RalA-binding protein 1

Overview
NameRalA-binding protein 1
Smed IDSMED30024063
Length (bp)2840
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RalA-binding protein 1 (SMED30024063) t-SNE clustered cells

Violin plots show distribution of expression levels for RalA-binding protein 1 (SMED30024063) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RalA-binding protein 1 (SMED30024063) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RalA-binding protein 1 (SMED30024063) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024063

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024063SMESG000043489.1 SMESG000016870.1 SMESG000016869.1 dd_Smed_v4_2322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024063SMESG000043489.1 SMESG000016870.1 SMESG000016869.1 dd_Smed_v4_2322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024063SMESG000043489.1 SMESG000016870.1 SMESG000016869.1 dd_Smed_v4_2322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024063SMESG000043489.1 SMESG000016870.1 SMESG000016869.1 dd_Smed_v4_2322_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RalA-binding protein 1 vs. Ensembl Human
Match: RALBP1 (ralA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9841])

HSP 1 Score: 140.584 bits (353), Expect = 7.569e-34
Identity = 88/262 (33.59%), Postives = 151/262 (57.63%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            +PIFG+ L +A + +  +DG  LPA FR+CI+Y+E    +  EGIYR+ G+ S++ +LK   + + +T+  L +++   + S++K +LRDL   L+ K L     +A  +  E   ++V   +++L + LPE N  L++ +  HM  VI    + KM+++N+ IVLSP + +   +L +F+ H  ++F ++     + P+R         LPET  GI EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  187 KPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYG-MKCEGIYRVSGIKSKVDELKAAYDREESTN--LEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTET--EKVQEFQRLLKE-LPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRK 442          
BLAST of RalA-binding protein 1 vs. Ensembl Human
Match: RALBP1 (ralA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9841])

HSP 1 Score: 140.584 bits (353), Expect = 7.569e-34
Identity = 88/262 (33.59%), Postives = 151/262 (57.63%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            +PIFG+ L +A + +  +DG  LPA FR+CI+Y+E    +  EGIYR+ G+ S++ +LK   + + +T+  L +++   + S++K +LRDL   L+ K L     +A  +  E   ++V   +++L + LPE N  L++ +  HM  VI    + KM+++N+ IVLSP + +   +L +F+ H  ++F ++     + P+R         LPET  GI EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  187 KPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYG-MKCEGIYRVSGIKSKVDELKAAYDREESTN--LEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTET--EKVQEFQRLLKE-LPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRK 442          
BLAST of RalA-binding protein 1 vs. Ensembl Human
Match: ARHGAP26 (Rho GTPase activating protein 26 [Source:HGNC Symbol;Acc:HGNC:17073])

HSP 1 Score: 78.1814 bits (191), Expect = 1.819e-14
Identity = 51/151 (33.77%), Postives = 86/151 (56.95%), Query Frame = 2
Query:  515 AFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLL-----NTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +  R+CI+ +ET   ++ +G+YRI GVNS++ KL  +L      ++  TD + + ++I  ITS +K++LR L   L+    + S  KA +   EN + RV  +   L   LPE+N+ +L L+ +H+  V +   QN M++ NL +V  P L
Sbjct:   10 SIIRKCIHAVETRG-INEQGLYRIVGVNSRVQKLLSVLMDPKTASETETD-ICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKL--ENQESRVSEIHS-LVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTL 155          
BLAST of RalA-binding protein 1 vs. Ensembl Human
Match: ARHGAP21 (Rho GTPase activating protein 21 [Source:HGNC Symbol;Acc:HGNC:23725])

HSP 1 Score: 78.1814 bits (191), Expect = 3.246e-14
Identity = 56/172 (32.56%), Postives = 85/172 (49.42%), Query Frame = 2
Query:  452 FGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNT-----DINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            FGV L +      +H    +P     C   +E +  L + GIYR+PG N+ I  +++ LN      DI  DK     D+ VI+S++KSF R L   L      A   +A    KE+  DR+  +K+++   LPE +   L  +++H+  V + S +NKM   NL IV  P L
Sbjct:  238 FGVRLDDC---PPAHTNRYIPLIVDICCKLVE-ERGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWR---DLNVISSLLKSFFRKLPEPLFTNDKYADFIEA--NRKEDPLDRLKTLKRLI-HDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTL 399          
BLAST of RalA-binding protein 1 vs. Ensembl Human
Match: ARHGAP26 (Rho GTPase activating protein 26 [Source:HGNC Symbol;Acc:HGNC:17073])

HSP 1 Score: 78.1814 bits (191), Expect = 4.066e-14
Identity = 51/151 (33.77%), Postives = 86/151 (56.95%), Query Frame = 2
Query:  515 AFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLL-----NTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +  R+CI+ +ET   ++ +G+YRI GVNS++ KL  +L      ++  TD + + ++I  ITS +K++LR L   L+    + S  KA +   EN + RV  +   L   LPE+N+ +L L+ +H+  V +   QN M++ NL +V  P L
Sbjct:  355 SIIRKCIHAVETRG-INEQGLYRIVGVNSRVQKLLSVLMDPKTASETETD-ICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKL--ENQESRVSEIHS-LVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTL 500          
BLAST of RalA-binding protein 1 vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 82.0333 bits (201), Expect = 1.889e-16
Identity = 60/187 (32.09%), Postives = 95/187 (50.80%), Query Frame = 2
Query:  413 IEPIKEVGLTRP--IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFG 967
            +E +KE G+ +P  +FG +L   C+    H+   +P F R     +E+   L  +GIYR+ G  S + K++   + D N   L+S  DI V+T  +K F R+L   L   SL      A++    N   R    +++L++ LP EN+  L ++  H+ +V   S+QN+M   NL IV  P L  H G
Sbjct:   77 VESLKEKGIYKPEPVFGSTLSAICQ----HENSLVPKFIRVITEVIESKG-LETDGIYRVSGNLSAVQKIRCQADQD-NYKALVSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQM--PNATTRFKKFEELLSR-LPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTL-FHNG 253          
BLAST of RalA-binding protein 1 vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 82.4185 bits (202), Expect = 8.867e-16
Identity = 60/188 (31.91%), Postives = 95/188 (50.53%), Query Frame = 2
Query:  410 VIEPIKEVGLTRP--IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFG 967
             +E +KE G+ +P  +FG +L   C+    H+   +P F R     +E+   L  +GIYR+ G  S + K++   + D N   L+S  DI V+T  +K F R+L   L   SL      A++    N   R    +++L++ LP EN+  L ++  H+ +V   S+QN+M   NL IV  P L  H G
Sbjct:  593 TVESLKEKGIYKPEPVFGSTLSAICQ----HENSLVPKFIRVITEVIESKG-LETDGIYRVSGNLSAVQKIRCQADQD-NYKALVSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQM--PNATTRFKKFEELLSR-LPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTL-FHNG 770          
BLAST of RalA-binding protein 1 vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 82.4185 bits (202), Expect = 9.113e-16
Identity = 60/188 (31.91%), Postives = 95/188 (50.53%), Query Frame = 2
Query:  410 VIEPIKEVGLTRP--IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFG 967
             +E +KE G+ +P  +FG +L   C+    H+   +P F R     +E+   L  +GIYR+ G  S + K++   + D N   L+S  DI V+T  +K F R+L   L   SL      A++    N   R    +++L++ LP EN+  L ++  H+ +V   S+QN+M   NL IV  P L  H G
Sbjct:  595 TVESLKEKGIYKPEPVFGSTLSAICQ----HENSLVPKFIRVITEVIESKG-LETDGIYRVSGNLSAVQKIRCQADQD-NYKALVSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQM--PNATTRFKKFEELLSR-LPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTL-FHNG 772          
BLAST of RalA-binding protein 1 vs. Ensembl Celegans
Match: chin-1 (CHImaeriN (Rac-GTPase-activating protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q965N4])

HSP 1 Score: 73.9442 bits (180), Expect = 1.550e-13
Identity = 54/169 (31.95%), Postives = 88/169 (52.07%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKAL-EQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +FGV +   C    +H G  LP     CI  +E+   L  EGIYR+ G    + KLKQ  +++   D L +  DI  +  ++K + R L  +LI  S+   L  A  E ++ +  +R   ++K++ + L + N   L  + +H+ KV D S +NKM++ENL  + SP L
Sbjct:  231 MFGVDITTLCM---AH-GADLPPIVPLCIGEVESRG-LDVEGIYRVSGSYDHMEKLKQQFDSNQYVD-LATVCDIHTVCGLLKLYFRLLPQQLIPFSVHKQLLVAYQETNQRSTHERERQIRKVMME-LSDANIITLGAVLAHLKKVADHSAKNKMTVENLATIFSPTL 392          
BLAST of RalA-binding protein 1 vs. Ensembl Celegans
Match: cyk-4 (CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q9XUS9])

