Zinc finger protein

Overview
NameZinc finger protein
Smed IDSMED30024071
Length (bp)2777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein (SMED30024071) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein (SMED30024071) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein (SMED30024071) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein (SMED30024071) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024071

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024071SMESG000025574.1 SmedASXL_014042SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024071SMESG000025574.1 dd_Smed_v6_17476_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF529 (zinc finger protein 529 [Source:HGNC Symbol;Acc:HGNC:29328])

HSP 1 Score: 47.7506 bits (112), Expect = 6.042e-6
Identity = 23/54 (42.59%), Postives = 30/54 (55.56%), Query Frame = 3
Query: 1272 ENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +  +HF+CS C KSF+  A L +H  IH   K Y C  CGK +R+      HQR
Sbjct:   13 DGEKHFECSFCGKSFRVHAQLTRHQKIHTDEKTYKCMECGKDFRFHSQLTEHQR 66          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf384l (zinc finger protein 384 like [Source:ZFIN;Acc:ZDB-GENE-030616-498])

HSP 1 Score: 53.5286 bits (127), Expect = 9.363e-7
Identity = 41/129 (31.78%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C +SF+N +  + HI        + S  KP+   + + T    SH    L   +  H         G P       KC HC KSF + + L QH+ IH   K YTC YC K +R       H R
Sbjct:  271 HKCPHCSKSFANSSYLAQHIR-------IHSGAKPYTCSYCQKTFRQLSH----LQQHTRNH-------TEGKP------HKCPHCSKSFANSSYLAQHIRIHSGAKPYTCSYCQKTFRQLSHLQQHNR 375          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf384l (zinc finger protein 384 like [Source:ZFIN;Acc:ZDB-GENE-030616-498])

HSP 1 Score: 53.5286 bits (127), Expect = 9.363e-7
Identity = 41/129 (31.78%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C +SF+N +  + HI        + S  KP+   + + T    SH    L   +  H         G P       KC HC KSF + + L QH+ IH   K YTC YC K +R       H R
Sbjct:  271 HKCPHCSKSFANSSYLAQHIR-------IHSGAKPYTCSYCQKTFRQLSH----LQQHTRNH-------TEGKP------HKCPHCSKSFANSSYLAQHIRIHSGAKPYTCSYCQKTFRQLSHLQQHNR 375          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: znf384 (zinc finger protein 384 [Source:NCBI gene;Acc:448352])

HSP 1 Score: 53.5286 bits (127), Expect = 1.407e-6
Identity = 37/129 (28.68%), Postives = 59/129 (45.74%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C +SF+N +  + H+        + S  KP+   + +      SH    L   +  H +  +S+++ P       +KC HC K+F + + L QH+ IH   K Y C YC K +R       H R
Sbjct:  240 HKCPHCSKSFANSSYLAQHVR-------IHSGAKPYTCTYCQKAFRQLSH----LQQHTRIH-TKVHSIVSKP-------YKCPHCSKTFANSSYLHQHLRIHSGAKPYNCNYCQKAFRQLSHLQQHTR 349          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp384 (zinc finger protein 384 [Source:MGI Symbol;Acc:MGI:2443203])

HSP 1 Score: 50.8322 bits (120), Expect = 7.742e-6
Identity = 37/129 (28.68%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C ++F+N +  + HI        + S  KP+  +F + +    SH        S+ H             E  +  KC HC K+F + + L QH+ IH   K Y C YC K +R       H R
Sbjct:  241 HKCPHCSKTFANSSYLAQHIR-------IHSGAKPYSCNFCEKSFRQLSHLQQHTRIHSKMH------------TETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQLSHLQQHTR 350          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp384 (zinc finger protein 384 [Source:MGI Symbol;Acc:MGI:2443203])

HSP 1 Score: 50.8322 bits (120), Expect = 8.058e-6
Identity = 37/129 (28.68%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C ++F+N +  + HI        + S  KP+  +F + +    SH        S+ H             E  +  KC HC K+F + + L QH+ IH   K Y C YC K +R       H R
Sbjct:  257 HKCPHCSKTFANSSYLAQHIR-------IHSGAKPYSCNFCEKSFRQLSHLQQHTRIHSKMH------------TETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQLSHLQQHTR 366          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp384 (zinc finger protein 384 [Source:MGI Symbol;Acc:MGI:2443203])

HSP 1 Score: 50.8322 bits (120), Expect = 8.058e-6
Identity = 37/129 (28.68%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C ++F+N +  + HI        + S  KP+  +F + +    SH        S+ H             E  +  KC HC K+F + + L QH+ IH   K Y C YC K +R       H R
Sbjct:  257 HKCPHCSKTFANSSYLAQHIR-------IHSGAKPYSCNFCEKSFRQLSHLQQHTRIHSKMH------------TETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQLSHLQQHTR 366          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp384 (zinc finger protein 384 [Source:MGI Symbol;Acc:MGI:2443203])

