPIEWVTRRLATGSFLKRNVGVPEGYRFSPPKQETFFKDDANHDPQWSEEQIVSAKFEL--NGLVIGQDEVDIMRRTTLLVFEILERAWQTKNCALIDMKVEFGICDDGNIVLADIIDSDSWRLWPAGDKRLMVDKQVYRNLASVTASDLDTVKRNFIWVAEQLADIVPKKDHLVVILMGSASDISHSEKIATSCRSLGLNVELRVSSAHKGPEETLRIVREYESVMSNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNMQVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMVWSKLRVKALNNFITLKKADK 420          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Fly
Match: Paics (gene:FBgn0020513 transcript:FBtr0073705)

HSP 1 Score: 439.499 bits (1129), Expect = 5.674e-152
Identity = 208/403 (51.61%), Postives = 280/403 (69.48%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VY++ +    CL++SKD+ITAGDGVK HD+ GKA+IS  T   +F +L+ +G +  Y+KQ    +FIA+KC MIPIEWV RR+ATGSFLKRN GV EGY+F P KQETFFKDDANHDP WS EQ+VSA  ++     +I + ++ +M  TT+ +FEILE+ W + NC LIDMK+EFG+ + G I+LADIIDSDSWRLWP GDKRLM DKQVYR+++ VT   L+ VK NFIW+  QL  + P     +V+ MGS +D+   +K+       G+  +LRV+S HK P E   I+  YE  +  ++ +AVAGRSN LGP+++G++  PVINCPP+  + +  D+WSSL++PSGLGC TVL  E A   AA IL L +  +WSK+R   L   + L ++D+
Sbjct:   21 GKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLAGKAEISNTTNGQVFRLLNEAGIRTAYVKQCGAKAFIARKCQMIPIEWVTRRLATGSFLKRNVGVPEGYRFSPPKQETFFKDDANHDPQWSEEQIVSAKFEL--NGLVIGQDEVDIMRRTTLLVFEILERAWQTKNCALIDMKVEFGICDDGNIVLADIIDSDSWRLWPAGDKRLMVDKQVYRNLASVTASDLDTVKRNFIWVAEQLADIVPKKDHLVVILMGSASDISHSEKIATSCRSLGLNVELRVSSAHKGPEETLRIVREYESVMSNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNMQVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMVWSKLRVKALNNFITLKKADK 421          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Zebrafish
Match: paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase [Source:ZFIN;Acc:ZDB-GENE-030131-9762])

HSP 1 Score: 459.144 bits (1180), Expect = 1.294e-159
Identity = 214/405 (52.84%), Postives = 292/405 (72.10%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK ++EI D     L+ SKD+ITAG+ V++  M+GKA I+ KT + +F +L  +G K  +++Q+SD +F+A +C MIPIEWV RRIATGSFLKRNPGV EGY+F P+K E FFKDDAN+DP WS EQL++A   +      I   ++ +MS++TVAIFE+LEK W + +C L+DMKIEFGV+  T EI+LAD+ID+DSWRLWP GD+   KDKQVYRD+ EVT + ++ VK NF W+  ++  L +   +G++VV MGS +D+  C+K+++    YGI C LRV S HK P E   I + YEG  EP + +AVAGRSN LGP+++G +  PVINCPP+ P+W +QDIWSSL +PSGLGC+TVLS E A Q AA IL L++H +W+K+R   L   V+L ++D+
Sbjct:   16 GKTKQIFEILDEPGHVLVQSKDQITAGNAVRKDQMEGKAAIANKTTSCVFKLLQDAGLKTAFVRQHSDTAFVASRCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFTPLKMEMFFKDDANNDPQWSEEQLLAAGFDLA--GLTIGRCEVDIMSKSTVAIFEVLEKAWATQDCTLVDMKIEFGVNVTTKEIVLADVIDNDSWRLWPAGDRSQQKDKQVYRDLKEVTPEAMQMVKRNFEWVAERVKLLLESQARGRVVVMMGSTSDVAHCEKIRKACASYGIPCHLRVNSAHKGPDETLRIKAEYEGDGEPTIFVAVAGRSNGLGPVMSGNTAYPVINCPPVTPDWGAQDIWSSLRMPSGLGCSTVLSPEAAAQFAAQILGLNNHLIWAKLRASMLNTWVSLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Zebrafish
Match: paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase [Source:ZFIN;Acc:ZDB-GENE-030131-9762])

HSP 1 Score: 459.144 bits (1180), Expect = 1.294e-159
Identity = 214/405 (52.84%), Postives = 292/405 (72.10%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK ++EI D     L+ SKD+ITAG+ V++  M+GKA I+ KT + +F +L  +G K  +++Q+SD +F+A +C MIPIEWV RRIATGSFLKRNPGV EGY+F P+K E FFKDDAN+DP WS EQL++A   +      I   ++ +MS++TVAIFE+LEK W + +C L+DMKIEFGV+  T EI+LAD+ID+DSWRLWP GD+   KDKQVYRD+ EVT + ++ VK NF W+  ++  L +   +G++VV MGS +D+  C+K+++    YGI C LRV S HK P E   I + YEG  EP + +AVAGRSN LGP+++G +  PVINCPP+ P+W +QDIWSSL +PSGLGC+TVLS E A Q AA IL L++H +W+K+R   L   V+L ++D+
Sbjct:   16 GKTKQIFEILDEPGHVLVQSKDQITAGNAVRKDQMEGKAAIANKTTSCVFKLLQDAGLKTAFVRQHSDTAFVASRCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFTPLKMEMFFKDDANNDPQWSEEQLLAAGFDLA--GLTIGRCEVDIMSKSTVAIFEVLEKAWATQDCTLVDMKIEFGVNVTTKEIVLADVIDNDSWRLWPAGDRSQQKDKQVYRDLKEVTPEAMQMVKRNFEWVAERVKLLLESQARGRVVVMMGSTSDVAHCEKIRKACASYGIPCHLRVNSAHKGPDETLRIKAEYEGDGEPTIFVAVAGRSNGLGPVMSGNTAYPVINCPPVTPDWGAQDIWSSLRMPSGLGCSTVLSPEAAAQFAAQILGLNNHLIWAKLRASMLNTWVSLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Zebrafish
Match: paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase [Source:ZFIN;Acc:ZDB-GENE-030131-9762])

HSP 1 Score: 459.144 bits (1180), Expect = 1.294e-159
Identity = 214/405 (52.84%), Postives = 292/405 (72.10%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK ++EI D     L+ SKD+ITAG+ V++  M+GKA I+ KT + +F +L  +G K  +++Q+SD +F+A +C MIPIEWV RRIATGSFLKRNPGV EGY+F P+K E FFKDDAN+DP WS EQL++A   +      I   ++ +MS++TVAIFE+LEK W + +C L+DMKIEFGV+  T EI+LAD+ID+DSWRLWP GD+   KDKQVYRD+ EVT + ++ VK NF W+  ++  L +   +G++VV MGS +D+  C+K+++    YGI C LRV S HK P E   I + YEG  EP + +AVAGRSN LGP+++G +  PVINCPP+ P+W +QDIWSSL +PSGLGC+TVLS E A Q AA IL L++H +W+K+R   L   V+L ++D+
Sbjct:   16 GKTKQIFEILDEPGHVLVQSKDQITAGNAVRKDQMEGKAAIANKTTSCVFKLLQDAGLKTAFVRQHSDTAFVASRCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFTPLKMEMFFKDDANNDPQWSEEQLLAAGFDLA--GLTIGRCEVDIMSKSTVAIFEVLEKAWATQDCTLVDMKIEFGVNVTTKEIVLADVIDNDSWRLWPAGDRSQQKDKQVYRDLKEVTPEAMQMVKRNFEWVAERVKLLLESQARGRVVVMMGSTSDVAHCEKIRKACASYGIPCHLRVNSAHKGPDETLRIKAEYEGDGEPTIFVAVAGRSNGLGPVMSGNTAYPVINCPPVTPDWGAQDIWSSLRMPSGLGCSTVLSPEAAAQFAAQILGLNNHLIWAKLRASMLNTWVSLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Zebrafish
Match: paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase [Source:ZFIN;Acc:ZDB-GENE-030131-9762])