HSP 1 Score: 68.1662 bits (165), Expect = 2.391e-11
Identity = 56/186 (30.11%), Postives = 95/186 (51.08%), Query Frame = 2
Query:  410 VIEPIKEVGLTRPIFG-VSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPG-VNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLH 961
            ++ P   +   +P  G   L++ C ++K      +PA    C+  LE    L+ EGIYR+PG V +  V L +L +  +    L    D+ VIT  +K FLRDLK  LI ++    L  A   +  +  +    + +++ + LP+ N+  LA +  H  KVI  S++NKM+ E +  +++PA+  H
Sbjct:  406 MMTPKSALRGAKPGAGEFRLQDFCTSAKPM----IPAAVIHCVVALEARG-LTQEGIYRVPGQVRTVNVLLDELRSKTVPNVGL---HDVEVITDTLKRFLRDLKDPLIPRTSRQELIVAANLYSTDPDNGRLALNRVICE-LPQANRDTLAYLFIHWRKVIAQSSRNKMNCEAMARMVAPAVMGH 582          
BLAST of RalA-binding protein 1 vs. Ensembl Fly
Match: Rlip (gene:FBgn0026056 transcript:FBtr0336772)

HSP 1 Score: 143.28 bits (360), Expect = 4.520e-35
Identity = 90/265 (33.96%), Postives = 148/265 (55.85%), Query Frame = 2
Query:  431 VGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            + L  P+FGVS+  A + S+ HDG  +P   R CI++L+  + L  E IY+I  + ++++  K+L N +   D  +   ++    S++K FLR+L   L+   L A  F+ +  H +    +  +  + L + LP+ N+ LLA +  H   VI     NK++ ++L ++LSP L +   L+     H +++F+D+Q   YVPP+        +LP+T E I  EL+KQ S L  +H ++N GF TK  E  +WEVQ I+T+LKRK
Sbjct:  179 LALGYPVFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQ--DHLKCEQIYKIEPIKTRLMHFKRLYN-NREHDSAVDELNLPTACSLLKLFLRELPEPLLTTDLVAR-FEEVASHPKVTTQQAEL--QQLLEQLPKCNRTLLAWVLLHFDAVIQQERHNKLNAQSLAMLLSPTLQMSHRLMVALLCHCNNLFADVQLIKYVPPL---TSTSPKLPDTPEDIQTELRKQDSLLSQIHSEMNAGFITKKREEQLWEVQRIITQLKRK 434          
BLAST of RalA-binding protein 1 vs. Ensembl Fly
Match: Rlip (gene:FBgn0026056 transcript:FBtr0084002)

HSP 1 Score: 142.895 bits (359), Expect = 5.035e-35
Identity = 90/265 (33.96%), Postives = 148/265 (55.85%), Query Frame = 2
Query:  431 VGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            + L  P+FGVS+  A + S+ HDG  +P   R CI++L+  + L  E IY+I  + ++++  K+L N +   D  +   ++    S++K FLR+L   L+   L A  F+ +  H +    +  +  + L + LP+ N+ LLA +  H   VI     NK++ ++L ++LSP L +   L+     H +++F+D+Q   YVPP+        +LP+T E I  EL+KQ S L  +H ++N GF TK  E  +WEVQ I+T+LKRK
Sbjct:  180 LALGYPVFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQ--DHLKCEQIYKIEPIKTRLMHFKRLYN-NREHDSAVDELNLPTACSLLKLFLRELPEPLLTTDLVAR-FEEVASHPKVTTQQAEL--QQLLEQLPKCNRTLLAWVLLHFDAVIQQERHNKLNAQSLAMLLSPTLQMSHRLMVALLCHCNNLFADVQLIKYVPPL---TSTSPKLPDTPEDIQTELRKQDSLLSQIHSEMNAGFITKKREEQLWEVQRIITQLKRK 435          
BLAST of RalA-binding protein 1 vs. Ensembl Fly
Match: RhoGAP68F (gene:FBgn0036257 transcript:FBtr0334091)

HSP 1 Score: 83.1889 bits (204), Expect = 2.471e-16
Identity = 56/165 (33.94%), Postives = 87/165 (52.73%), Query Frame = 2
Query:  452 FGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSP 946
            FGV LK    NS   +   +P   R+C++ L     +  EGI+R  G +S+I+ LK+ +N   + D  L + ++ VI  ++KSFLRDL   L+   L   +   L+  KE   +R   V +++ + LPEEN  L   I   + +V+D  + NKM+  NL IV  P
Sbjct:  217 FGVPLKFIVMNSPCLNS--IPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVD--LKSVNVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKE---ERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGP 374          
BLAST of RalA-binding protein 1 vs. Ensembl Fly
Match: RhoGAP68F (gene:FBgn0036257 transcript:FBtr0334093)

HSP 1 Score: 83.1889 bits (204), Expect = 3.600e-16
Identity = 56/165 (33.94%), Postives = 87/165 (52.73%), Query Frame = 2
Query:  452 FGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSP 946
            FGV LK    NS   +   +P   R+C++ L     +  EGI+R  G +S+I+ LK+ +N   + D  L + ++ VI  ++KSFLRDL   L+   L   +   L+  KE   +R   V +++ + LPEEN  L   I   + +V+D  + NKM+  NL IV  P
Sbjct:  273 FGVPLKFIVMNSPCLNS--IPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVD--LKSVNVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKE---ERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGP 430          
BLAST of RalA-binding protein 1 vs. Ensembl Fly
Match: RhoGAP68F (gene:FBgn0036257 transcript:FBtr0075997)

HSP 1 Score: 83.1889 bits (204), Expect = 3.683e-16
Identity = 56/165 (33.94%), Postives = 87/165 (52.73%), Query Frame = 2
Query:  452 FGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSP 946
            FGV LK    NS   +   +P   R+C++ L     +  EGI+R  G +S+I+ LK+ +N   + D  L + ++ VI  ++KSFLRDL   L+   L   +   L+  KE   +R   V +++ + LPEEN  L   I   + +V+D  + NKM+  NL IV  P
Sbjct:  274 FGVPLKFIVMNSPCLNS--IPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVD--LKSVNVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKE---ERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGP 431          
BLAST of RalA-binding protein 1 vs. Ensembl Zebrafish
Match: ralbp1 (ralA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2098])

HSP 1 Score: 142.124 bits (357), Expect = 2.042e-34
Identity = 93/270 (34.44%), Postives = 152/270 (56.30%), Query Frame = 2
Query:  422 IKEVGLT-RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            I EV +T RPIFG  L EA + +  +DG  LPA FR+C++Y+E+   +  EGIYR+ G+ S++ +LK     D      L  +D   + S++K +LR+L   L+ K L     +A  +  E   +++   +++LT+ +P  ++ LLA + +HM  VI      KM+++N+ IVL+P + +   +L +F+ H  ++F D+     V P+R         LP+T E I EE+++Q   L+ LH  +  G +  + E  +WEVQ IVT LKRK
Sbjct:  172 ITEVTVTFRPIFGAPLVEAVRRTALYDGIQLPAIFRECVDYIESYG-MKCEGIYRVSGMKSKVDELKAAY--DREECPCLEEYDPHTVASLLKQYLRELPDNLLGKELSLRFEEACGRPSEA--EKLQEFQRLLTE-VPAGSRLLLAWLITHMDHVIAREADTKMNIQNISIVLNPTIQISNRVLYVFFTHVREMFGDVFLKPVVHPLRWSNMATMPTLPDTQESIKEEIRRQEFLLNRLHRDLQAGVKDLSKEERLWEVQRIVTALKRK 435          
BLAST of RalA-binding protein 1 vs. Ensembl Zebrafish
Match: ophn1 (oligophrenin 1 [Source:ZFIN;Acc:ZDB-GENE-040718-464])

HSP 1 Score: 82.8037 bits (203), Expect = 1.176e-15
Identity = 54/152 (35.53%), Postives = 82/152 (53.95%), Query Frame = 2
Query:  518 FFRQCINYLETDNRLSFEGIYRIPGVNSQIVKL-------KQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            F R+CIN++ET   L+ EG+YR  G N Q+ KL       K   + D N+    S+ DI  ITS +K +LR L   L+  SL   L   L    EN+  R+G V  ++ + LPE N+ +L L+  H+  V   S++N M++ N+ ++  P L
Sbjct:  390 FVRKCINFVETKG-LTQEGVYRTVGSNIQVQKLLNAFFDSKCPADVDFNS----SDMDIKTITSALKFYLRSLSEPLMTYSLHGELI--LAAKSENLDYRLGAVHSLVYK-LPERNREMLELLIKHLVSVCSHSSENLMTVSNMGVIFGPTL 533          
BLAST of RalA-binding protein 1 vs. Ensembl Zebrafish
Match: arhgap35a (Rho GTPase activating protein 35a [Source:ZFIN;Acc:ZDB-GENE-120516-2])

HSP 1 Score: 78.1814 bits (191), Expect = 4.668e-14
Identity = 51/180 (28.33%), Postives = 91/180 (50.56%), Query Frame = 2
Query:  425 KEVGLTRP----IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            ++  L++P     FGV L       +     P+P F  +CI+Y+ET   LS EGIYR+ G  +++  +++  + D N D +  +  +  +   +KSF  +L   L+  S++  L +A + +  + + R+  +K +L +  P EN  +   + +H+ KV   S  N M+ ENL I   P L
Sbjct: 1253 RQTSLSKPPESNYFGVPLANVVTPER-----PIPLFIEKCIHYIETTG-LSTEGIYRVSGNKAEMESMQRQFDQDPNIDLVEKDMSVNTVAGALKSFFSELPDPLVPYSMQVELVEAFKIN--DREHRLHTMKDVL-RRFPRENYDVFKYVITHLNKVSLNSRLNLMTSENLSICFWPTL 1423          
BLAST of RalA-binding protein 1 vs. Ensembl Zebrafish
Match: arhgap35a (Rho GTPase activating protein 35a [Source:ZFIN;Acc:ZDB-GENE-120516-2])