HSP 1 Score: 50.8322 bits (120), Expect = 8.058e-6
Identity = 37/129 (28.68%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C ++F+N +  + HI        + S  KP+  +F + +    SH        S+ H             E  +  KC HC K+F + + L QH+ IH   K Y C YC K +R       H R
Sbjct:  257 HKCPHCSKTFANSSYLAQHIR-------IHSGAKPYSCNFCEKSFRQLSHLQQHTRIHSKMH------------TETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQLSHLQQHTR 366          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A3P7MUT2 (C2H2-type domain-containing protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS14870 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.043e-28
Identity = 103/286 (36.01%), Postives = 135/286 (47.20%), Query Frame = 3
Query: 1062 CQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIEN----------SRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTCKKRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLGNTS-----NLSNTLHTQV-SMPHPQNKASP-----------PNLIMNGTNP--FMQHPL----INFPNKPSFQPLFPGSNGFS-------CICGQRIDNFPAYLTHINYCPVF 1799
            C+R+F  + +   H  +C+   +L S         +  +     +    +    ER L   + V+ G   +           SR FKC HC+KSFKSKALLDQHMHIHYPPKYTC+YC KKYRWPPVFYHHQRTCKKRP A  +  SS +     +L TS+++   A +     +      + S TL  Q+ S P P +   P           P L  N TNP  F+  P     I  PN      L    +  S       C CG   D+ P YL+HI  C +F
Sbjct:  100 CERAFEEIEQFLAHTRECST--MLASV--------MNISPPNPPNPACTVESSQERTLPDNDRVVGGTTADGKAANLAVTDLSRPFKCCHCVKSFKSKALLDQHMHIHYPPKYTCRYCAKKYRWPPVFYHHQRTCKKRPPATTTCPSSINGNPTEALRTSASSGLMAGSHLCAPSRASTQHSQSPTLRFQLPSFPSPTSGMVPLPTLPSVSLPNPLLFYNSTNPSNFLGFPANPNSIGAPN------LLESGSAESKMQAPARCTCGTEFDSLPYYLSHIGQCRLF 369          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A3S5AM91 (C2H2-type domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS17109 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 3.059e-27
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 3
Query: 1254 INGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTCKKRP 1448
            +N PP + SR F+C HC+KSFKSKALLDQHMHIHYPPKYTC+YC KKYRWPPVFYHHQRTCKKRP
Sbjct:  515 LNAPPPDLSRPFRCCHCVKSFKSKALLDQHMHIHYPPKYTCRYCAKKYRWPPVFYHHQRTCKKRP 579          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A5K4FCW3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.864e-26
Identity = 61/78 (78.21%), Postives = 63/78 (80.77%), Query Frame = 3
Query: 1245 NSVINGPP------IEN----SRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTCKKRP 1448
            NSV N PP      IEN    SR FKC HCIK+FKSKALLDQHMHIHYPPKYTC+YC KKYRWPPVFYHHQRTCKKRP
Sbjct:  736 NSVNNLPPTPTTTSIENITDLSRPFKCCHCIKAFKSKALLDQHMHIHYPPKYTCRYCAKKYRWPPVFYHHQRTCKKRP 813          

HSP 2 Score: 112.464 bits (280), Expect = 2.899e-21
Identity = 52/71 (73.24%), Postives = 58/71 (81.69%), Query Frame = 3
Query: 2346 KSCNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSCIASKDSIGSPVPSPIMTDM 2558
            KSC  CGKEFSSRLSLKQH+EGKHSTEGKY CP C+KRYRWGASYYYHKKSC A ++   SPV S I+  +
Sbjct: 1467 KSCYHCGKEFSSRLSLKQHVEGKHSTEGKYCCPGCSKRYRWGASYYYHKKSCPAVREQ--SPVSSDIVNQL 1535          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A183QMS0 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.938e-26
Identity = 61/77 (79.22%), Postives = 63/77 (81.82%), Query Frame = 3
Query: 1245 NSVINGPP-----IEN----SRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTCKKRP 1448
            NSV N PP     IEN    SR FKC HCIK+FKSKALLDQHMHIHYPPKYTC+YC KKYRWPPVFYHHQRTCKKRP
Sbjct:  489 NSVNNLPPPTTTSIENITDLSRPFKCCHCIKAFKSKALLDQHMHIHYPPKYTCRYCAKKYRWPPVFYHHQRTCKKRP 565          

HSP 2 Score: 107.842 bits (268), Expect = 6.077e-20
Identity = 50/63 (79.37%), Postives = 54/63 (85.71%), Query Frame = 3
Query: 2346 KSCNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSCIASKDSIGSPV 2534
            KSC  CGKEFSSRLSLKQH+EGKHSTEGKY CP C+KRYRWGASYYYHKKSC A ++   SPV
Sbjct:  809 KSCYHCGKEFSSRLSLKQHVEGKHSTEGKYCCPGCSKRYRWGASYYYHKKSCPAVREQ--SPV 869          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A183STN7 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS7585 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 4.805e-26
Identity = 52/57 (91.23%), Postives = 54/57 (94.74%), Query Frame = 3
Query: 1278 SRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTCKKRP 1448
            SR FKC HC+KSFKSKALLDQHMHIHYPPKYTC+YC KKYRWPPVFYHHQRTCKKRP
Sbjct:  531 SRPFKCCHCVKSFKSKALLDQHMHIHYPPKYTCRYCAKKYRWPPVFYHHQRTCKKRP 587          