HSP 1 Score: 461.455 bits (1186), Expect = 1.181e-152
Identity = 214/404 (52.97%), Postives = 291/404 (72.03%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSD 1351
            GKTK ++EI D     L+ SKD+ITAG+ V++  M+GKA I+ KT + +F +L  +G K  +++Q+SD +F+A +C MIPIEWV RRIATGSFLKRNPGV EGY+F P+K E FFKDDAN+DP WS EQL++A   +      I   ++ +MS++TVAIFE+LEK W + +C L+DMKIEFGV+  T EI+LAD+ID+DSWRLWP GD+   KDKQVYRD+ EVT + ++ VK NF W+  ++  L +   +G++VV MGS +D+  C+K+++    YGI C LRV S HK P E   I + YEG  EP + +AVAGRSN LGP+++G +  PVINCPP+ P+W +QDIWSSL +PSGLGC+TVLS E A Q AA IL L++H +W+K+R   L   V+L ++D
Sbjct:  633 GKTKQIFEILDEPGHVLVQSKDQITAGNAVRKDQMEGKAAIANKTTSCVFKLLQDAGLKTAFVRQHSDTAFVASRCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFTPLKMEMFFKDDANNDPQWSEEQLLAAGFDLA--GLTIGRCEVDIMSKSTVAIFEVLEKAWATQDCTLVDMKIEFGVNVTTKEIVLADVIDNDSWRLWPAGDRSQQKDKQVYRDLKEVTPEAMQMVKRNFEWVAERVKLLLESQARGRVVVMMGSTSDVAHCEKIRKACASYGIPCHLRVNSAHKGPDETLRIKAEYEGDGEPTIFVAVAGRSNGLGPVMSGNTAYPVINCPPVTPDWGAQDIWSSLRMPSGLGCSTVLSPEAAAQFAAQILGLNNHLIWAKLRASMLNTWVSLKQAD 1034          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Xenopus
Match: ENSXETT00000016729.1 (phosphoribosylaminoimidazole carboxylase; phosphoribosylaminoimidazolesuccinocarboxamide synthase [Source:NCBI gene;Acc:100488155])

HSP 1 Score: 449.899 bits (1156), Expect = 6.844e-156
Identity = 220/404 (54.46%), Postives = 288/404 (71.29%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDET-GEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLG-FLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSD 1351
            GKTK VYE+ +   C L+ SKD+IT+GD V++  M+GKA IS KT + +F +L  +G K  ++++  D +FIA  C MIPIEWV RRIATGSFLKRNPGV EGY+F P K ETFFKDDANHDP WS EQL+SA L       +I + ++ +M+ +T AIFEILEK W + +C L+DMKIEFGVD T  EI+LAD+ID+DSWRLWP GDK   KDKQ YRD+ EVT + L+ VK NF W+ +++   L P  +G++VV MGS++D+  C+K+K+    YGI C+LRV S HK P E   I + YEG   P V IAVAGRSN LGP+++G +  PV+NCPPL  +W +QD+WSSL +PSGLGC+TVLS E A Q AA I  L++H +WSK+R   L   ++L ++D
Sbjct:   16 GKTKEVYELPEHPGCVLMKSKDQITSGDAVRKDHMEGKASISNKTTSCVFKLLQEAGIKTAFVRKCGDTAFIATHCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFSPPKVETFFKDDANHDPQWSEEQLISAKLSCA--GLVIGQAEVDIMTHSTAAIFEILEKAWMTQDCTLVDMKIEFGVDVTKKEIVLADVIDNDSWRLWPAGDKSQQKDKQTYRDLKEVTPEALQMVKRNFEWVADRVELLLSPNSRGRVVVLMGSISDLAHCEKIKKSCANYGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFIAVAGRSNGLGPVMSGNTAYPVLNCPPLTADWGAQDVWSSLRMPSGLGCSTVLSPEAAAQFAAQIFGLNNHLVWSKLRSCTLNTWISLKQAD 417          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Xenopus
Match: ENSXETT00000016742.1 (phosphoribosylaminoimidazole carboxylase; phosphoribosylaminoimidazolesuccinocarboxamide synthase [Source:NCBI gene;Acc:100488155])

HSP 1 Score: 450.669 bits (1158), Expect = 3.900e-155
Identity = 220/404 (54.46%), Postives = 288/404 (71.29%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDET-GEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLG-FLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSD 1351
            GKTK VYE+ +   C L+ SKD+IT+GD V++  M+GKA IS KT + +F +L  +G K  ++++  D +FIA  C MIPIEWV RRIATGSFLKRNPGV EGY+F P K ETFFKDDANHDP WS EQL+SA L       +I + ++ +M+ +T AIFEILEK W + +C L+DMKIEFGVD T  EI+LAD+ID+DSWRLWP GDK   KDKQ YRD+ EVT + L+ VK NF W+ +++   L P  +G++VV MGS++D+  C+K+K+    YGI C+LRV S HK P E   I + YEG   P V IAVAGRSN LGP+++G +  PV+NCPPL  +W +QD+WSSL +PSGLGC+TVLS E A Q AA I  L++H +WSK+R   L   ++L ++D
Sbjct:   81 GKTKEVYELPEHPGCVLMKSKDQITSGDAVRKDHMEGKASISNKTTSCVFKLLQEAGIKTAFVRKCGDTAFIATHCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFSPPKVETFFKDDANHDPQWSEEQLISAKLSCA--GLVIGQAEVDIMTHSTAAIFEILEKAWMTQDCTLVDMKIEFGVDVTKKEIVLADVIDNDSWRLWPAGDKSQQKDKQTYRDLKEVTPEALQMVKRNFEWVADRVELLLSPNSRGRVVVLMGSISDLAHCEKIKKSCANYGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFIAVAGRSNGLGPVMSGNTAYPVLNCPPLTADWGAQDVWSSLRMPSGLGCSTVLSPEAAAQFAAQIFGLNNHLVWSKLRSCTLNTWISLKQAD 482          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Xenopus
Match: ENSXETT00000031576.1 (phosphoribosylaminoimidazole carboxylase; phosphoribosylaminoimidazolesuccinocarboxamide synthase [Source:NCBI gene;Acc:100488155])