HSP 1 Score: 78.1814 bits (191), Expect = 4.668e-14
Identity = 51/180 (28.33%), Postives = 91/180 (50.56%), Query Frame = 2
Query:  425 KEVGLTRP----IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            ++  L++P     FGV L       +     P+P F  +CI+Y+ET   LS EGIYR+ G  +++  +++  + D N D +  +  +  +   +KSF  +L   L+  S++  L +A + +  + + R+  +K +L +  P EN  +   + +H+ KV   S  N M+ ENL I   P L
Sbjct: 1253 RQTSLSKPPESNYFGVPLANVVTPER-----PIPLFIEKCIHYIETTG-LSTEGIYRVSGNKAEMESMQRQFDQDPNIDLVEKDMSVNTVAGALKSFFSELPDPLVPYSMQVELVEAFKIN--DREHRLHTMKDVL-RRFPRENYDVFKYVITHLNKVSLNSRLNLMTSENLSICFWPTL 1423          
BLAST of RalA-binding protein 1 vs. Ensembl Zebrafish
Match: arhgap35b (Rho GTPase activating protein 35b [Source:ZFIN;Acc:ZDB-GENE-060526-44])

HSP 1 Score: 74.3294 bits (181), Expect = 6.405e-13
Identity = 45/149 (30.20%), Postives = 77/149 (51.68%), Query Frame = 2
Query:  506 PLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            P+P F  +CI Y+E    L+ EGIYR+ G  ++I  +++    D N D +  +F +  +   +KSF  +L   L+  S +  L +A + +  + + R+  +K +L +  P EN  +   + SH+ KV   +  N M+ ENL I   P L
Sbjct: 1275 PIPVFIDKCIRYIEATG-LTTEGIYRVSGNKAEIEGMQRQFEQDHNLDFVEKDFTVNTVAGAMKSFFSELPDPLVPYSSQEELVEAFKIN--DREQRLHTMKDVL-RRFPRENFDVFKYVMSHLNKVGQWNRVNLMTSENLSICFWPTL 1419          
BLAST of RalA-binding protein 1 vs. Ensembl Xenopus
Match: chrm3 (cholinergic receptor, muscarinic 3 [Source:Xenbase;Acc:XB-GENE-940647])

HSP 1 Score: 139.813 bits (351), Expect = 1.126e-33
Identity = 90/272 (33.09%), Postives = 154/272 (56.62%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXX-XXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPE 1255
            RP+FG+ L EA + +  +DG  LPA FR+CI+Y+E    +  EGIYR+ G+ S++ +LK   +   + +  L +++   + S++K +LR+L   ++ K L     +A  +  E   +R+   +++L + LPE N  L + +  HM  VI+   + KM+++N+ IVLSP + +   +L +F+ H  ++F  +Q    + P+R         LPET E I EE+++Q   L+ LH ++  G +  + E  +WEVQ I+T LKRK   A+  D E
Sbjct:  182 RPMFGIPLVEAAERTMMYDGIRLPAVFRECIDYIEQHG-MKCEGIYRVSGIKSKVDELKAAYDRGESPN--LEDYEPYTVASLLKQYLRELPENVLTKDLMPRFEEACGKSTEG--ERLQECQRLLKE-LPECNFCLTSWLIVHMDHVIEKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGGIQIKRVIKPLRWSNMATMPTLPETQETIKEEIRRQEFLLNCLHRELQAGIKDLSKEERLWEVQRILTALKRKLREAKRQDCE 447          
BLAST of RalA-binding protein 1 vs. Ensembl Xenopus
Match: chrm3 (cholinergic receptor, muscarinic 3 [Source:Xenbase;Acc:XB-GENE-940647])

HSP 1 Score: 139.428 bits (350), Expect = 1.934e-33
Identity = 90/272 (33.09%), Postives = 154/272 (56.62%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXX-XXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPE 1255
            RP+FG+ L EA + +  +DG  LPA FR+CI+Y+E    +  EGIYR+ G+ S++ +LK   +   + +  L +++   + S++K +LR+L   ++ K L     +A  +  E   +R+   +++L + LPE N  L + +  HM  VI+   + KM+++N+ IVLSP + +   +L +F+ H  ++F  +Q    + P+R         LPET E I EE+++Q   L+ LH ++  G +  + E  +WEVQ I+T LKRK   A+  D E
Sbjct:  182 RPMFGIPLVEAAERTMMYDGIRLPAVFRECIDYIEQHG-MKCEGIYRVSGIKSKVDELKAAYDRGESPN--LEDYEPYTVASLLKQYLRELPENVLTKDLMPRFEEACGKSTEG--ERLQECQRLLKE-LPECNFCLTSWLIVHMDHVIEKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGGIQIKRVIKPLRWSNMATMPTLPETQETIKEEIRRQEFLLNCLHRELQAGIKDLSKEERLWEVQRILTALKRKLREAKRQDCE 447          
BLAST of RalA-binding protein 1 vs. Ensembl Xenopus
Match: bora (bora, aurora kinase A activator [Source:Xenbase;Acc:XB-GENE-5865524])

HSP 1 Score: 77.0258 bits (188), Expect = 1.485e-13
Identity = 46/155 (29.68%), Postives = 78/155 (50.32%), Query Frame = 2
Query:  506 PLPAFFRQCINYLE-TDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKA-----LEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            P+P F  +C+ Y+E T   ++ EGIYR+ G  S++  L++  + D N D    +F +  +   +KSF  +L   L+  +++A L +A     LE   + M+D        L +  P+EN  +   + SH+ +V    + N M+ ENL I   P L
Sbjct: 1247 PIPVFIEKCVEYIEATGEGMTTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGALKSFFSELPDPLVPYNMQAELVEAYKINDLEHKLQAMKD--------LLKKFPKENHEIFKYVISHLNRVSQHHHINLMTSENLSICFWPTL 1393          
BLAST of RalA-binding protein 1 vs. Ensembl Xenopus
Match: fadd (Fas associated via death domain [Source:Xenbase;Acc:XB-GENE-1001300])

HSP 1 Score: 75.485 bits (184), Expect = 2.566e-13
Identity = 50/148 (33.78%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  518 FFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLL---NTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            F R+CIN +E    ++ EG+YR  G N Q+ KL           N D   S +DI  ITS +K +LR+L   ++   L   L   L    EN+  R+G +   L   LPE ++ +L LI  H+ +V + S +N MS  N+ ++  P L
Sbjct:  384 FVRKCINAVEATG-ITSEGVYRTVGSNIQVQKLLNAFFDPKCPGNVDLQNSEWDIKTITSSLKFYLRNLSEPVMTYKLHRDL--VLASKSENLDYRLGAI-HCLVYRLPENHREMLELIIRHLSRVCEFSRENLMSPSNMGVIFGPTL 527          
BLAST of RalA-binding protein 1 vs. Ensembl Xenopus
Match: tox3 (TOX high mobility group box family member 3 [Source:Xenbase;Acc:XB-GENE-5887160])

HSP 1 Score: 73.9442 bits (180), Expect = 2.725e-13
Identity = 56/187 (29.95%), Postives = 95/187 (50.80%), Query Frame = 2
Query:  413 IEPIKEVGLTR-PIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNF-DIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQ-----DRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            ++ ++E GL +  +FG  L   C    S     +P F   CI  +  +  L  +GIYR+ G  + I KL+ +++ +   D   S++ D+ VIT  +K F R+L   LI        F   EQ+ E +Q     +R+  +K +++  LPE N   L  + SH+ +V++ S  N+M+ +N+ IV  P L
Sbjct:  140 LQTLQEKGLIKDQVFGCRLDALCHRENS----TVPKFVCMCIEAV-NERGLEADGIYRVNGNLATIQKLRFIVDREEKLDLSTSDWEDVHVITGALKMFFRELPEPLIP-------FSMFEQYVEAVQIPDLDERIETIKDLVST-LPEPNHDTLKHMLSHLKRVMEHSETNRMTTQNIGIVFGPTL 313          
BLAST of RalA-binding protein 1 vs. Ensembl Mouse
Match: Ralbp1 (ralA binding protein 1 [Source:MGI Symbol;Acc:MGI:108466])

HSP 1 Score: 133.65 bits (335), Expect = 1.003e-31
Identity = 85/262 (32.44%), Postives = 146/262 (55.73%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            +PIFGV L +A + +  +DG  LPA FR+C++Y+E    +  EG+YR+ G+ S++ +LK   + + + +  L  ++   + S++K +LRDL   L+ K L     +A  +  E   ++V   +++L + LPE N  LL+ +  H+  VI    + KM+++N+ IVLSP + +   +L + + H  ++F  +       P+R         LPET  GI EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  187 KPIFGVPLVDAVERTMMYDGVRLPAVFRECVDYMEKHG-MKCEGVYRVSGIKSKVDELKAAYDREESPN--LEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGKTTE--MEKVQEFQRLL-RELPECNHLLLSWLIVHLDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVLFTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRK 442          
BLAST of RalA-binding protein 1 vs. Ensembl Mouse
Match: Ralbp1 (ralA binding protein 1 [Source:MGI Symbol;Acc:MGI:108466])