HSP 2 Score: 113.235 bits (282), Expect = 1.544e-21
Identity = 47/56 (83.93%), Postives = 51/56 (91.07%), Query Frame = 3
Query: 2352 CNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSCIASKDS 2519
            C++CGKEFSSRLSLKQH+EGKHS EGKYQCP C KRYRWGASYYYHKKSC A +DS
Sbjct: 1239 CSKCGKEFSSRLSLKQHVEGKHSAEGKYQCPGCAKRYRWGASYYYHKKSCAAVRDS 1294          

HSP 3 Score: 71.2478 bits (173), Expect = 1.121e-8
Identity = 29/54 (53.70%), Postives = 37/54 (68.52%), Query Frame = 3
Query:  660 CPECKFICSNKILLLEHFDCEHKESGSFSCTCGHLNDWLPSFLRHYIVCKIAAT 821
            CPECK   +N I LL HF+  H   G+FSC CG   +WLP+FL HY++C +AAT
Sbjct:  293 CPECKVSTTNHIQLLRHFEAVHGVYGTFSCICGSGFEWLPAFLSHYLLCSMAAT 346          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000047017.1 (zinc finger E-box-binding homeobox 2-like [Source:NCBI gene;Acc:103034067])

HSP 1 Score: 55.4546 bits (132), Expect = 3.013e-7
Identity = 36/120 (30.00%), Postives = 52/120 (43.33%), Query Frame = 3
Query: 1053 CPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIEN----SRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKY 1397
            CP+CQRS+   T    H+  C ++    S               P    + P     E+HL+    V N  P+       R F+CS C+K+FK K  L +H+ IH   K Y C  C K++
Sbjct:  211 CPFCQRSYGCETSLGEHMKLCQVREGGSSV-------------CPLCGYSTPYRAQMEQHLALHAQVQNKNPVSEPNMEKRKFQCSQCLKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 317          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000057984.1 (zinc finger E-box-binding homeobox 2-like [Source:NCBI gene;Acc:103034067])

HSP 1 Score: 55.0694 bits (131), Expect = 3.587e-7
Identity = 36/120 (30.00%), Postives = 53/120 (44.17%), Query Frame = 3
Query: 1053 CPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIEN----SRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKY 1397
            CP+CQRS+   T    H+  C ++                S+  P    + P     E+HL+    V N  P+       R F+CS C+K+FK K  L +H+ IH   K Y C  C K++
Sbjct:  138 CPFCQRSYGCETSLGEHMKLCQVREG-------------GSSVCPLCGYSTPYRAQMEQHLALHAQVQNKNPVSEPNMEKRKFQCSQCLKAFKYKHHLKEHLRIHSGEKPYECPNCKKRF 244          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: znf646 (zinc finger protein 646-like [Source:NCBI gene;Acc:103039858])

HSP 1 Score: 53.9138 bits (128), Expect = 9.362e-7
Identity = 38/128 (29.69%), Postives = 54/128 (42.19%), Query Frame = 3
Query: 1053 CPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLS-PFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIH-YPPKYTCKYCGKKYRWPPVFYHHQR 1430
            C  C  +FS   + +NHI  C+ +P   +  +  G      +N P      P       R    A S++N      + HF CS C K F +   L  H  IH    KY C  CGK +R   + Y+HQ+
Sbjct: 1102 CKQCSLAFSTADQLANHI--CSKQPDTHAAHEQNG-----KSNAPAVKEERPFKCNICGRSYRHAGSLLNHKNTHKTGHFTCSFCAKPFSNPMALRNHTRIHTQKKKYVCPICGKAFRLSSILYNHQK 1222          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: znf384l (zinc finger protein 384 [Source:NCBI gene;Acc:103027624])

HSP 1 Score: 53.1434 bits (126), Expect = 1.280e-6
Identity = 39/129 (30.23%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C +SF+N +  + HI        + S  KP+   + + +    SH    L   +  H               S+  KC HC KSF + + L QH+ IH   K YTC YC K +R       H R
Sbjct:  264 HKCPHCSKSFANSSYLAQHIR-------IHSGAKPYTCSYCQKSFRQLSH----LQQHTRNHT-------------ESKPHKCPHCSKSFANSSYLSQHIRIHSGAKPYTCSYCQKTFRQLSHLQQHHR 368          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: znf384l (zinc finger protein 384 [Source:NCBI gene;Acc:103027624])

HSP 1 Score: 53.1434 bits (126), Expect = 1.376e-6
Identity = 39/129 (30.23%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C +SF+N +  + HI        + S  KP+   + + +    SH    L   +  H               S+  KC HC KSF + + L QH+ IH   K YTC YC K +R       H R
Sbjct:  334 HKCPHCSKSFANSSYLAQHIR-------IHSGAKPYTCSYCQKSFRQLSH----LQQHTRNHT-------------ESKPHKCPHCSKSFANSSYLSQHIRIHSGAKPYTCSYCQKTFRQLSHLQQHHR 438          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: si:ch211-154o6.2 (zinc finger protein 384 [Source:NCBI gene;Acc:101157483])