HSP 1 Score: 443.351 bits (1139), Expect = 1.493e-153
Identity = 216/399 (54.14%), Postives = 284/399 (71.18%), Query Frame = 2
Query:  161 VYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETG-EIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSD 1351
            VYE+ +   C L+ SKD+IT+GD V++  M+GKA IS KT + +F +L  +G K  ++++  D +FIA  C MIPIEWV RRIATGSFLKRNPGV EGY+F P K ETFFKDDANHDP WS EQL+SA L       +I + ++ +M+ +T AIFEILEK W + +C L+DMKIEFGVD T  EI+LAD+ID+DSWRLWP GDK   KDKQ YRD+ EVT + L+ VK NF W+ +++  L  P  +G++VV MGS++D+  C+K+K+    YGI C+LRV S HK P E   I + YEG   P V IAVAGRSN LGP+++G +  PV+NCPPL  +W +QD+WSSL +PSGLGC+TVLS E A Q AA I  L++H +WSK+R   L   ++L ++D
Sbjct:    2 VYELPEHPGCVLMKSKDQITSGDAVRKDHMEGKASISNKTTSCVFKLLQEAGIKTAFVRKCGDTAFIATHCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFSPPKVETFFKDDANHDPQWSEEQLISAKLSCA--GLVIGQAEVDIMTHSTAAIFEILEKAWMTQDCTLVDMKIEFGVDVTKKEIVLADVIDNDSWRLWPAGDKSQQKDKQTYRDLKEVTPEALQMVKRNFEWVADRVELLLSPNSRGRVVVLMGSISDLAHCEKIKKSCANYGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFIAVAGRSNGLGPVMSGNTAYPVLNCPPLTADWGAQDVWSSLRMPSGLGCSTVLSPEAAAQFAAQIFGLNNHLVWSKLRSCTLNTWISLKQAD 398          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Xenopus
Match: pld1 (phospholipase D1 [Source:Xenbase;Acc:XB-GENE-948465])

HSP 1 Score: 288.5 bits (737), Expect = 6.277e-88
Identity = 157/397 (39.55%), Postives = 231/397 (58.19%), Query Frame = 2
Query:  161 VYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSD 1351
            VY++ +   C LI SKD + A         +G A +S +  + +F +L  +G K  ++K+ S+ +FIA +C MIPIEW  RRIA+    KRN    EGY+F   K E +  +D N+  + S EQL++  +K+     +I + ++ VM+ +T+AIFEI+EK W + +C L+DM+I+FGVD T + +L   I   S  LWP G+K  +K                     N + ++ Q          ++VV M S +D+  C+++K+   KYG++C+LRVAS H  P E   I++ YEG   P V IAVAG SN LG ++A  S  PVINCPPL  +W ++DIWSSL VPSGLGC+TVLS E A Q AA I  ++ H +WSK+R   L   ++L ++D
Sbjct:  538 VYDLPERPGCVLIQSKDHMNAQYAAWDGHTEGNASVSNRATSCVFSLLQEAGIKTAFVKKCSEAAFIATQCEMIPIEWFCRRIAS----KRNAETEEGYRFPQAKVEMYKVNDTNNHQV-SVEQLIA--VKLICSGLLIGKIEVDVMTRSTIAIFEIIEKSWRAQDCTLVDMRIKFGVDVTKKEVLLTDIKCGSQALWPAGNKSQLK---------------------NNLCLDGQ---------SRVVVLMASTSDLVHCEEIKKSCSKYGMKCELRVASAHTGPQETLEIIAEYEGDYIPTVFIAVAGGSNGLGAIVAANSSHPVINCPPLSEDWSTKDIWSSLRVPSGLGCSTVLSPEAAAQFAARIFGINSHMVWSKLRACTLNSWISLKQAD 897          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Xenopus
Match: pld1 (phospholipase D1 [Source:Xenbase;Acc:XB-GENE-948465])

HSP 1 Score: 288.5 bits (737), Expect = 9.162e-88
Identity = 157/397 (39.55%), Postives = 231/397 (58.19%), Query Frame = 2
Query:  161 VYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSD 1351
            VY++ +   C LI SKD + A         +G A +S +  + +F +L  +G K  ++K+ S+ +FIA +C MIPIEW  RRIA+    KRN    EGY+F   K E +  +D N+  + S EQL++  +K+     +I + ++ VM+ +T+AIFEI+EK W + +C L+DM+I+FGVD T + +L   I   S  LWP G+K  +K+         +  DG                      + ++VV M S +D+  C+++K+   KYG++C+LRVAS H  P E   I++ YEG   P V IAVAG SN LG ++A  S  PVINCPPL  +W ++DIWSSL VPSGLGC+TVLS E A Q AA I  ++ H +WSK+R   L   ++L ++D
Sbjct:  552 VYDLPERPGCVLIQSKDHMNAQYAAWDGHTEGNASVSNRATSCVFSLLQEAGIKTAFVKKCSEAAFIATQCEMIPIEWFCRRIAS----KRNAETEEGYRFPQAKVEMYKVNDTNNHQV-SVEQLIA--VKLICSGLLIGKIEVDVMTRSTIAIFEIIEKSWRAQDCTLVDMRIKFGVDVTKKEVLLTDIKCGSQALWPAGNKSQLKNN--------LCLDG----------------------QSRVVVLMASTSDLVHCEEIKKSCSKYGMKCELRVASAHTGPQETLEIIAEYEGDYIPTVFIAVAGGSNGLGAIVAANSSHPVINCPPLSEDWSTKDIWSSLRVPSGLGCSTVLSPEAAAQFAARIFGINSHMVWSKLRACTLNSWISLKQAD 911          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Mouse
Match: Paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase [Source:MGI Symbol;Acc:MGI:1914304])

HSP 1 Score: 433.335 bits (1113), Expect = 1.959e-149
Identity = 209/405 (51.60%), Postives = 284/405 (70.12%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ D+    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + K+  + +FIA +C MIPIEWV RRIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   +C L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+ +++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V ++VAGRSN LGP+L+G +  PVI+CPP+ P+W +QD+WSSL +PSG+GC+T+LS E + Q AA I  L++H +W+K+R   L   ++L ++D+
Sbjct:   16 GKTKEVYELLDTPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYKFYPPKVEMFFKDDANNDPQWSEEQLIAAKFCFA--GLVIGQTEVDIMSHATQAIFEILEKSWLPQDCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVADRVELLLKSDSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVSVAGRSNGLGPVLSGNTAYPVISCPPITPDWGAQDVWSSLRLPSGIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASILNTWISLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Mouse
Match: Paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase [Source:MGI Symbol;Acc:MGI:1914304])

HSP 1 Score: 433.335 bits (1113), Expect = 1.959e-149
Identity = 209/405 (51.60%), Postives = 284/405 (70.12%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ D+    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + K+  + +FIA +C MIPIEWV RRIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   +C L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+ +++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V ++VAGRSN LGP+L+G +  PVI+CPP+ P+W +QD+WSSL +PSG+GC+T+LS E + Q AA I  L++H +W+K+R   L   ++L ++D+
Sbjct:   16 GKTKEVYELLDTPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYKFYPPKVEMFFKDDANNDPQWSEEQLIAAKFCFA--GLVIGQTEVDIMSHATQAIFEILEKSWLPQDCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVADRVELLLKSDSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVSVAGRSNGLGPVLSGNTAYPVISCPPITPDWGAQDVWSSLRLPSGIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASILNTWISLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Mouse
Match: Paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase [Source:MGI Symbol;Acc:MGI:1914304])

HSP 1 Score: 433.335 bits (1113), Expect = 1.959e-149
Identity = 209/405 (51.60%), Postives = 284/405 (70.12%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ D+    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + K+  + +FIA +C MIPIEWV RRIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   +C L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+ +++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V ++VAGRSN LGP+L+G +  PVI+CPP+ P+W +QD+WSSL +PSG+GC+T+LS E + Q AA I  L++H +W+K+R   L   ++L ++D+
Sbjct:   16 GKTKEVYELLDTPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYKFYPPKVEMFFKDDANNDPQWSEEQLIAAKFCFA--GLVIGQTEVDIMSHATQAIFEILEKSWLPQDCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVADRVELLLKSDSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVSVAGRSNGLGPVLSGNTAYPVISCPPITPDWGAQDVWSSLRLPSGIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASILNTWISLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Mouse
Match: Paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase [Source:MGI Symbol;Acc:MGI:1914304])