HSP 1 Score: 133.65 bits (335), Expect = 1.003e-31
Identity = 85/262 (32.44%), Postives = 146/262 (55.73%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            +PIFGV L +A + +  +DG  LPA FR+C++Y+E    +  EG+YR+ G+ S++ +LK   + + + +  L  ++   + S++K +LRDL   L+ K L     +A  +  E   ++V   +++L + LPE N  LL+ +  H+  VI    + KM+++N+ IVLSP + +   +L + + H  ++F  +       P+R         LPET  GI EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  187 KPIFGVPLVDAVERTMMYDGVRLPAVFRECVDYMEKHG-MKCEGVYRVSGIKSKVDELKAAYDREESPN--LEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGKTTE--MEKVQEFQRLL-RELPECNHLLLSWLIVHLDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVLFTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRK 442          
BLAST of RalA-binding protein 1 vs. Ensembl Mouse
Match: Ralbp1 (ralA binding protein 1 [Source:MGI Symbol;Acc:MGI:108466])

HSP 1 Score: 97.0561 bits (240), Expect = 3.233e-20
Identity = 56/171 (32.75%), Postives = 100/171 (58.48%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALH 955
            +PIFGV L +A + +  +DG  LPA FR+C++Y+E    +  EG+YR+ G+ S++ +LK   + + + +  L  ++   + S++K +LRDL   L+ K L     +A  +  E   ++V   +++L + LPE N  LL+ +  H+  VI    + KM+++N+ IVLSP + 
Sbjct:  187 KPIFGVPLVDAVERTMMYDGVRLPAVFRECVDYMEKHG-MKCEGVYRVSGIKSKVDELKAAYDREESPN--LEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGKTTE--MEKVQEFQRLLRE-LPECNHLLLSWLIVHLDHVIAKELETKMNIQNISIVLSPTVQ 351          
BLAST of RalA-binding protein 1 vs. Ensembl Mouse
Match: Arhgap27 (Rho GTPase activating protein 27 [Source:MGI Symbol;Acc:MGI:1916903])

HSP 1 Score: 82.0333 bits (201), Expect = 1.830e-15
Identity = 53/169 (31.36%), Postives = 85/169 (50.30%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNF-DIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +FG +L + C+  +S    P+P F +QCI  +E    L  +G+YRI G  + I KL+  ++ D   D     + D+ VIT  +K F R+L   L   S       A++      + R     + L + LP  NQ  L L+  H+ +VI+   QN+M+++N+ IV  P L
Sbjct:  475 VFGCALAQLCERERS----PVPRFVQQCIRTVEARG-LDIDGLYRISGNLATIQKLRYKVDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFHQFIAAIKLQDPAQRSR---CVRDLVRTLPAPNQDTLRLLIQHLCRVIEHGEQNRMTVQNVAIVFGPTL 635          
BLAST of RalA-binding protein 1 vs. Ensembl Mouse
Match: Arhgap27 (Rho GTPase activating protein 27 [Source:MGI Symbol;Acc:MGI:1916903])

HSP 1 Score: 81.6481 bits (200), Expect = 3.138e-15
Identity = 53/169 (31.36%), Postives = 85/169 (50.30%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNF-DIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +FG +L + C+  +S    P+P F +QCI  +E    L  +G+YRI G  + I KL+  ++ D   D     + D+ VIT  +K F R+L   L   S       A++      + R     + L + LP  NQ  L L+  H+ +VI+   QN+M+++N+ IV  P L
Sbjct:  674 VFGCALAQLCERERS----PVPRFVQQCIRTVEARG-LDIDGLYRISGNLATIQKLRYKVDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFHQFIAAIKLQDPAQRSR---CVRDLVRTLPAPNQDTLRLLIQHLCRVIEHGEQNRMTVQNVAIVFGPTL 834          
BLAST of RalA-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9VDG2|RLIP_DROME (RalA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Rlip PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 5.047e-34
Identity = 90/265 (33.96%), Postives = 148/265 (55.85%), Query Frame = 2
Query:  431 VGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            + L  P+FGVS+  A + S+ HDG  +P   R CI++L+  + L  E IY+I  + ++++  K+L N +   D  +   ++    S++K FLR+L   L+   L A  F+ +  H +    +  +  + L + LP+ N+ LLA +  H   VI     NK++ ++L ++LSP L +   L+     H +++F+D+Q   YVPP+        +LP+T E I  EL+KQ S L  +H ++N GF TK  E  +WEVQ I+T+LKRK
Sbjct:  180 LALGYPVFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQ--DHLKCEQIYKIEPIKTRLMHFKRLYN-NREHDSAVDELNLPTACSLLKLFLRELPEPLLTTDLVAR-FEEVASHPKVTTQQAEL--QQLLEQLPKCNRTLLAWVLLHFDAVIQQERHNKLNAQSLAMLLSPTLQMSHRLMVALLCHCNNLFADVQLIKYVPPL---TSTSPKLPDTPEDIQTELRKQDSLLSQIHSEMNAGFITKKREEQLWEVQRIITQLKRK 435          
BLAST of RalA-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q15311|RBP1_HUMAN (RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3)

HSP 1 Score: 140.584 bits (353), Expect = 3.635e-33
Identity = 88/262 (33.59%), Postives = 151/262 (57.63%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            +PIFG+ L +A + +  +DG  LPA FR+CI+Y+E    +  EGIYR+ G+ S++ +LK   + + +T+  L +++   + S++K +LRDL   L+ K L     +A  +  E   ++V   +++L + LPE N  L++ +  HM  VI    + KM+++N+ IVLSP + +   +L +F+ H  ++F ++     + P+R         LPET  GI EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  187 KPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYG-MKCEGIYRVSGIKSKVDELKAAYDREESTN--LEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTET--EKVQEFQRLLKE-LPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRK 442          
BLAST of RalA-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9PT60|RBP1A_XENLA (RalA-binding protein 1-A OS=Xenopus laevis OX=8355 GN=ralbp1-a PE=1 SV=3)

HSP 1 Score: 136.346 bits (342), Expect = 8.065e-32
Identity = 88/272 (32.35%), Postives = 154/272 (56.62%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXX-XXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPE 1255
            RP+FG+ L EA + +  +DG  LP  FR+CI+++E    +  EGIYR+ G+ S++ +LK   + + + +  L +++   + S++K +LR+L   ++ K L     +A  +  E   +R+   +++L + LPE N  L + +  HM  VI+   + KM+++N+ IVLSP + +   +L +F+ H  ++F  +Q    + P+R         LPET E I EE+++Q   L+ LH ++  G +  + E  +WEVQ I+T LKRK   A+  D E
Sbjct:  182 RPVFGIPLIEAAERTMIYDGIRLPLVFRECIDFIEQHG-MKCEGIYRVSGIKSKVDELKAAYDREESPN--LEDYEPYTVASLLKQYLRELPENVLTKDLMPRFEEACGKTTEG--ERLQECQRLLKE-LPECNFCLTSWLVVHMDHVIEQELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGGVQIKRVIKPLRWSNMATMPALPETQETIKEEIRRQEFLLNCLHRELQAGVKDLSKEERLWEVQRILTALKRKLREAKRQDCE 447          
BLAST of RalA-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q62796|RBP1_RAT (RalA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ralbp1 PE=1 SV=3)

HSP 1 Score: 134.035 bits (336), Expect = 4.882e-31
Identity = 86/262 (32.82%), Postives = 144/262 (54.96%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            RPIFG    +A + +  +DG  LPA FR+C++Y+E    +  EGIYR+ G+ S++ +LK   + + + +  L  ++   + S++K +LRDL   L+ K L     +A  +  E   ++V   +++L + LPE N  LL+ +  HM  VI    + KM+++N+ IVLSP + +   +L + + H  ++F  +       P+R         LPET  GI EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  187 RPIFGAPFADAVERTMMYDGIRLPAVFRECVDYMEKHG-MKCEGIYRVSGIKSKVDELKAAYDREESPN--LEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTEV--EKVQEFQRLL-RELPEYNHLLLSWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVLFTHVQELFGTVLLKQVTRPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDFSKEERLWEVQRILTALKRK 442          
BLAST of RalA-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q62172|RBP1_MOUSE (RalA-binding protein 1 OS=Mus musculus OX=10090 GN=Ralbp1 PE=1 SV=4)