HSP 1 Score: 53.1434 bits (126), Expect = 1.109e-6
Identity = 39/129 (30.23%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C +SF+N +  + HI        + S  KP+   + + +    SH    L   +  H               S+  KC HC KSF + + L QH+ IH   K YTC YC K +R       H R
Sbjct:  240 HKCPHCAKSFANSSYLAQHIR-------IHSGAKPYTCSYCQKSFRQLSH----LQQHTRNHT-------------ESKPHKCPHCTKSFANSSYLAQHIRIHTGVKPYTCSYCQKSFRQLSHLQQHSR 344          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: znf384l (zinc finger protein 384 [Source:NCBI gene;Acc:101167968])

HSP 1 Score: 51.2174 bits (121), Expect = 5.224e-6
Identity = 38/129 (29.46%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C +SF+N +  S HI        + S  KP+   + + T    SH    L   +  H               ++  KC HC KSF + + L QH+ IH   K Y+C +C K +R       H R
Sbjct:  274 HKCPHCSKSFANSSYLSQHIR-------IHSGAKPYTCTYCQKTFRQLSH----LQQHTRNHT-------------EAKPHKCPHCSKSFANSSYLSQHIRIHTGAKPYSCSFCQKTFRQLSHLQQHTR 378          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: znf384l (zinc finger protein 384 [Source:NCBI gene;Acc:101167968])

HSP 1 Score: 51.2174 bits (121), Expect = 5.224e-6
Identity = 38/129 (29.46%), Postives = 55/129 (42.64%), Query Frame = 3
Query: 1047 NKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKYRWPPVFYHHQR 1430
            +KCP C +SF+N +  S HI        + S  KP+   + + T    SH    L   +  H               ++  KC HC KSF + + L QH+ IH   K Y+C +C K +R       H R
Sbjct:  274 HKCPHCSKSFANSSYLSQHIR-------IHSGAKPYTCTYCQKTFRQLSH----LQQHTRNHT-------------EAKPHKCPHCSKSFANSSYLSQHIRIHTGAKPYSCSFCQKTFRQLSHLQQHTR 378          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000025013.2 (zinc finger E-box-binding homeobox 2 [Source:NCBI gene;Acc:101167278])

HSP 1 Score: 51.2174 bits (121), Expect = 5.317e-6
Identity = 39/121 (32.23%), Postives = 55/121 (45.45%), Query Frame = 3
Query: 1053 CPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPP-----IENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKY 1397
            CP+C+R +  +T    HI   +     K  D+ F       T   F  S++      +RH++T       PP      EN R FKCS C K+FK K  L +H+ IH   K Y C  C K++
Sbjct:  105 CPYCERGYKRLTSLKEHIMNRH-----KRNDESFACQLCTGT---FDSSSLL-----DRHMTTHKLGREKPPPLSEEAEN-RKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 211          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000031578.1 (zinc finger E-box-binding homeobox 2 [Source:NCBI gene;Acc:101167278])

HSP 1 Score: 51.2174 bits (121), Expect = 5.708e-6
Identity = 39/121 (32.23%), Postives = 55/121 (45.45%), Query Frame = 3
Query: 1053 CPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPP-----IENSRHFKCSHCIKSFKSKALLDQHMHIHYPPK-YTCKYCGKKY 1397
            CP+C+R +  +T    HI   +     K  D+ F       T   F  S++      +RH++T       PP      EN R FKCS C K+FK K  L +H+ IH   K Y C  C K++
Sbjct:  163 CPYCERGYKRLTSLKEHIMNRH-----KRNDESFACQLCTGT---FDSSSLL-----DRHMTTHKLGREKPPPLSEEAEN-RKFKCSECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRF 269          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000025574.1 (SMESG000025574.1)