HSP 1 Score: 56.6102 bits (135), Expect = 5.953e-10
Identity = 28/65 (43.08%), Postives = 43/65 (66.15%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQ 340
            GKTK VYE+ D+    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + K+
Sbjct:   16 GKTKEVYELLDTPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTKK 80          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Mouse
Match: Paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase [Source:MGI Symbol;Acc:MGI:1914304])

HSP 1 Score: 53.1434 bits (126), Expect = 2.020e-8
Identity = 26/57 (45.61%), Postives = 39/57 (68.42%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSG 316
            GKTK VYE+ D+    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G
Sbjct:   16 GKTKEVYELLDTPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAG 72          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. UniProt/SwissProt
Match: sp|P38024|PUR6_CHICK (Multifunctional protein ADE2 OS=Gallus gallus OX=9031 GN=AIRC PE=2 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 4.775e-152
Identity = 210/405 (51.85%), Postives = 279/405 (68.89%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ D   C L+ SKD+ITAG+  ++  M+GKA IS  T + +F +L  +G K  ++++ SD +FIA  C MIPIEWV RRIATGSFLKRNPGV EGYKF P K E F+KDDAN+DP WS EQL+ A          I + ++ +M+ +T AIFEILEK W   NC L+D+KIEFGV+  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT + L+ VK NF W+  ++  L K   +G++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V +AVAGRSN LGP+++G +  PV+NCPPL  +W +QD+WSSL +PSGLGC T LS E A Q AA I  L++H +W+K+R   L   ++L ++D+
Sbjct:   17 GKTKEVYELPDIPGCVLMQSKDQITAGNAARKDRMEGKAAISNTTTSCVFQLLQEAGIKTAFVRKQSDTAFIAAHCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKIEMFYKDDANNDPQWSEEQLIEAKFSFA--GLTIGKTEVDIMARSTQAIFEILEKSWQPQNCTLVDLKIEFGVNILTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEALQMVKRNFEWVAERVELLLKTKSQGRVVVLMGSTSDLGHCEKIKKACATFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVVNCPPLSSDWGAQDVWSSLRLPSGLGCPTTLSPEGAAQFAAQIFGLNNHLVWAKLRSNMLNTWISLKQADK 419          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. UniProt/SwissProt
Match: sp|Q9I7S8|PUR6_DROME (Multifunctional protein ADE2 OS=Drosophila melanogaster OX=7227 GN=ade5 PE=2 SV=2)

HSP 1 Score: 439.499 bits (1129), Expect = 5.687e-151
Identity = 208/403 (51.61%), Postives = 280/403 (69.48%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VY++ +    CL++SKD+ITAGDGVK HD+ GKA+IS  T   +F +L+ +G +  Y+KQ    +FIA+KC MIPIEWV RR+ATGSFLKRN GV EGY+F P KQETFFKDDANHDP WS EQ+VSA  ++     +I + ++ +M  TT+ +FEILE+ W + NC LIDMK+EFG+ + G I+LADIIDSDSWRLWP GDKRLM DKQVYR+++ VT   L+ VK NFIW+  QL  + P     +V+ MGS +D+   +K+       G+  +LRV+S HK P E   I+  YE  +  ++ +AVAGRSN LGP+++G++  PVINCPP+  + +  D+WSSL++PSGLGC TVL  E A   AA IL L +  +WSK+R   L   + L ++D+
Sbjct:   21 GKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLAGKAEISNTTNGQVFRLLNEAGIRTAYVKQCGAKAFIARKCQMIPIEWVTRRLATGSFLKRNVGVPEGYRFSPPKQETFFKDDANHDPQWSEEQIVSAKFEL--NGLVIGQDEVDIMRRTTLLVFEILERAWQTKNCALIDMKVEFGICDDGNIVLADIIDSDSWRLWPAGDKRLMVDKQVYRNLASVTASDLDTVKRNFIWVAEQLADIVPKKDHLVVILMGSASDISHSEKIATSCRSLGLNVELRVSSAHKGPEETLRIVREYESVMSNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNMQVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMVWSKLRVKALNNFITLKKADK 421          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. UniProt/SwissProt
Match: sp|P22234|PUR6_HUMAN (Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3)

HSP 1 Score: 438.343 bits (1126), Expect = 1.524e-150
Identity = 215/405 (53.09%), Postives = 282/405 (69.63%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ DS    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + ++  + +FIA +C MIPIEWV RRIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   NC L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+  ++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V +AVAGRSN LGP+++G +  PVI+CPPL P+W  QD+WSSL +PSGLGC+TVLS E + Q AA I  LS+H +WSK+R   L   ++L ++D+
Sbjct:   16 GKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFA--GLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. UniProt/SwissProt
Match: sp|P51583|PUR6_RAT (Multifunctional protein ADE2 OS=Rattus norvegicus OX=10116 GN=Paics PE=1 SV=3)

HSP 1 Score: 434.876 bits (1117), Expect = 2.950e-149
Identity = 209/405 (51.60%), Postives = 284/405 (70.12%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ DS    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + K+  + +FIA +C MIPIEWV RRIATGSFLKRNPGV EGY+F P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   NC L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+ +++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V +AVAGRSN LGP+++G +  PVI+CPP+  +W +QD+WSSL +PSG+GC+T+LS E + Q AA I  L++H +W+K+R  +L   ++L ++D+
Sbjct:   16 GKTKEVYELLDSPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFYPPKVEMFFKDDANNDPQWSEEQLIAAKFCFA--GLVIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVADRVELLLKSNSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPITADWGAQDVWSSLRLPSGIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASKLNTWISLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. UniProt/SwissProt
Match: sp|Q5RB59|PUR6_PONAB (Multifunctional protein ADE2 OS=Pongo abelii OX=9601 GN=PAICS PE=2 SV=3)

HSP 1 Score: 434.491 bits (1116), Expect = 5.313e-149
Identity = 212/405 (52.35%), Postives = 281/405 (69.38%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK VYE+ DS    L+ SKD+ITAG+  +++ ++GKA IS K  + IF +L  +G K  + ++  + +FIA +C MIPIEWV  RIATGSFLKRNPGV EGYKF P K E FFKDDAN+DP WS EQL++A         +I + ++ +MS  T AIFEILEK W   NC L+DMKIEFGVD  T EI+LAD+ID+DSWRLWP GD+   KDKQ YRD+ EVT +GL+ VK NF W+  ++  L K   + ++VV MGS +D+  C+K+K+    +GI C+LRV S HK P E   I + YEG   P V +AVAGRSN LGP++ G +  PVI+CPPL P+W +QD+WSSL +PSGLGC+T+LS E + Q AA I  L++H +WSK+R   L   ++L ++D+
Sbjct:   16 GKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCGRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSAEQLIAAKFCFA--GLVIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMCGNTAYPVISCPPLTPDWGAQDVWSSLRLPSGLGCSTILSPEGSAQFAAQIFGLNNHLVWSKLRASILNTWISLKQADK 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. TrEMBL
Match: A0A131XVF9 (Putative phosphoribosylamidoimidazole-succinocarboxamide synthase OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 9.667e-169
Identity = 232/404 (57.43%), Postives = 300/404 (74.26%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK+VYE+ D     ++VSKD+ITAGDG + HD+QGKA IS  TA+ IF++L+ +G K H+++++ + SF+A+ C+M+PIEWV+RR+ATGSFLKRNPGVNEG++FCP KQETFFKDDANHDP WS EQLV A LK G  N +I   +++VM  T+  +FEILEK W SLNC LIDMK+E+GVD +TGE++LADIIDSDSWRLWP GDKRLM DKQVYR++ EVT+  LE VK NF W+  Q+  L P  K ++ V MGS +D + C+K+K+   K G+ C+LRVAS HK   +   +++ YEG   P V ++VAGRSN LGP+ +G S  PVINCPP+  EW   DIWSSL VPSGLGCTTVL  E A  +AA IL LSDH +W+K+R  +L   + L  +D+
Sbjct:   14 GKTKVVYELADEPGHVVLVSKDRITAGDGARAHDLQGKAAISNATASSIFELLNAAGIKTHFVRKHDEKSFVARNCAMVPIEWVSRRVATGSFLKRNPGVNEGFRFCPPKQETFFKDDANHDPQWSTEQLVEAKLKCG--NTVIGPEEVQVMLRTSRTVFEILEKAWASLNCSLIDMKVEYGVDLQTGELLLADIIDSDSWRLWPSGDKRLMVDKQVYRNLKEVTDQDLETVKKNFAWVAEQIQKLNPKPKSQVAVVMGSPSDKEHCEKIKKACEKLGVPCELRVASAHKNTDQSLDLIAQYEGEGIPTVFVSVAGRSNGLGPVTSGNSAFPVINCPPVSGEWGPHDIWSSLRVPSGLGCTTVLFPEAAALAAAQILGLSDHVIWAKLRASQLNNWIALKMADK 415          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. TrEMBL
Match: K1RJ97 (Multifunctional protein ADE2 OS=Crassostrea gigas OX=29159 GN=CGI_10028436 PE=3 SV=1)