HSP 1 Score: 133.65 bits (335), Expect = 7.019e-31
Identity = 85/262 (32.44%), Postives = 146/262 (55.73%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            +PIFGV L +A + +  +DG  LPA FR+C++Y+E    +  EG+YR+ G+ S++ +LK   + + + +  L  ++   + S++K +LRDL   L+ K L     +A  +  E   ++V   +++L + LPE N  LL+ +  H+  VI    + KM+++N+ IVLSP + +   +L + + H  ++F  +       P+R         LPET  GI EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  187 KPIFGVPLVDAVERTMMYDGVRLPAVFRECVDYMEKHG-MKCEGVYRVSGIKSKVDELKAAYDREESPN--LEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGKTTE--MEKVQEFQRLL-RELPECNHLLLSWLIVHLDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVLFTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRK 442          
BLAST of RalA-binding protein 1 vs. TrEMBL
Match: A0A267E4K0 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007423g2 PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.083e-48
Identity = 138/377 (36.60%), Postives = 203/377 (53.85%), Query Frame = 2
Query:  422 IKEVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHK--ENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQI----NEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPELIKVELKKYERQLEKLHKDMLETVNNTPXXXXXXXXXXXXXXXXXAVQANNIVDQTSGVGAPSTADQELWQIQRTITTLNRKLKSLTTYSVPR 1534
            ++++   RP+FGV L  A + SKSHDG  LPA FR+CI+++E  N LS EGIYR+ GV S++  + +  N  ++ +  LS++D  V+ SVVK+F+R+L PE +   L   L    E      + + +V   +++L+  LP  N  LLA    HM  V+    QNKMSL+N+ IVLSP + +   +L +F+ H  ++FS +    YV P+RP    E         +  EL KQ S L+ LH+++    ++G ++++   LIWEVQ +VT LKRKK + E++D E I+ EL K E  L +LH     T+   PT                        DQ        T DQ LW++QRTIT L RKL+   T   PR
Sbjct:  126 VEQLTPNRPVFGVPLALAVQRSKSHDGVALPACFRECIDFVEA-NALSCEGIYRVSGVKSKVQAIIRAYNLHLSVE--LSDYDPFVVASVVKNFIREL-PECV---LTEKLLPEFEGSWSIRDPKQKVETFQRLLSS-LPAPNYMLLAYTLLHMSHVVAHQAQNKMSLQNVSIVLSPTMQISHKVLHVFFSHLDELFSGVVIKRYVAPLRPQARMEIPETLED--VEAELAKQESLLEWLHQELSALKSDGLDSQDKSNLIWEVQRVVTALKRKKSLIEMDDIEAIESELLKQETSLNRLHA----TLTGCPTD-----------------------DQ-------ETQDQ-LWEVQRTITMLKRKLRK--TAGAPR 455          
BLAST of RalA-binding protein 1 vs. TrEMBL
Match: A0A1I8HIR1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.601e-47
Identity = 136/374 (36.36%), Postives = 197/374 (52.67%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHK--ENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQI----NEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPELIKVELKKYERQLEKLHKDMLETVNNTPXXXXXXXXXXXXXXXXXAVQANNIVDQTSGVGAPSTADQE----LWQIQRTITTLNRKLKSLTTYSVPR 1534
            RP+FGV L  A + SKSHDG  LPA FR+CI+++E  N LS EGIYR+ GV S++  + +  N  ++ +  LS++D  V+ SVVK+F+R+L PE +   L   L    E      + + +V   +++L+  LP  N  LLA    HM  V+    QNKMSL+N+ IVLSP + +   +L +F+ H  ++FS +    YV P+RP    E         +  EL KQ S L+ LH+++    ++G ++++   LIWEVQ +VT LKRKK + E++D E I+ EL K E  L +LH  +                                       G P T DQE    LW++QRTIT L RKL+   T   PR
Sbjct:  908 RPVFGVPLALAVQRSKSHDGVALPACFRECIDFVEA-NALSCEGIYRVSGVKSKVQAIIRAYNLHLSVE--LSDYDPFVVASVVKNFIREL-PECV---LTEKLLPEFEGSWSIRDPKQKVETFQRLLSS-LPAPNYMLLAYTLLHMSHVVAHQAQNKMSLQNVSIVLSPTMQISHKVLHVFFSHLDELFSGVVIKRYVAPLRPQARMEIPETLED--VEAELAKQESLLEWLHQELSALKSDGLDSQDKSNLIWEVQRVVTALKRKKSLIEMDDIEAIESELLKQETSLNRLHATL--------------------------------------TGCP-TDDQETQDQLWEVQRTITMLKRKLRK--TAGAPR 1230          
BLAST of RalA-binding protein 1 vs. TrEMBL
Match: A0A1I8HMN1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.898e-47
Identity = 136/374 (36.36%), Postives = 197/374 (52.67%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHK--ENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQI----NEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPELIKVELKKYERQLEKLHKDMLETVNNTPXXXXXXXXXXXXXXXXXAVQANNIVDQTSGVGAPSTADQE----LWQIQRTITTLNRKLKSLTTYSVPR 1534
            RP+FGV L  A + SKSHDG  LPA FR+CI+++E  N LS EGIYR+ GV S++  + +  N  ++ +  LS++D  V+ SVVK+F+R+L PE +   L   L    E      + + +V   +++L+  LP  N  LLA    HM  V+    QNKMSL+N+ IVLSP + +   +L +F+ H  ++FS +    YV P+RP    E         +  EL KQ S L+ LH+++    ++G ++++   LIWEVQ +VT LKRKK + E++D E I+ EL K E  L +LH  +                                       G P T DQE    LW++QRTIT L RKL+   T   PR
Sbjct: 1133 RPVFGVPLALAVQRSKSHDGVALPACFRECIDFVEA-NALSCEGIYRVSGVKSKVQAIIRAYNLHLSVE--LSDYDPFVVASVVKNFIREL-PECV---LTEKLLPEFEGSWSIRDPKQKVETFQRLLSS-LPAPNYMLLAYTLLHMSHVVAHQAQNKMSLQNVSIVLSPTMQISHKVLHVFFSHLDELFSGVVIKRYVAPLRPQARMEIPETLED--VEAELAKQESLLEWLHQELSALKSDGLDSQDKSNLIWEVQRVVTALKRKKSLIEMDDIEAIESELLKQETSLNRLHATL--------------------------------------TGCP-TDDQETQDQLWEVQRTITMLKRKLRK--TAGAPR 1455          
BLAST of RalA-binding protein 1 vs. TrEMBL
Match: E2BNG7 (RalA-binding protein 1 OS=Harpegnathos saltator OX=610380 GN=EAI_01903 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.395e-39
Identity = 104/266 (39.10%), Postives = 153/266 (57.52%), Query Frame = 2
Query:  428 EVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            ++G  +P+FGVSL  A + S  HDG  LP   R CI+Y+E ++ ++ EG+Y++PGV S++  LK+L N     +  +S F+  V TS++  FLR+L   ++E S   S F+     K+  Q    + +  LTQ LPE N+ LLA +T H+  V       KM+ + + + LSP L +   LL  F  H   +F ++Q   YVPP+         LP+TVEGI  EL KQ S L  +H Q+N GF TK+ E  +WEVQ ++T+LKRK
Sbjct:  156 DIGEEQPVFGVSLHLAVERSCCHDGIELPLVVRDCIDYVE-EHGMNVEGLYKVPGVKSKVQHLKKLYNYRETVN--ISEFEPTVATSLLILFLRELPEPVLENSETISRFEQAASTKDVAQRESQLAQ--LTQQLPECNRVLLAWVTLHLDHVTAREKTTKMNAQTISMTLSPVLQMSHRLLLAFLFHCKALFPNVQLTKYVPPL---SSGSTNLPDTVEGITAELSKQESLLSQIHMQMNAGFVTKSREEQLWEVQRMITQLKRK 413          
BLAST of RalA-binding protein 1 vs. TrEMBL
Match: A0A026WEJ8 (RalA-binding protein OS=Ooceraea biroi OX=2015173 GN=DMN91_001516 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.388e-39
Identity = 104/268 (38.81%), Postives = 154/268 (57.46%), Query Frame = 2
Query:  428 EVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLN--TDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            ++G  +P+FGVSL  A + S  HDG  LP   R CI+Y+E ++ +S EG+Y++PGV S++  LK+L N    +N    +S F+  V TS++  FLR+L   ++E S   S F+     K+  Q    +V+  LTQ LP+ N+ LLA +T H+  V       KM+ + + + LSP L +   LL     H   +F ++Q   YVPP+         LP++VEGI  EL KQ S L  +H Q+N GF TK+ E  +WEVQ ++T+LKRK
Sbjct:  156 DIGEEQPVFGVSLHLAVERSCCHDGVELPLVVRDCIDYVE-EHGMSVEGLYKVPGVKSKVQNLKKLYNHREPVN----ISEFEPTVATSLLILFLRELPEPVLENSETISRFEQAASTKDVAQREAQLVQ--LTQQLPDCNRVLLAWVTLHLDHVTAREKTTKMNAQTISMTLSPVLQMSHRLLLALLFHCKALFPNVQLTKYVPPL---SSGSTSLPDSVEGIAAELSKQESLLSQIHMQMNAGFVTKSREEQLWEVQRMITQLKRK 413          
BLAST of RalA-binding protein 1 vs. Ensembl Cavefish
Match: ralbp1 (ralA binding protein 1 [Source:NCBI gene;Acc:103041092])