HSP 1 Score: 1419.83 bits (3674), Expect = 0.000e+0
Identity = 795/840 (94.64%), Postives = 802/840 (95.48%), Query Frame = 3
Query:   42 MTSIDIFNNYSDILAHWKTQHHHQLPTTDEHQKPIKLEMSEDEISNLGKNSLKLEFDYPISGMPNETENSNNRSGLSLRENGYDIKNVLNIDNNDELGISNSIEESAMKRIKCFCEEEFFNILDLISHLKTCQQGREIKWNPFLKWTXXXXXXXXXXXXXNKVQSVSSSTSEALDLSKKSPALEQVEASIKEPIMIDGKLETVKWHCPECKFICSNKILLLEHFDCEHKESGSFSCTCGHLNDWLPSFLRHYIVCKIAATDLQEEHKDEINFQTDSNFHNFDIDFINKVSTTHSNLSKFYNNRXXXXXXXXXXXXXXXXNGWLEPCKIDIPMSFQNKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTCKKRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLGNTSNLSNTLHTQVSMPHPQNKASPPNLIMNGTNPFMQHPLINFPNKPSFQPLFPGSNGFSCICGQRIDNFPAYLTHINYCPVFIHMSSKPCPENSPVHPNNSPINSFNFKSINSGLDHNPFLHPTGLLLRPPIQTPYFNPGFHQSALKPKVSPPIPNQTTTISSNFLQSTDPIMVAFASPINSQKNPAFMTDAFXXXXXXXXXXXXXXXXXXXXXXXXINSKNTLLPAIANFDRLLSHEMARIPLQNSPTFNPTLHPHHHFFGIGKSCNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSCIASKDSIGSPVPSPIMTDMI 2561
            MTSIDIFNNYSDILAHWKTQHHHQLPTTDEHQKPIKLEMSEDEISNLGKNSLKLEFDYPISGMPNETENSNNRSGLSLRENGYDIKNVLNIDNNDELG++NSIEESAMKRIKCFCEEEFFNILDLISHLKTCQQGREIKWNPFLKWTPESLEPLSVEESPNKVQSVSSSTSEALDLSKKSPALEQVEASIKEPIMIDGKLETVKWHCPECKFICSNKILLLEHFDCEHKESGSFSCTCGHLNDWLPSFLRHYIVCKIAATDLQEEHKDEINFQTDSNFHNFDIDFINKVSTTHSNLSKFYNNRLDLSFGLLSGLSHQFLNGWLEPCKIDIPMSFQNKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTCKKRPAALISSTSSSSAGCLTSLSTSSTTITTASTSYLGNTSNLSNTLHTQVSMPHPQNKASPPNLIMNGTNPFMQHPLINFPNKPSFQP+FPGSNGFSCICGQRIDNFPAYLTHINYCPVFIHMSSKPC ENSPVHPNNSPINSFNFKSINSGLDHNPFLHPTGL+                    P VS               ++ +PIMVAFASPINSQKNPAFMTDAFSLNLNSNSSTSNSNASPNSSLTTNINSKNTLLPAIANFDRLLSHEMARIPLQNSPTFNPTLHPHHHFFGIGKSCNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSCIASKDSIGSPVPSPIMTDMI
Sbjct:    1 MTSIDIFNNYSDILAHWKTQHHHQLPTTDEHQKPIKLEMSEDEISNLGKNSLKLEFDYPISGMPNETENSNNRSGLSLRENGYDIKNVLNIDNNDELGMANSIEESAMKRIKCFCEEEFFNILDLISHLKTCQQGREIKWNPFLKWTPESLEPLSVEESPNKVQSVSSSTSEALDLSKKSPALEQVEASIKEPIMIDGKLETVKWHCPECKFICSNKILLLEHFDCEHKESGSFSCTCGHLNDWLPSFLRHYIVCKIAATDLQEEHKDEINFQTDSNFHNFDIDFINKVSTTHSNLSKFYNNRLDLSFGLLSGLSHQFLNGWLEPCKIDIPMSFQNKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTCKKRPAALISSTSSSSAGCLTSLSTSSTTITTASTSYLGNTSNLSNTLHTQVSMPHPQNKASPPNLIMNGTNPFMQHPLINFPNKPSFQPIFPGSNGFSCICGQRIDNFPAYLTHINYCPVFIHMSSKPCLENSPVHPNNSPINSFNFKSINSGLDHNPFLHPTGLI--------------------PSVS--------------FKTKNPIMVAFASPINSQKNPAFMTDAFSLNLNSNSSTSNSNASPNSSLTTNINSKNTLLPAIANFDRLLSHEMARIPLQNSPTFNPTLHPHHHFFGIGKSCNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSCIASKDSIGSPVPSPIMTDMI 806          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000067419.1 (SMESG000067419.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.001e-31
Identity = 85/272 (31.25%), Postives = 129/272 (47.43%), Query Frame = 3
Query:  651 KWHCPECKFICSNKILLLEHFDCEHKESGSFSCTCGHLNDWLPSFLRHYIVCKIAATDL-QEEHKDEINFQTDSNFHNFDID-----FINKVSTTHSNLSKFYNNRXXXXXXXXXXXXXXXXNGWLEPCKIDIPMSFQNKCPWCQRSFSNVTEASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFS-HSTIPLSPFSERHLSTANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTCKKR 1445
            ++ CPECK++ S++  +  HFD  H  SG+F CTC    + +  FL HYI+C IAATDL Q    DE  F+   +  + + +     F ++   THS       N                          D+P+ F N                N +   + +P++  F        + S NM +S HS     P S   + T++      P    + ++C HC K+FKSK LLDQH H+H+PP++ C+YCG+++RWPP FY H++ C KR
Sbjct:  111 RFVCPECKYMSSSQKEIENHFDECHDLSGTFPCTCNQCFNSMSHFLAHYIICPIAATDLLQNSFNDEQQFEETESIQDEEKEPSEPVFESRSPLTHSTEQTPIQNEDSD----------------------DLPLDFANPI--------------NLVKSESKEPIMADFS-------INSMNMDYSSHSDKACLPIS---IQTSSPNSQDQPKRTGKVYECEHCEKNFKSKGLLDQHKHLHFPPRHECEYCGRRFRWPPQFYTHKQQCSKR 336          