HSP 1 Score: 486.493 bits (1251), Expect = 4.120e-167
Identity = 228/406 (56.16%), Postives = 293/406 (72.17%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDESA 1360
            GKTK+VY++ D  +  L+ +KD+ITAGDG + H+++GKA IST T   IF +L+ +G K H++++  D SFI  KC MIPIEWV RR+ATGSFLKRNPGV EGY+FCP KQETFFKDDANHDP WSYEQ ++AN+ +G    +I   ++ +MS TTV +FEILE+ W SL+C LIDMKIEFGV   TGEI+LAD+IDSDSWRLWP GDKRLMKDKQVYR++ EVT + L+ VK NF W+  ++  L P    + VVFMGS +DM  C+K++    + G+ C+LRV+S HK   E   IL+ YEG   P V IAVAGRSN LGP+L+G +  PVINCPPL  +W S DIWSS+ +PSGLGC TV+  E A   AA ILAL+DH +W  +R  +L   + L  +D+ +
Sbjct:   15 GKTKVVYQVADDPELVLLKAKDRITAGDGDRSHELKGKAAISTDTTTAIFQLLNSAGIKTHFVRRCDDTSFIGYKCDMIPIEWVTRRVATGSFLKRNPGVKEGYRFCPPKQETFFKDDANHDPQWSYEQCLAANITVG--GVLIGRDELDIMSRTTVTVFEILERSWASLDCSLIDMKIEFGVKPSTGEIVLADVIDSDSWRLWPSGDKRLMKDKQVYRELREVTQEALDTVKRNFEWVAERVKLLIPKPNARAVVFMGSASDMPHCEKIRTSCQQLGVPCELRVSSAHKGTEETMKILAEYEGEGIPTVFIAVAGRSNGLGPVLSGNATWPVINCPPLSGDWGSHDIWSSMRLPSGLGCATVMFPEAAALCAAQILALNDHVIWGNVRAKQLNTWIGLKEADKKS 418          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. TrEMBL
Match: C3ZBE4 (AIRC domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_117612 PE=3 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 1.886e-166
Identity = 226/403 (56.08%), Postives = 299/403 (74.19%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTKIVY + D      I+SKD+ITAGDG + +D++GKA IST TA  IFD+L+ +G K+H+++Q+ D SFIA++C MIPIEWV RR+ATGSFLKRN GV EGY+F P K ETFFKDD NHDP WSYEQL+ A L+ G   ++I   ++++MS TTVA+FE+LEK W + NC L+DMKIEFGV+  GEI+LAD+IDSDSWRLWP GD+RLMKDKQVYR++ EVT + L++VK NF W+  ++  L+     ++VV MGS  D++  +K+ +     GI CD+RV+S HK   E   IL  YEG   P V +A+AGRSN LGP+L+G +  PVINCPP+  +W +QDIWSSL +PSGLGC+TVLS + AV +AA IL+LSDH +WS++R  +L  ++ L  SD+
Sbjct:   13 GKTKIVYALPDDPANVYILSKDRITAGDGARANDLEGKAVISTATATSIFDLLTSAGIKNHFVRQHDDKSFIAQRCDMIPIEWVTRRLATGSFLKRNVGVKEGYRFSPPKLETFFKDDENHDPQWSYEQLLGAKLEAG--GRVIGRDEVEIMSRTTVAVFEVLEKAWATQNCTLVDMKIEFGVNTKGEIVLADLIDSDSWRLWPSGDRRLMKDKQVYRELKEVTAEALDEVKRNFQWVAERVKLLQTKPSAQVVVLMGSATDLEHGQKISKGCQALGIPCDVRVSSAHKGTEETIRILREYEGEGIPCVFVAIAGRSNGLGPVLSGNTSYPVINCPPVKADWGAQDIWSSLRLPSGLGCSTVLSPDAAVLAAAQILSLSDHMIWSRLRCKQLYTYLGLKDSDK 413          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. TrEMBL
Match: G3MKE1 (AIRC domain-containing protein OS=Amblyomma maculatum OX=34609 PE=2 SV=1)

HSP 1 Score: 479.945 bits (1234), Expect = 1.881e-164
Identity = 231/404 (57.18%), Postives = 298/404 (73.76%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK+VYE+ +     ++VSKD+ITAGDG + HD+QGKA IS  TAA IF +L+ +G K H++++  D SF+A+ C+M+PIEWV RRIATGSFLKRNPGVNEGY+F P K ETFFKDDANHDP WS EQL++A L+ G     I   ++++M  TT  +FEILE+ W SLNC LIDMK+E+GVD +TGEI+LADIIDSDSWRLWP GDKRLM DKQVYR+++EVT + LE VK NF W+  Q+  L P  K ++ V MGS +D + C+K+K+   K G+ C+LRVAS HK   +   ++S YEG   P V ++VAGRSN LGP+ +G S  PVINCPP+  EW + DIWSSL +PSGLGCTTVL  E A  +AA ILA+SDH +W+K+R  +L   V+L  +D+
Sbjct:   14 GKTKVVYELPNEPGNVVLVSKDRITAGDGARAHDLQGKAAISNATAASIFTLLNNAGIKTHFVRKQDDKSFVARNCAMVPIEWVTRRIATGSFLKRNPGVNEGYRFSPPKLETFFKDDANHDPQWSTEQLIAAKLQCG--GTTIGAEEVQIMLRTTRTVFEILERAWASLNCSLIDMKVEYGVDLQTGEILLADIIDSDSWRLWPSGDKRLMVDKQVYRNLTEVTAEALETVKRNFAWVAEQIEKLSPKPKAQVAVVMGSPSDKEHCEKIKKACEKLGVPCELRVASAHKNTDQALDLISEYEGEGIPTVFVSVAGRSNGLGPVTSGNSVFPVINCPPVSGEWGAHDIWSSLRLPSGLGCTTVLFPEAAALAAAQILAMSDHVIWAKLRASQLNTWVSLKLADK 415          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. TrEMBL
Match: A0A1S3JJQ1 (multifunctional protein ADE2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106173523 PE=3 SV=1)