HSP 1 Score: 140.584 bits (353), Expect = 4.819e-34
Identity = 89/270 (32.96%), Postives = 150/270 (55.56%), Query Frame = 2
Query:  419 PIKEVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            P++     RPIFG  L EA + +  +DG  LPA FR+C++Y+E+   +  EGIYR+ G+ S++ +LK     D      L  +D   + S++K +LR+L   L+ + L     +A  +  E   +++   +++LT+ +P  ++ LLA + +HM  VI      KM+++N+ IVL+P + +   +L +F+ H  ++F D+     V P+R         LPET E I EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  173 PVEAPATIRPIFGAPLAEAVRRTALYDGIQLPAIFRECVDYIESYG-MKCEGIYRVSGMKSKVDELKAAY--DREECPCLEEYDPHTVASLLKQYLRELPGNLLGRELAPRFEEACGRPSEA--EKLQEFQRLLTE-VPAGSRLLLAWLITHMDHVIARELDTKMNIQNISIVLNPTVQIGNRVLYVFFTHVREMFGDVVLKPVVRPLRWSNMATMPALPETQESIKEEIRRQEFLLNCLHRDLQAGIKDLSKEERLWEVQRILTALKRK 436          
BLAST of RalA-binding protein 1 vs. Ensembl Cavefish
Match: ralbp1 (ralA binding protein 1 [Source:NCBI gene;Acc:103041092])

HSP 1 Score: 140.584 bits (353), Expect = 4.819e-34
Identity = 89/270 (32.96%), Postives = 150/270 (55.56%), Query Frame = 2
Query:  419 PIKEVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            P++     RPIFG  L EA + +  +DG  LPA FR+C++Y+E+   +  EGIYR+ G+ S++ +LK     D      L  +D   + S++K +LR+L   L+ + L     +A  +  E   +++   +++LT+ +P  ++ LLA + +HM  VI      KM+++N+ IVL+P + +   +L +F+ H  ++F D+     V P+R         LPET E I EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  173 PVEAPATIRPIFGAPLAEAVRRTALYDGIQLPAIFRECVDYIESYG-MKCEGIYRVSGMKSKVDELKAAY--DREECPCLEEYDPHTVASLLKQYLRELPGNLLGRELAPRFEEACGRPSEA--EKLQEFQRLLTE-VPAGSRLLLAWLITHMDHVIARELDTKMNIQNISIVLNPTVQIGNRVLYVFFTHVREMFGDVVLKPVVRPLRWSNMATMPALPETQESIKEEIRRQEFLLNCLHRDLQAGIKDLSKEERLWEVQRILTALKRK 436          
BLAST of RalA-binding protein 1 vs. Ensembl Cavefish
Match: ophn1 (oligophrenin 1 [Source:ZFIN;Acc:ZDB-GENE-040718-464])

HSP 1 Score: 80.4925 bits (197), Expect = 4.973e-15
Identity = 54/152 (35.53%), Postives = 81/152 (53.29%), Query Frame = 2
Query:  518 FFRQCINYLETDNRLSFEGIYRIPGVNSQIVKL-------KQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            F R+CIN +ET   L+ EG+YR  G N Q+ KL       K   + D+N+    S +DI  ITS +K +LR L   L+  SL   L  A +   EN+  R G V  ++ + LPE+NQ +L L+  H+  V    ++N M+  N+ ++  P L
Sbjct:  379 FVRKCINVIETKG-LTQEGVYRTVGSNIQVQKLLNSFFDSKCPGDVDLNS----SEWDIKTITSAMKFYLRSLSEPLMTYSLHRELISAAK--SENLDYRSGAVHSLVYK-LPEQNQEMLELLIKHLVSVCGHCSENLMTASNMGVIFGPTL 522          
BLAST of RalA-binding protein 1 vs. Ensembl Cavefish
Match: arhgap27 (rho GTPase-activating protein 27 [Source:NCBI gene;Acc:103022762])

HSP 1 Score: 76.6406 bits (187), Expect = 1.035e-13
Identity = 56/184 (30.43%), Postives = 93/184 (50.54%), Query Frame = 2
Query:  410 VIEPIKEVGLTRP-IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLN--TDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
             ++ +KE G  R  +FG  L   C   K+     +P+F  +CI  +E    L  +GIYR+ G  + I KL+   +   D+N ++   N+DI VIT  +K F R+L+  L   S   S  + ++    +   RV  +   L + LP  N   +  + SH+ KVI+   +N+M+++N+ IV  P L
Sbjct:  811 TLQSVKEKGYIRENVFGCHLHNLCAQEKTT----VPSFVEKCIRTVEKRG-LGIDGIYRVSGNLAVIQKLRFRADHAEDLNLEE--GNWDIHVITGALKLFFRELQEPLFPYSHFNSFVQGIK--IADYHSRVSYMSD-LVKSLPAPNHNTMEALFSHLRKVIEHGEENRMTVQNVAIVFGPTL 984          
BLAST of RalA-binding protein 1 vs. Ensembl Cavefish
Match: arhgap27 (rho GTPase-activating protein 27 [Source:NCBI gene;Acc:103022762])

HSP 1 Score: 75.8702 bits (185), Expect = 1.410e-13
Identity = 56/184 (30.43%), Postives = 93/184 (50.54%), Query Frame = 2
Query:  410 VIEPIKEVGLTRP-IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLN--TDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
             ++ +KE G  R  +FG  L   C   K+     +P+F  +CI  +E    L  +GIYR+ G  + I KL+   +   D+N ++   N+DI VIT  +K F R+L+  L   S   S  + ++    +   RV  +   L + LP  N   +  + SH+ KVI+   +N+M+++N+ IV  P L
Sbjct:  837 TLQSVKEKGYIRENVFGCHLHNLCAQEKTT----VPSFVEKCIRTVEKRG-LGIDGIYRVSGNLAVIQKLRFRADHAEDLNLEE--GNWDIHVITGALKLFFRELQEPLFPYSHFNSFVQGIK--IADYHSRVSYMSD-LVKSLPAPNHNTMEALFSHLRKVIEHGEENRMTVQNVAIVFGPTL 1010          
BLAST of RalA-binding protein 1 vs. Ensembl Sea Lamprey
Match: ralbp1 (ralA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2098])

HSP 1 Score: 149.058 bits (375), Expect = 1.526e-37
Identity = 89/261 (34.10%), Postives = 152/261 (58.24%), Query Frame = 2
Query:  446 PIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            PIFG +L+EA   +  +DG PLPA  R+CI+Y+E  N L  EGIYR+ G+ S++ +LK + + + + +  L ++D   + SV+K +LR+L   L+ + L   + +A    +  ++DR+   K++L + LP+ N++LL+ +  HM  V+   + NKM+++ + IVL P   +   LL MF+ + +D+F ++     + P+R          PE+ E I EE+++Q   L+ LH  +  G +    E  +WEVQ I+T LKRK
Sbjct:  196 PIFGATLEEAVHRTALYDGVPLPAVCRECIDYIER-NGLKCEGIYRVSGIKSKVDELKAIYDREESPN--LEDYDPHTVASVLKQYLRELPESLLTRELHPKIEEAC--SRPLVEDRLAECKRLLAE-LPKFNRHLLSWLMVHMDHVVLHESDNKMNVQGISIVLHPTTQISHRLLYMFFMNVNDLFKNVNLNSAIRPLRWSNLANAPNFPESQENIKEEIRRQEFMLNRLHSDLQAGVKDSGKEERLWEVQRILTALKRK 450          
BLAST of RalA-binding protein 1 vs. Ensembl Sea Lamprey
Match: arhgap21b (Rho GTPase activating protein 21b [Source:ZFIN;Acc:ZDB-GENE-030131-4944])

HSP 1 Score: 70.0922 bits (170), Expect = 2.052e-12
Identity = 57/173 (32.95%), Postives = 84/173 (48.55%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLN-----TDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +FGV L E C     H+ + LP     C   +E +  L   GIYR+PG N+ +  L++ LN      D N DK     D+ VI+S++KSF R L   L           A     EN  +R+  +KK++   LPE + + L  ++ H+  + + S +NKM   NL IV  P L
Sbjct: 1005 MFGVRL-EDCPPGL-HNKF-LPLIVEVCCGLVE-ERGLESTGIYRVPGNNAAVCSLQEELNRGVTEIDTNDDKWR---DLNVISSLLKSFFRKLPEPLFTDEKYYEFIDA--NRMENGVERLKALKKLI-HELPEHHFHTLKFLSMHLKTIAENSPKNKMEPRNLAIVFGPTL 1167          
BLAST of RalA-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003939.1 (pep scaffold:Pmarinus_7.0:GL477112:28457:91290:-1 gene:ENSPMAG00000003551.1 transcript:ENSPMAT00000003939.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 4.294e-11
Identity = 45/150 (30.00%), Postives = 78/150 (52.00%), Query Frame = 2
Query:  509 LPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKA--LEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +P    + +NY+E    L  EGIYR  G N+++ +L+Q L+ D+N+   L ++ + VI SV+K +LR+L   L+   L     +A  + + KE ++    I+ +     LP  N   L  I  H+ ++    + N+MS   L IV +P +
Sbjct: 1129 VPFLLEKLLNYIEIHG-LYTEGIYRKSGANTKVKELRQQLDNDVNSVN-LDDYQVHVIGSVLKQWLRELPVPLMTLDLYDEFLRAVGVPEKKEKIKAVYSIIGQ-----LPSVNYSTLERIIFHLVRIAQYEDTNRMSCNALAIVFAPCI 1271          
BLAST of RalA-binding protein 1 vs. Ensembl Sea Lamprey
Match: arhgap5 (Rho GTPase activating protein 5 [Source:ZFIN;Acc:ZDB-GENE-081014-1])