HSP 2 Score: 67.3958 bits (163), Expect = 2.915e-11
Identity = 37/94 (39.36%), Postives = 51/94 (54.26%), Query Frame = 3
Query: 2226 LPAIANFDRL-LSHEMARIPLQNSPTFNPTLHPHHHFFGIGKSCNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSCI 2504
             P ++N D + L+  +    +  +PT   TL     F      C+ C   F +++SLKQH++GKHS + KY C  C K Y W ASY YHKK CI
Sbjct:  465 FPVLSNADNVGLTQTLPAGAV--APTQTNTLQDEKPF-----ECDFCESRFMTKISLKQHLDGKHSDQAKYCCEKCGKGYFWNASYNYHKKKCI 551          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000000427.1 (SMESG000000427.1)

HSP 1 Score: 67.781 bits (164), Expect = 4.841e-12
Identity = 29/56 (51.79%), Postives = 39/56 (69.64%), Query Frame = 3
Query: 2337 GIGK-SCNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSC 2501
            G GK  C++C K F+S LSL+QH +G H   GKY C  C+++YRW  S++YHKK C
Sbjct:  201 GDGKYECSRCNKSFTSILSLRQHWDGIHREHGKYICDKCSRKYRWATSFHYHKKKC 256          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000000427.1 (SMESG000000427.1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.887e-12
Identity = 29/56 (51.79%), Postives = 39/56 (69.64%), Query Frame = 3
Query: 2337 GIGK-SCNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSC 2501
            G GK  C++C K F+S LSL+QH +G H   GKY C  C+++YRW  S++YHKK C
Sbjct:  199 GDGKYECSRCNKSFTSILSLRQHWDGIHREHGKYICDKCSRKYRWATSFHYHKKKC 254          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000024007.1 (SMESG000024007.1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.206e-10
Identity = 75/290 (25.86%), Postives = 112/290 (38.62%), Query Frame = 3
Query:  639 LETVKWHCPECKFICSNKILLLEHFDCEHKESGSFSCTCGHLNDWLPSFLRHYIVCKIAATDLQEEHKDEINFQTDSNFHNFDIDFINKVSTTHSNLSKFYNNRXXXXXXXXXXXXXXXXNGWLEPCKIDIPMSFQNKCPWCQRSFSNVTEASNH------ISQCNIKPL-LKSFD-KPFGIDFLKSTNMPFSHSTIPLSPFSERHL------------STANSVINGPPIE----NSRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGKKYRWPPVFYHHQRTC 1436
            LE  K  C +C    S +  L +H++  H +   F C+CG     L  FL+H   C +  T+L+ E  ++     + N    ++    +V     N                            E C      S       C+++ S+ +  SN+      +S+ NIKP+ LKS   K F I F         H T+  + + E               ST +S     P++    ++  F C  C KSF S   L QH      PKY CK CGK YRW   F++H+R C
Sbjct:   98 LEYTKIECKDCHEKFSLESELSKHYEIYHVQPNQFKCSCGDNFQCLQLFLQHKFFCSVLKTNLKLEKTNDRKRCWEGNMKEQNM---KRVKVYELNC---------------------------ETCGRKFRTSSALYLHECRKTKSDDSHQSNNSPSKMPVSKENIKPIELKSQQVKSFEIKFT-------CHCTVEFNDYYEYSSHCNKCGKTDVLDSTISSTKRSSPLKILPNDNGKFDCEDCDKSFSSILSLRQHRD---EPKYVCKVCGKGYRWCTSFHYHKRKC 347          