HSP 1 Score: 479.174 bits (1232), Expect = 3.375e-164
Identity = 227/403 (56.33%), Postives = 295/403 (73.20%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTKIVYEI       L+ SKDKITAG+  ++H+M+GKA +ST TAA +F++L+ +G K H+IKQ+SD +FIA+ C MIPIEWV RR+ATGSFLKRNPGV EGY+FCP K E F+KDDA  DP WS EQ++ + +  G    +I   ++ +MS+ TV +FEILEK W +L+C LIDMKIEFGV+  GEI+LADIIDSDSWRLWP GDKRLMKDKQVYRDM+EVT +GL  VK NF W+  +L  L P    + VVFMGS +D  F +K+ +   KYG+ C++RV+S HK   E  +IL+ YEG   P V IAVAGRSN LGP+L+G +  PVINCPP+  +W ++D+WSSL +PSGLGC+TV+S E A   AA I++L DH +WS++R  +L   + L + D+
Sbjct:   17 GKTKIVYEITSQPGKVLLQSKDKITAGNAARQHEMKGKAIVSTATAAKVFELLAIAGVKSHFIKQHSDTAFIAEACDMIPIEWVTRRVATGSFLKRNPGVTEGYRFCPPKLEMFYKDDAAGDPQWSREQILESKMTHG--GLLIGPDEVDMMSKVTVCVFEILEKAWATLDCSLIDMKIEFGVNNKGEIVLADIIDSDSWRLWPSGDKRLMKDKQVYRDMAEVTEEGLALVKRNFEWVAERLDHLTPKPNCRAVVFMGSPSDFAFSQKIAETCQKYGLPCEMRVSSAHKGTDETLNILAQYEGENIPTVFIAVAGRSNGLGPVLSGNASWPVINCPPIKADWGNEDVWSSLRLPSGLGCSTVISPEAAGLMAAQIMSLHDHLIWSRLRANKLNTWLGLKKVDK 417          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Cavefish
Match: paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase [Source:ZFIN;Acc:ZDB-GENE-030131-9762])

HSP 1 Score: 454.907 bits (1169), Expect = 1.558e-150
Identity = 210/405 (51.85%), Postives = 290/405 (71.60%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK ++E+       L+ SKD+ITAG+ V++  M+GKA I+ KT + +F +L  +G K  +++Q+SD +F+A  C MIPIEWV RRIATGSFLKRNPGV EGY+F P+K E FFKDDAN+DP WS EQL++A+  +   +  I   ++ +MS++TVAIFEILEK W + NC L+DMKIEFG++  T E++LAD+ID+DSWRLWP GD+   KDKQVYRD+ EVT + ++ VK NF W+  ++  L +P   G++VV MGS +DM  C+++++    YGI C LRV S HK P E   I + YEG   P + +AVAGRSN LGP+++G +  PVINCPP+ P+W +QD+WSSL +PSGLGC+TVLS + A Q AA IL L+DH +W+K+R   L    +L ++D+
Sbjct:  605 GKTKQIFELPGEPGHVLVQSKDQITAGNAVRKDQMEGKAAIANKTTSCVFKLLQEAGVKTAFVRQHSDTAFVASHCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFSPLKLEMFFKDDANNDPQWSEEQLLAASFDLAGVS--IGRCEVDIMSKSTVAIFEILEKAWATQNCTLVDMKIEFGINVATKEVVLADVIDNDSWRLWPAGDRSQQKDKQVYRDLKEVTPEAMQMVKRNFEWVSERVQLLLEPQSSGRVVVLMGSTSDMAHCERIRKACSSYGIPCHLRVTSAHKGPDETLRIKAEYEGDGVPTIFVAVAGRSNGLGPVMSGNTAYPVINCPPVTPDWGAQDVWSSLRMPSGLGCSTVLSPDAAAQHAAQILGLTDHLIWAKLRASMLNTWTSLKQADK 1007          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Cavefish
Match: paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase [Source:ZFIN;Acc:ZDB-GENE-030131-9762])

HSP 1 Score: 453.366 bits (1165), Expect = 1.206e-149
Identity = 209/400 (52.25%), Postives = 286/400 (71.50%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFL-KPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNL 1339
            GKTK ++E+       L+ SKD+ITAG+ V++  M+GKA I+ KT + +F +L  +G K  +++Q+SD +F+A  C MIPIEWV RRIATGSFLKRNPGV EGY+F P+K E FFKDDAN+DP WS EQL++A+  +   +  I   ++ +MS++TVAIFEILEK W + NC L+DMKIEFG++  T E++LAD+ID+DSWRLWP GD+   KDKQVYRD+ EVT + ++ VK NF W+  ++  L +P   G++VV MGS +DM  C+++++    YGI C LRV S HK P E   I + YEG   P + +AVAGRSN LGP+++G +  PVINCPP+ P+W +QD+WSSL +PSGLGC+TVLS + A Q AA IL L+DH +W+K+R   L    +L
Sbjct:  624 GKTKQIFELPGEPGHVLVQSKDQITAGNAVRKDQMEGKAAIANKTTSCVFKLLQEAGVKTAFVRQHSDTAFVASHCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFSPLKLEMFFKDDANNDPQWSEEQLLAASFDLAGVS--IGRCEVDIMSKSTVAIFEILEKAWATQNCTLVDMKIEFGINVATKEVVLADVIDNDSWRLWPAGDRSQQKDKQVYRDLKEVTPEAMQMVKRNFEWVSERVQLLLEPQSSGRVVVLMGSTSDMAHCERIRKACSSYGIPCHLRVTSAHKGPDETLRIKAEYEGDGVPTIFVAVAGRSNGLGPVMSGNTAYPVINCPPVTPDWGAQDVWSSLRMPSGLGCSTVLSPDAAAQHAAQILGLTDHLIWAKLRASMLNTWTSL 1021          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004939.1 (pep scaffold:Pmarinus_7.0:GL488119:536:2311:-1 gene:ENSPMAG00000004485.1 transcript:ENSPMAT00000004939.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.432 bits (620), Expect = 9.057e-79
Identity = 111/216 (51.39%), Postives = 150/216 (69.44%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQ 790
            GKTK V+ +       L+ S+D ITAG+  +R  ++GKA +S +T   +F +L+  G +  ++K     +F+A++C M+PIEWV RR+ATGSFLKRNPGV EG +F   K E FFKDDAN+DP WS EQLV+A L   P  ++I   ++ VM+ TT A+FEILE+ W +  C L+DMK+EFGV   T EI+LAD+ID+DSWRLWP GD+R  KDKQ
Sbjct:   16 GKTKAVFAVDGQPGRVLVQSRDSITAGNAARRDHLEGKAALSNRTTTAVFALLNDVGIRTAFVKAQGKTAFLAERCDMVPIEWVCRRVATGSFLKRNPGVAEGLRFASPKLEIFFKDDANNDPQWSEEQLVAAQL--APAGRLIGTHEVAVMARTTQAVFEILERAWATQVCTLVDMKVEFGVSVTTKEILLADVIDNDSWRLWPAGDRRQQKDKQ 229          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Yeast
Match: ADE1 (N-succinyl-5-aminoimidazole-4-carboxamide ribotide synthetase; required for 'de novo' purine nucleotide biosynthesis; red pigment accumulates in mutant cells deprived of adenine; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000070])

HSP 1 Score: 55.0694 bits (131), Expect = 6.864e-9
Identity = 65/260 (25.00%), Postives = 101/260 (38.85%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKH---------------------HYIKQNSDVSFIAKKCSMIPIEWVARRIATGSF------------LKRNPGVNEGYKFC-PIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDE-TGEIILAD-IIDSDSWRLW-----PEGDKRLMKDKQVYRD 802
            GK + +YE+       L V+ D+I+A D +  + +  K  + TK +   F  LS     H                      Y  Q  D S +  K  +IP+E + R   TGS             LK+  G+ E  +F  PI   +   +   HD           N+      +++ E   + ++E  V ++   +         + D K EFG+DE T EIIL D ++  DS R W       G+ +   DKQ  RD
Sbjct:   18 GKVRDIYEV--DAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGEHD----------ENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRD 265          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Nematostella
Match: EDO29941 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T273])