HSP 1 Score: 61.6178 bits (148), Expect = 8.265e-10
Identity = 43/169 (25.44%), Postives = 81/169 (47.93%), Query Frame = 2
Query:  452 FGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVG--IVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            FG+ L E  ++  +    P+P F  +C+ YLE+   ++ EG+YR+ G  ++   L++    D +      + ++  +   +K F  +L   L+   +   L +A+     N+ D+ G  +  +   + LP  N  +   I +H+ KV   S++N M+ ENL I   P L
Sbjct: 1220 FGLPLVEVVQSPDN----PIPLFVEKCVLYLESCG-ITTEGLYRVSGNKTEQDSLQKQFECDHSISYEAMDVNVNTVAGSLKIFFAELPDPLLPYDIHQDLMEAI-----NIPDKTGRLLALRGKLKKLPHVNHEVFKYIITHLHKVSQYSSENYMTSENLSICFWPTL 1378          
BLAST of RalA-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004494.1 (pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-1 gene:ENSPMAG00000004080.1 transcript:ENSPMAT00000004494.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.579e-9
Identity = 45/170 (26.47%), Postives = 84/170 (49.41%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFD-IAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMG-KVIDMSNQNKMSLENLLIVLSPAL 952
            +FG  L+  C+     +G  +P F R  +  +E    L  +GIYR+ G  + I KL+ +++ +   D     +D + VIT  +K F R+L   L           A++   ++  +++  + K++   LP  N+  + L+ +H+  +V+     N+MS++NL IV  P L
Sbjct:  411 VFGCPLQTLCE----REGSAVPNFARLSVQCVERTG-LQVDGIYRVSGNLATIQKLRFIVDHEEKLDLEEPQWDDVHVITGALKMFFRELPEPLFPFKFFPHFINAIK--IKDYAEKIRCMGKLIAI-LPPTNRETMKLLFNHLATRVVAHGKTNRMSVQNLAIVFGPTL 572          
BLAST of RalA-binding protein 1 vs. Ensembl Yeast
Match: BEM3 (Rho GTPase activating protein (RhoGAP); involved in control of the cytoskeleton organization; targets the essential Rho-GTPase Cdc42p, which controls establishment and maintenance of cell polarity, including bud-site assembly [Source:SGD;Acc:S000006036])

HSP 1 Score: 63.929 bits (154), Expect = 1.108e-10
Identity = 55/206 (26.70%), Postives = 97/206 (47.09%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSH---DGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSN---------------FDIAVITSVVKSFLRDLKPELIEKSLEASLFKAL--EQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIF 1006
            IFG SL E C    SH   + Y LP+   +C+ YL  +  +  EGI+R+ G ++ I  L++  + + + D    N                 +  ++ ++K +LR L P L+    +   FK +  E H   +Q  +G  + + +  +P  N  L+  +   + ++ + S  NKM+L NL IV SP L++   +L+ F    + IF
Sbjct:  904 IFGSSL-ETCLRLSSHKYQNVYDLPSVVYRCLEYLYKNRGIQEEGIFRLSGSSTVIKTLQERFDKEYDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKL-PHLLFGDEQFLSFKRVVDENHNNPVQISLGFKELIESGLVPHANLSLMYALFELLVRINENSKFNKMNLRNLCIVFSPTLNIPISMLQPFITDFACIF 1107          
BLAST of RalA-binding protein 1 vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 58.9214 bits (141), Expect = 2.998e-9
Identity = 54/206 (26.21%), Postives = 93/206 (45.15%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNR-LSFEGIYRIPG-------VNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHK--ENMQDRVGIVK----------------KMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYD 988
            ++G SL   C    +++   +P     CI+++E+D   +  EGIYR  G       +  Q    K   NT+  T  +L+  D+ V+T V+K +LR L   +    +   L + ++  K  EN+    G +                 K + + LP E+  +L +++ H+ KV   S+ N+M+L NL +V +P L   F   K   D
Sbjct:  788 LYGSSLVARC----NYENNEIPMILSVCIDFIESDEENMRSEGIYRKSGSQLVIEEIEKQFSAWKVQQNTE--TPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLIRDFSGEKDIID 987          
BLAST of RalA-binding protein 1 vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 53.1434 bits (126), Expect = 1.718e-7
Identity = 43/154 (27.92%), Postives = 76/154 (49.35%), Query Frame = 2
Query:  509 LPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTD------INTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +PA  RQCI Y+     L  EGIYR       + KLK+ ++ D      I   K  S+ DI ++ S++K+F   L   ++ K+L + +   L+   E+   R   +  ++  +LP+   + L  +  H+ +V+    QN+M+L  L I+  P +
Sbjct:  485 VPAIVRQCI-YVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQI--EDPTTRKNFMHGLI-YNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTI 634          
BLAST of RalA-binding protein 1 vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 51.2174 bits (121), Expect = 7.021e-7
Identity = 59/199 (29.65%), Postives = 98/199 (49.25%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDN-RLSFEGIYRIPGVNSQIVKLKQLL--NTDINTDKL------LSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQ----------------DRVGIVKKMLT------QHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            ++G SL+  C   KS     +P   R CI+ +E D+  L+ EG+YR  G  + + +++     N  +++D L      L N DI  + SV+K +LR L P+ +   L  S++ AL     N Q                 +V I + +L       + LP E+Q +L ++ +H+GKV   S +N M+L NL +V +P+L
Sbjct:  785 LYGSSLQARCAYEKS----TVPIIIRCCIDRIEKDDIGLNMEGLYRKSGSQTLVEEIENEFAQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKL-PDPV---LSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSL 975          
BLAST of RalA-binding protein 1 vs. Ensembl Nematostella
Match: EDO34021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL1])

HSP 1 Score: 142.51 bits (358), Expect = 1.323e-35
Identity = 98/269 (36.43%), Postives = 153/269 (56.88%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKAL---EQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXX-XXXXGINEELKKQVSYLDDLHEQINEGFE--TKNTEYLIWEVQLIVTKLKRKKYIA 1237
            IFG+ L++A K S   DG  LP  FR+ I Y+E +N L+ EGIYR+ GV S++  LK+L +     D  L  ++  V+ S+VK +LR+L PE +   + A  F  L   +  KE ++       K L   LP  N+ LLA    HMG VID +++NKMSL+N+ IVL+P + +  G+L +F  + +++F + Q   Y  P+    E +E     + + I   L KQ + L +LH+++N   +  ++  + L+WEVQ  VT+LKRK  +A
Sbjct:   98 IFGIPLEKAVKQSILPDGVELPRLFREGIMYVE-ENGLNVEGIYRVSGVKSKVDALKELYDQGKQVD--LKEYEPEVVASIVKQYLREL-PESVLTMMLAPRFNELIGIQDKKEQLEK-----TKQLLAELPSPNRTLLAWTMVHMGHVIDKASENKMSLQNISIVLNPTMSISHGVLFIFLSNLAELFPNTQLTSYNGPLTFRLEEDEADLPSSPDAIATALAKQEAILANLHKELNASKDDNSEGQDELLWEVQRKVTQLKRKLRVA 357          
BLAST of RalA-binding protein 1 vs. Ensembl Nematostella
Match: EDO45667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS04])

HSP 1 Score: 72.0182 bits (175), Expect = 8.665e-13
Identity = 50/152 (32.89%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  518 FFRQCINYLETDNRLSFEGIYRIPGVNS-------QIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            F R+ I  +E    L+ +G+YRI GV S       Q V+ K++   ++ +D   S +++  ITS +K  LR++ P L           A++Q  +  + RV  + K L Q LPEEN+ L+ +I  H+  V   SN+N M+  NL +V  P L
Sbjct:  395 FIRKSIRAVEKRG-LTDQGLYRIVGVGSKVQNLLFQCVEKKKISQIELESDD--SEYEVKTITSALKQHLRNMDPPLFTYEYHEDFLDAVKQ--DTYEKRVASLSK-LVQLLPEENKKLIVMIMEHLKNVAANSNKNLMAASNLGVVFGPTL 540          
BLAST of RalA-binding protein 1 vs. Ensembl Nematostella
Match: EDO47995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ0])

HSP 1 Score: 67.0106 bits (162), Expect = 1.445e-11
Identity = 49/170 (28.82%), Postives = 85/170 (50.00%), Query Frame = 2
Query:  443 RPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKA--LEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSP 946
            R +FG  L+E  K  +    + L     +C+ YL  +  L  +G++R+ G + +I KLK   +  +  D    + D+  IT V+K +LR+L   L+  +L     +A  ++     +Q   G+V K     LP+ N+  L  +   +GK+ D S  NKM+  N+ IV++P
Sbjct:  250 RSVFGCPLEEHLKVQRRSIAFVL----EECLTYLH-EEALQEQGLFRMAGSSGKIRKLKAAFDAGM-VDLTEFDCDVHAITGVLKQYLRELPEPLMTFALYDDWIQAASIQDSGARLQAYWGLVDK-----LPKANKDNLRYLICFLGKLADYSEVNKMTASNIAIVIAP 408          
BLAST of RalA-binding protein 1 vs. Ensembl Nematostella
Match: EDO47842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY9])