HSP 2 Score: 53.1434 bits (126), Expect = 5.017e-7
Identity = 26/54 (48.15%), Postives = 32/54 (59.26%), Query Frame = 3
Query: 2352 CNQCGKEFSSRLSLKQHIEGKHSTEGKYQCPSCNKRYRWGASYYYHKKSCIASK 2513
            C  C K FSS LSL+QH +     E KY C  C K YRW  S++YHK+ C + K
Sbjct:  303 CEDCDKSFSSILSLRQHRD-----EPKYVCKVCGKGYRWCTSFHYHKRKCDSEK 351          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZNF5296.042e-642.59zinc finger protein 529 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
znf384l9.363e-731.78zinc finger protein 384 like [Source:ZFIN;Acc:ZDB-... [more]
znf384l9.363e-731.78zinc finger protein 384 like [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf3841.407e-628.68zinc finger protein 384 [Source:NCBI gene;Acc:4483... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zfp3847.742e-628.68zinc finger protein 384 [Source:MGI Symbol;Acc:MGI... [more]
Zfp3848.058e-628.68zinc finger protein 384 [Source:MGI Symbol;Acc:MGI... [more]
Zfp3848.058e-628.68zinc finger protein 384 [Source:MGI Symbol;Acc:MGI... [more]
Zfp3848.058e-628.68zinc finger protein 384 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Zinc finger protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7MUT22.043e-2836.01C2H2-type domain-containing protein (Fragment) OS=... [more]
A0A3S5AM913.059e-2783.08C2H2-type domain-containing protein (Fragment) OS=... [more]
A0A5K4FCW33.864e-2678.21Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183QMS03.938e-2679.22Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A183STN74.805e-2691.23Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047017.13.013e-730.00zinc finger E-box-binding homeobox 2-like [Source:... [more]
ENSAMXT00000057984.13.587e-730.00zinc finger E-box-binding homeobox 2-like [Source:... [more]
znf6469.362e-729.69zinc finger protein 646-like [Source:NCBI gene;Acc... [more]
znf384l1.280e-630.23zinc finger protein 384 [Source:NCBI gene;Acc:1030... [more]
znf384l1.376e-630.23zinc finger protein 384 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-154o6.21.109e-630.23zinc finger protein 384 [Source:NCBI gene;Acc:1011... [more]
znf384l5.224e-629.46zinc finger protein 384 [Source:NCBI gene;Acc:1011... [more]
znf384l5.224e-629.46zinc finger protein 384 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000025013.25.317e-632.23zinc finger E-box-binding homeobox 2 [Source:NCBI ... [more]
ENSORLT00000031578.15.708e-632.23zinc finger E-box-binding homeobox 2 [Source:NCBI ... [more]
back to top
BLAST of Zinc finger protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025574.10.000e+094.64SMESG000025574.1[more]
SMESG000067419.11.001e-3131.25SMESG000067419.1[more]
SMESG000000427.14.841e-1251.79SMESG000000427.1[more]
SMESG000000427.14.887e-1251.79SMESG000000427.1[more]
SMESG000024007.15.206e-1025.86SMESG000024007.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024071 ID=SMED30024071|Name=Zinc finger protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2777bp
TCTTAAAATTCTAACACGAAAGAAGCTTTAATGAACCTTTTATGACTTCG
ATAGATATTTTCAACAACTATTCCGATATTTTGGCTCATTGGAAAACTCA
GCATCATCATCAGTTACCAACAACCGACGAGCATCAGAAACCGATCAAGC
TCGAAATGAGTGAGGATGAAATTTCGAATTTGGGGAAAAATTCACTCAAG
TTAGAATTTGATTATCCCATATCCGGAATGCCGAACGAAACGGAGAATTC
CAACAATCGGTCGGGATTATCGTTGCGTGAAAACGGATACGACATCAAAA
ATGTACTCAATATTGACAACAACGATGAGTTGGGAATCTCAAATTCAATT
GAGGAAAGCGCAATGAAGAGGATTAAATGTTTCTGCGAAGAAGAGTTTTT
CAATATACTCGATTTAATATCACACTTGAAAACCTGTCAACAAGGAAGAG
AAATCAAATGGAACCCGTTTTTGAAATGGACACCAGAATCTTTGGAACCA
TTGTCGGTGGAGGAAAGTCCAAATAAAGTCCAATCAGTCAGCTCCAGTAC
TTCAGAGGCTTTGGATTTGAGTAAAAAATCTCCGGCTTTGGAACAAGTAG
AAGCATCGATAAAAGAACCGATAATGATTGATGGGAAACTTGAAACAGTT
AAGTGGCACTGTCCAGAGTGCAAATTTATATGTAGCAATAAAATCCTGTT
ACTTGAACACTTTGATTGCGAACACAAAGAAAGTGGCTCATTTTCCTGTA
CTTGTGGCCATTTGAACGACTGGTTACCGTCATTCCTTAGACATTATATT
GTCTGTAAAATAGCAGCAACCGACCTTCAAGAAGAACACAAAGATGAAAT
CAATTTCCAAACCGATTCAAACTTTCACAACTTTGACATTGATTTTATAA
ACAAAGTCTCAACGACCCATTCAAATTTGTCAAAATTTTACAACAATCGA
CTAGATTTATCGTTTGGCCTTCTGTCAGGTTTGTCACATCAGTTTCTCAA
TGGTTGGTTAGAACCTTGTAAAATAGATATTCCGATGTCCTTTCAAAACA
AATGTCCATGGTGCCAGCGTTCCTTCTCTAACGTTACAGAAGCCTCTAAT
CACATCAGTCAGTGCAATATCAAACCCTTATTGAAATCCTTTGATAAGCC
GTTTGGTATTGACTTCTTAAAATCTACTAATATGCCATTTTCACACTCCA
CCATTCCATTATCACCATTTTCAGAGCGTCATTTATCGACGGCTAACTCA
GTTATTAATGGACCACCTATAGAAAACTCAAGGCACTTCAAATGTAGTCA
CTGTATTAAATCTTTTAAGTCTAAAGCTTTGCTAGATCAGCATATGCATA
TTCATTATCCTCCAAAATACACCTGCAAATACTGCGGTAAAAAATACAGA
TGGCCTCCTGTATTTTATCACCATCAAAGAACGTGTAAAAAACGACCAGC
GGCTTTAATTTCATCAACATCTTCATCGTCAGCCGGATGCTTAACTTCCT
TATCAACATCGTCAACGACCATTACAACAGCTTCCACTTCGTATTTAGGA
AATACATCCAATCTTTCTAATACATTACATACTCAAGTTTCAATGCCCCA
TCCCCAAAATAAAGCCTCGCCACCTAATTTAATAATGAATGGAACGAATC
CATTTATGCAACATCCTCTGATTAATTTTCCCAACAAACCCTCATTCCAA
CCTCTCTTTCCAGGCAGTAATGGTTTCTCGTGTATTTGTGGACAGAGAAT
CGACAATTTCCCAGCATACCTTACCCATATAAACTACTGTCCAGTTTTTA
TTCACATGAGTTCCAAACCCTGTCCTGAAAATTCTCCAGTCCATCCAAAC
AACTCTCCAATTAATTCCTTCAATTTCAAATCCATAAATTCAGGATTGGA
CCATAATCCTTTTTTACATCCAACAGGACTGTTGCTGAGACCACCCATTC
AAACGCCATATTTCAATCCAGGATTCCATCAGTCAGCTTTAAAACCAAAA
GTGAGTCCACCGATACCTAATCAAACAACTACAATTTCATCAAATTTTCT
TCAATCAACAGATCCCATCATGGTGGCCTTCGCTTCCCCGATAAACTCCC
AAAAGAATCCAGCTTTCATGACAGATGCCTTCTCACTAAATCTAAATTCC
AACAGTTCAACTTCCAATTCCAACGCAAGTCCAAATTCTTCATTGACAAC
TAATATTAATTCCAAAAACACACTCCTTCCAGCAATTGCTAACTTTGACC
GATTGCTTTCCCATGAAATGGCTCGGATCCCATTGCAAAACAGTCCGACA
TTCAATCCGACCCTTCATCCTCATCATCATTTTTTCGGAATCGGCAAATC
ATGCAACCAATGCGGCAAAGAATTCAGCAGCAGACTTTCACTGAAACAAC
ACATTGAAGGTAAGCATAGCACCGAGGGTAAATATCAGTGTCCCAGTTGC
AACAAACGATACAGATGGGGCGCATCCTACTACTATCATAAAAAGTCATG
CATAGCCTCGAAGGATTCCATTGGTTCCCCTGTTCCGAGTCCAATAATGA
CCGACATGATCTATGACTGAAATAATTTATATTTTTTTATTTATTATTAT
TTATCATATTTAAATTTATATTTACTTCTCCTTGCTTTCAAATCTAGACC
ACCAAAAAAACGACCTGTACACCATAGCAATGCTAATAACATGAATTTTA
CAGTCACATATAAATATATCATACATTTAGTATCCAATGTTGGTCTCATA
ATCTTTTGTACATTTTATGATTGACAG
back to top