HSP 1 Score: 431.409 bits (1108), Expect = 2.990e-149
Identity = 213/408 (52.21%), Postives = 282/408 (69.12%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDC--CLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIK--QNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTKIVY + DS D    L+ SKDKITA D  ++ +M GKA  ST T   IF++L   G K H++K  ++   +FI   C MIP+E V RRIATGSFLKR PGV EGY+F P KQE F KDDA HDP W+YEQ V A  +IG K   I + ++ +MSE+ +AIFEI+E+ W +++  L+DMKIEFGV+ +TGE++LAD++D+DSWR+WP GDKRLM+DKQVYR++ EVT + LEQVK N+ W+  +   L     G +VVFMGS +D+D CKK++     + + CDLRV+S HK   +   +L  YEG   PIV+IAVAGRSN LGP+L+G +  PVINCPP+   W ++D+WSSL +PSGLGCTT L+ + A  +AA IL L DH +W  +R  RL   V L  +D+
Sbjct:   10 GKTKIVYALPDSPDGNHVLLKSKDKITAFDATRKDEMSGKAAQSTATTCAIFEMLKACGLKTHFVKRCESDPEAFIGIACEMIPLEVVCRRIATGSFLKRYPGVKEGYRFTPPKQEFFLKDDAQHDPFWTYEQCVEAAFEIGGKK--IGKHELDIMSESAIAIFEIIERAWATVDVALVDMKIEFGVNRKTGELMLADVVDNDSWRIWPSGDKRLMRDKQVYRNLPEVTPEALEQVKKNYAWVAGESQKLNKHNPGHVVVFMGSASDIDHCKKIEAALKSFNVPCDLRVSSAHKGSEDTLKVLRVYEGQGVPIVIIAVAGRSNGLGPVLSGNTSFPVINCPPVSSGWGAEDVWSSLRLPSGLGCTTALNPDGAAAAAAQILGLHDHIIWGSLRAKRLNMAVGLREADD 415          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Medaka
Match: paics (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase [Source:NCBI gene;Acc:101171736])

HSP 1 Score: 446.432 bits (1147), Expect = 2.344e-147
Identity = 214/405 (52.84%), Postives = 289/405 (71.36%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD-ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLG-FLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDE 1354
            GKTK ++EI D     L+ SKD+ITAG+  ++  M+GKA ++ KT + +F +L  SG K  ++KQ+SD +FIA  C MIPIEWV RR+ATGSFLKRNPGV EG++F P+K E FFKDDAN+DP WS EQL+ A   +      I   ++ +M+ +TVAIFEILE+ W + +C L+DMKIEFGV+ +T EI+LAD+ID+DSWRLWP GD+   KDKQVYRD+ EVT + ++ VK NF W+  ++   L+P + G++VV MGS +DM  C+K+K+  + +GI C LRV S HK P E   I + YEG   P V +AVAGRSN LGP+++G S  PVINCPPL P+W +QD+WSSL +PSGLGC+T+LS E A Q AA I  L++H +WSK+R   L   V+L ++D+
Sbjct:  590 GKTKQIFEIVDQPGLVLVQSKDQITAGNAARKDQMEGKAAMANKTTSCVFRLLQESGIKTAFVKQHSDTAFIAAHCEMIPIEWVCRRVATGSFLKRNPGVKEGFRFSPLKMEMFFKDDANNDPQWSEEQLLEAKFCLS--GLPIGRCEVDIMNRSTVAIFEILERAWATQDCTLVDMKIEFGVNVKTQEIVLADVIDNDSWRLWPSGDRSQQKDKQVYRDLKEVTPEAMQVVKRNFEWVAERVKMLLEPQVSGRVVVLMGSTSDMAHCEKIKKACVSFGISCSLRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNSTYPVINCPPLTPDWGAQDVWSSLRMPSGLGCSTILSPEAAAQFAAQIFGLTNHLVWSKVRASMLNTWVSLKQADQ 992          
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Planmine SMEST
Match: SMESG000056504.1 (SMESG000056504.1)