protein sequence of SMED30024071-orf-1

>SMED30024071-orf-1 ID=SMED30024071-orf-1|Name=SMED30024071-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=843bp
MTSIDIFNNYSDILAHWKTQHHHQLPTTDEHQKPIKLEMSEDEISNLGKN
SLKLEFDYPISGMPNETENSNNRSGLSLRENGYDIKNVLNIDNNDELGIS
NSIEESAMKRIKCFCEEEFFNILDLISHLKTCQQGREIKWNPFLKWTPES
LEPLSVEESPNKVQSVSSSTSEALDLSKKSPALEQVEASIKEPIMIDGKL
ETVKWHCPECKFICSNKILLLEHFDCEHKESGSFSCTCGHLNDWLPSFLR
HYIVCKIAATDLQEEHKDEINFQTDSNFHNFDIDFINKVSTTHSNLSKFY
NNRLDLSFGLLSGLSHQFLNGWLEPCKIDIPMSFQNKCPWCQRSFSNVTE
ASNHISQCNIKPLLKSFDKPFGIDFLKSTNMPFSHSTIPLSPFSERHLST
ANSVINGPPIENSRHFKCSHCIKSFKSKALLDQHMHIHYPPKYTCKYCGK
KYRWPPVFYHHQRTCKKRPAALISSTSSSSAGCLTSLSTSSTTITTASTS
YLGNTSNLSNTLHTQVSMPHPQNKASPPNLIMNGTNPFMQHPLINFPNKP
SFQPLFPGSNGFSCICGQRIDNFPAYLTHINYCPVFIHMSSKPCPENSPV
HPNNSPINSFNFKSINSGLDHNPFLHPTGLLLRPPIQTPYFNPGFHQSAL
KPKVSPPIPNQTTTISSNFLQSTDPIMVAFASPINSQKNPAFMTDAFSLN
LNSNSSTSNSNASPNSSLTTNINSKNTLLPAIANFDRLLSHEMARIPLQN
SPTFNPTLHPHHHFFGIGKSCNQCGKEFSSRLSLKQHIEGKHSTEGKYQC
PSCNKRYRWGASYYYHKKSCIASKDSIGSPVPSPIMTDMIYD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 205..228
e-value: 2.0
score: 17.4
coord: 443..463
e-value: 23.0
score: 10.1
coord: 416..438
e-value: 0.012
score: 24.8
coord: 336..356
e-value: 76.0
score: 5.5
coord: 798..818
e-value: 71.0
score: 5.7
coord: 769..792
e-value: 0.0045
score: 26.2
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 418..438
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 771..792
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 416..443
score: 11.302
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 769..797
score: 11.406
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 391..474
e-value: 5.8E-9
score: 37.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 770..819
e-value: 8.6E-9
score: 37.7
NoneNo IPR availablePANTHERPTHR24406FAMILY NOT NAMEDcoord: 7..819
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 414..464
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 770..818