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 404/405 (99.75%), Postives = 404/405 (99.75%), Query Frame = 2
Query:  146 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDESA 1360
            GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWP GDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDESA
Sbjct:   16 GKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHDMQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWVARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSANLKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVDETGEIILADIIDSDSWRLWPGGDKRLMKDKQVYRDMSEVTNDGLEQVKLNFIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRVASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVINCPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLWSKIRGMRLEKHVNLIRSDESA 420          
The following BLAST results are available for this feature:
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAICS3.174e-15153.09phosphoribosylaminoimidazole carboxylase and phosp... [more]
PAICS3.174e-15153.09phosphoribosylaminoimidazole carboxylase and phosp... [more]
PAICS1.688e-15053.50phosphoribosylaminoimidazole carboxylase and phosp... [more]
PAICS5.815e-14852.43phosphoribosylaminoimidazole carboxylase and phosp... [more]
PAICS3.182e-12755.79phosphoribosylaminoimidazole carboxylase and phosp... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pacs-12.152e-12948.88Probable multifunctional protein ADE2 Phosphoribos... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Paics4.812e-15251.61gene:FBgn0020513 transcript:FBtr0333799[more]
Paics5.674e-15251.61gene:FBgn0020513 transcript:FBtr0073705[more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
paics1.294e-15952.84phosphoribosylaminoimidazole carboxylase, phosphor... [more]
paics1.294e-15952.84phosphoribosylaminoimidazole carboxylase, phosphor... [more]
paics1.294e-15952.84phosphoribosylaminoimidazole carboxylase, phosphor... [more]
paics1.181e-15252.97phosphoribosylaminoimidazole carboxylase, phosphor... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000016729.16.844e-15654.46phosphoribosylaminoimidazole carboxylase; phosphor... [more]
ENSXETT00000016742.13.900e-15554.46phosphoribosylaminoimidazole carboxylase; phosphor... [more]
ENSXETT00000031576.11.493e-15354.14phosphoribosylaminoimidazole carboxylase; phosphor... [more]
pld16.277e-8839.55phospholipase D1 [Source:Xenbase;Acc:XB-GENE-94846... [more]
pld19.162e-8839.55phospholipase D1 [Source:Xenbase;Acc:XB-GENE-94846... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Paics1.959e-14951.60phosphoribosylaminoimidazole carboxylase, phosphor... [more]
Paics1.959e-14951.60phosphoribosylaminoimidazole carboxylase, phosphor... [more]
Paics1.959e-14951.60phosphoribosylaminoimidazole carboxylase, phosphor... [more]
Paics5.953e-1043.08phosphoribosylaminoimidazole carboxylase, phosphor... [more]
Paics2.020e-845.61phosphoribosylaminoimidazole carboxylase, phosphor... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P38024|PUR6_CHICK4.775e-15251.85Multifunctional protein ADE2 OS=Gallus gallus OX=9... [more]
sp|Q9I7S8|PUR6_DROME5.687e-15151.61Multifunctional protein ADE2 OS=Drosophila melanog... [more]
sp|P22234|PUR6_HUMAN1.524e-15053.09Multifunctional protein ADE2 OS=Homo sapiens OX=96... [more]
sp|P51583|PUR6_RAT2.950e-14951.60Multifunctional protein ADE2 OS=Rattus norvegicus ... [more]
sp|Q5RB59|PUR6_PONAB5.313e-14952.35Multifunctional protein ADE2 OS=Pongo abelii OX=96... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131XVF99.667e-16957.43Putative phosphoribosylamidoimidazole-succinocarbo... [more]
K1RJ974.120e-16756.16Multifunctional protein ADE2 OS=Crassostrea gigas ... [more]
C3ZBE41.886e-16656.08AIRC domain-containing protein OS=Branchiostoma fl... [more]
G3MKE11.881e-16457.18AIRC domain-containing protein OS=Amblyomma macula... [more]
A0A1S3JJQ13.375e-16456.33multifunctional protein ADE2 isoform X2 OS=Lingula... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
paics1.558e-15051.85phosphoribosylaminoimidazole carboxylase, phosphor... [more]
paics1.206e-14952.25phosphoribosylaminoimidazole carboxylase, phosphor... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004939.19.057e-7951.39pep scaffold:Pmarinus_7.0:GL488119:536:2311:-1 gen... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ADE16.864e-925.00N-succinyl-5-aminoimidazole-4-carboxamide ribotide... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO299412.990e-14952.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
paics2.344e-14752.84phosphoribosylaminoimidazole carboxylase and phosp... [more]
back to top
BLAST of Phosphoribosylaminoimidazole-succinocarboxamide synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000056504.10.000e+099.75SMESG000056504.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024082 ID=SMED30024082|Name=Phosphoribosylaminoimidazole-succinocarboxamide synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1387bp
TTTAAAAACAAGTGGACTTTGTTAAACTCACAGTTAAATTTTTATTAGTT
TTTGGCTAAATTTTCATTTGAAAACCTTTTCGGATAAAATTTTTGTTATG
GCGTTAGTTGTTGAAAATATTGATGTCGAGGAAATAATAATTGAAGGGAA
AACTAAAATTGTTTATGAAATAAAAGATTCGAAAGATTGTTGTTTAATTG
TGTCAAAAGATAAAATAACTGCAGGAGATGGTGTTAAGCGACATGATATG
CAAGGAAAGGCTAAAATTAGTACAAAAACCGCTGCACATATATTCGATAT
CTTATCATTTTCTGGCTTCAAACACCACTATATTAAACAAAACTCTGATG
TCAGCTTCATTGCTAAAAAATGCTCGATGATTCCAATTGAATGGGTTGCT
CGAAGAATCGCCACTGGTTCGTTTTTAAAAAGAAATCCTGGAGTTAATGA
AGGGTATAAATTCTGTCCAATTAAACAGGAGACATTTTTTAAAGACGATG
CAAATCATGATCCATTGTGGTCTTATGAACAATTAGTTTCTGCAAATTTA
AAAATAGGACCTAAAAATAAAATAATAACCGAAAGAGATATTAAAGTTAT
GTCTGAAACAACTGTTGCGATTTTTGAAATACTTGAAAAATGTTGGAACA
GTTTAAATTGTCAATTAATTGACATGAAAATTGAATTTGGTGTTGATGAA
ACAGGAGAGATAATATTAGCTGACATTATTGATAGTGATTCTTGGAGATT
ATGGCCAGAGGGAGACAAGAGATTAATGAAAGATAAACAAGTTTATAGGG
ATATGTCTGAAGTAACTAATGATGGATTGGAACAAGTCAAATTGAATTTT
ATATGGATCGAAAATCAATTAGGTTTCTTGAAGCCAATAATTAAAGGAAA
AATTGTCGTTTTTATGGGATCCGTTGCTGACATGGACTTCTGTAAAAAAT
TAAAACAATTATCCTTAAAATACGGAATCGAGTGCGATCTTAGAGTTGCT
TCGGGTCATAAAGTTCCTGGTGAAGTTTCAAGTATTTTATCTACTTATGA
AGGAACATTGGAGCCAATAGTTCTTATTGCCGTTGCTGGTCGAAGTAATG
CGCTTGGTCCAATGTTAGCCGGAACTTCATGTTTACCGGTTATAAATTGT
CCACCATTAGGACCTGAATGGGTATCGCAGGATATATGGTCTAGTCTCCA
TGTTCCAAGTGGTTTAGGATGTACAACCGTTCTATCGGTTGAAAATGCAG
TGCAAAGCGCTGCTCATATTCTTGCTTTGTCGGATCATTTTCTTTGGTCC
AAAATTCGTGGAATGCGATTAGAAAAGCATGTCAATTTGATTAGATCGGA
TGAGTCGGCTTAAATTAAAATAAAATATATTTGTCGG
back to top

protein sequence of SMED30024082-orf-1

>SMED30024082-orf-1 ID=SMED30024082-orf-1|Name=SMED30024082-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=422bp
MALVVENIDVEEIIIEGKTKIVYEIKDSKDCCLIVSKDKITAGDGVKRHD
MQGKAKISTKTAAHIFDILSFSGFKHHYIKQNSDVSFIAKKCSMIPIEWV
ARRIATGSFLKRNPGVNEGYKFCPIKQETFFKDDANHDPLWSYEQLVSAN
LKIGPKNKIITERDIKVMSETTVAIFEILEKCWNSLNCQLIDMKIEFGVD
ETGEIILADIIDSDSWRLWPEGDKRLMKDKQVYRDMSEVTNDGLEQVKLN
FIWIENQLGFLKPIIKGKIVVFMGSVADMDFCKKLKQLSLKYGIECDLRV
ASGHKVPGEVSSILSTYEGTLEPIVLIAVAGRSNALGPMLAGTSCLPVIN
CPPLGPEWVSQDIWSSLHVPSGLGCTTVLSVENAVQSAAHILALSDHFLW
SKIRGMRLEKHVNLIRSDESA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR035893PurE_sf
IPR000031PurE_dom
IPR013816ATP_grasp_subdomain_2
IPR028923SAICAR_synt/ADE2_N
IPR018236SAICAR_synthetase_CS
Vocabulary: biological process
TermDefinition
GO:0006189'de novo' IMP biosynthetic process
GO:0006164purine nucleotide biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004639phosphoribosylaminoimidazolesuccinocarboxamide synthase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000031PurE domainSMARTSM01001AIRC_2coord: 266..413
e-value: 2.3E-16
score: 70.4
IPR000031PurE domainPFAMPF00731AIRCcoord: 267..409
e-value: 7.9E-32
score: 109.9
IPR035893PurE domain superfamilyGENE3DG3DSA:3.40.50.7700coord: 264..420
e-value: 2.0E-40
score: 139.7
IPR035893PurE domain superfamilySUPERFAMILYSSF52255N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)coord: 267..418
IPR028923SAICAR synthetase/ADE2, N-terminalPFAMPF01259SAICAR_syntcoord: 13..242
e-value: 4.5E-54
score: 183.7
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 92..237
e-value: 3.0E-78
score: 264.3
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 13..238
e-value: 3.0E-78
score: 264.3
NoneNo IPR availablePANTHERPTHR43599:SF2MULTIFUNCTIONAL PROTEIN ADE2coord: 5..418
NoneNo IPR availablePANTHERPTHR43599FAMILY NOT NAMEDcoord: 5..418
NoneNo IPR availableCDDcd01416SAICAR_synt_Ade5coord: 11..257
e-value: 5.83522E-147
score: 415.923
NoneNo IPR availableSUPERFAMILYSSF56104SAICAR synthase-likecoord: 6..257
IPR018236SAICAR synthetase, conserved sitePROSITEPS01058SAICAR_SYNTHETASE_2coord: 189..197
IPR018236SAICAR synthetase, conserved sitePROSITEPS01057SAICAR_SYNTHETASE_1coord: 93..107