HSP 1 Score: 65.0846 bits (157), Expect = 1.017e-10
Identity = 49/165 (29.70%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  452 FGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSP 946
            FGV L+E    +KS DG P+P    + ++YL +   L  EGI+R+ G +  +  LK   + D + D  L   D+  +  ++K FLR+L    + ++L     K  E + ++  D +  ++ +L + LP  N  LL  +   + +V      NKMS   L IV  P
Sbjct:  103 FGVPLEEV---TKSRDGSPIPWVLAKIVHYL-SQCGLKHEGIFRVSGNHKVVESLKATFDRDGDAD--LEECDVMAVAGLLKLFLRELPEPPVPQALTTDFIKVHEVYGDDNPDCLDELRALLDK-LPYLNYELLKFLCHFLVEVSMNEENNKMSTMALAIVFGP 260          
BLAST of RalA-binding protein 1 vs. Ensembl Nematostella
Match: EDO49053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHX5])

HSP 1 Score: 64.3142 bits (155), Expect = 1.658e-10
Identity = 49/152 (32.24%), Postives = 78/152 (51.32%), Query Frame = 2
Query:  509 LPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLK-QLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLH 961
            +PA   QCI+ +E    L+  G+YR+PG    I +LK + L+    T  L    DI V+  V+K FLR+L   L+   L  +   A   +K++ QD    + + +++ LP+ N+  LA +  H+ KV   ++  KM + NL  V  P L  H
Sbjct:  382 VPAIVVQCISEIEKRG-LNEVGLYRVPGAERSIKELKDKFLHG--KTQNLHETIDIHVVCGVLKDFLRNLAEPLVTYHLWGAFVNAA--NKDDDQDSFSAMYQAVSE-LPQANRDTLACLVVHLQKVSQCTD-CKMPVSNLARVFGPTLVGH 526          
BLAST of RalA-binding protein 1 vs. Ensembl Medaka
Match: ralbp1 (ralA binding protein 1 [Source:NCBI gene;Acc:101173008])

HSP 1 Score: 142.895 bits (359), Expect = 7.625e-35
Identity = 93/272 (34.19%), Postives = 150/272 (55.15%), Query Frame = 2
Query:  416 EPIK-EVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            EP+  E    RPIFG  L EA K +  +DG  LPA FR+C++Y+E    +  EGIYR+ G+ S++ +LK     D      L  +D   + S++K +LR+L   L+ + L   L  A  +  E   ++V   +++L + +P E++ LL+ + +HM  VI      KM+++N+ IVL+P + +   +L +F+ H  ++F D+     V P+R         LPET E I EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  170 EPVPVETPTFRPIFGAPLTEAVKRTALYDGIQLPAVFRECVDYIENYG-MKCEGIYRVSGMKSKVDELKAAY--DREECPCLEEYDPHTVASLLKQYLRELPDNLLHRDLAQRLEDACGRQAEA--EKVTEFQRLLAE-VPPESKLLLSWLVTHMDHVIAREADTKMNIQNISIVLNPTIQIGNRVLYVFFTHVKELFGDVVLKPVVRPLRWSNMATMPALPETAESIKEEIRRQEFLLNCLHRDLQAGVKDLSKEERLWEVQRILTALKRK 435          
BLAST of RalA-binding protein 1 vs. Ensembl Medaka
Match: ralbp1 (ralA binding protein 1 [Source:NCBI gene;Acc:101173008])

HSP 1 Score: 142.895 bits (359), Expect = 1.068e-34
Identity = 93/272 (34.19%), Postives = 150/272 (55.15%), Query Frame = 2
Query:  416 EPIK-EVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVR-XXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            EP+  E    RPIFG  L EA K +  +DG  LPA FR+C++Y+E    +  EGIYR+ G+ S++ +LK     D      L  +D   + S++K +LR+L   L+ + L   L  A  +  E   ++V   +++L + +P E++ LL+ + +HM  VI      KM+++N+ IVL+P + +   +L +F+ H  ++F D+     V P+R         LPET E I EE+++Q   L+ LH  +  G +  + E  +WEVQ I+T LKRK
Sbjct:  170 EPVPVETPTFRPIFGAPLTEAVKRTALYDGIQLPAVFRECVDYIENYG-MKCEGIYRVSGMKSKVDELKAAY--DREECPCLEEYDPHTVASLLKQYLRELPDNLLHRDLAQRLEDACGRQAEA--EKVTEFQRLLAE-VPPESKLLLSWLVTHMDHVIAREADTKMNIQNISIVLNPTIQIGNRVLYVFFTHVKELFGDVVLKPVVRPLRWSNMATMPALPETAESIKEEIRRQEFLLNCLHRDLQAGVKDLSKEERLWEVQRILTALKRK 435          
BLAST of RalA-binding protein 1 vs. Ensembl Medaka
Match: ralbp1 (ralA binding protein 1 [Source:NCBI gene;Acc:101173008])

HSP 1 Score: 103.219 bits (256), Expect = 3.215e-22
Identity = 80/271 (29.52%), Postives = 125/271 (46.13%), Query Frame = 2
Query:  416 EPIK-EVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRK 1225
            EP+  E    RPIFG  L EA K +  +DG  LPA FR+C++Y+E    +  EGIYR+ G+ S++ +LK     D      L  +D   + S++K +LR+L   L+ + L   L  A  +  E   ++V   +++L + +P E++ LL+ + +HM  VI      KM+++N+ IVL+P +   F LL   +        DLQA                                            G +  + E  +WEVQ I+T LKRK
Sbjct:  170 EPVPVETPTFRPIFGAPLTEAVKRTALYDGIQLPAVFRECVDYIENYG-MKCEGIYRVSGMKSKVDELKAAY--DREECPCLEEYDPHTVASLLKQYLRELPDNLLHRDLAQRLEDACGRQAEA--EKVTEFQRLLAE-VPPESKLLLSWLVTHMDHVIAREADTKMNIQNISIVLNPTIQ-EF-LLNCLH-------RDLQA--------------------------------------------GVKDLSKEERLWEVQRILTALKRK 381          
BLAST of RalA-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000008703.2 (Rho GTPase activating protein 35 [Source:NCBI gene;Acc:101164082])

HSP 1 Score: 80.8777 bits (198), Expect = 4.893e-15
Identity = 55/187 (29.41%), Postives = 88/187 (47.06%), Query Frame = 2
Query:  419 PIKEVGLTRPI----FGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKAL-----EQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            P     +++PI    FG+ L       +     P+P F  +CI ++ET   LS EGIYR+ G  +++  L++  + D N D +  ++ I  +   +K+F  +L   L+  +L+A L +A      EQ  + M+D        +    P EN  L   + SH+ KV   S  N M+ ENL I   P L
Sbjct: 1247 PRPRHSISKPIESNYFGMPLASVVTPER-----PIPVFIEKCIRFIETTG-LSTEGIYRVCGNKAEMESLQRQFDQDHNLDLVEKDYTINTVAGAMKAFFSELPQPLVPYNLQADLVEAFKINDREQRFQTMRD--------ILWRFPRENYELFKYVISHLNKVSQHSRTNLMTSENLSICFWPTL 1419          
BLAST of RalA-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036475.1 (rho GTPase-activating protein 23 [Source:NCBI gene;Acc:101173450])

HSP 1 Score: 79.7221 bits (195), Expect = 1.075e-14
Identity = 54/168 (32.14%), Postives = 85/168 (50.60%), Query Frame = 2
Query:  452 FGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNF-DIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            FG+ L E C+ + +H   PL      C   +ET   L + GIYR+PG N+ +  L++ LN  +N +     + D+ VI+S++KSF R L   L           A     +N +DR+  +KK++   LP+   + L  +  H+ +V D S +NKM   NL +V  P L
Sbjct:  868 FGIRL-EDCQPAVNHKFVPL--IVEMCCEVVETIG-LEYTGIYRVPGNNAMVSNLQEHLNKGLNINITEERWQDLNVISSLLKSFFRKLPEPLFTDDKYGDFIDA--NRIKNTEDRLKTMKKLI-HDLPDYYHHTLKFLVGHLKRVADHSEKNKMEPRNLALVFGPTL 1028          
BLAST of RalA-binding protein 1 vs. Planmine SMEST
Match: SMESG000043489.1 (SMESG000043489.1)

HSP 1 Score: 1486.09 bits (3846), Expect = 0.000e+0
Identity = 872/873 (99.89%), Postives = 873/873 (100.00%), Query Frame = 2
Query:   92 MTNLELKKHGIFDKTRKDKKEINVAYHTIGDSRTSLDVSNIVIPDLEQKLDDNLHANVTVNLKKSKTFXXXXXXXXXXXXXXXXIDSFXXXXXXXXXXXXXXTESFVIEPIKEVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRXXXXXXXXXXXXXXGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPELIKVELKKYERQLEKLHKDMLETVNNTPXXXXXXXXXXXXXXXXXAVQANNIVDQTSGVGAPSTADQELWQIQRTITTLNRKLKSLTTYSVPRFQAESYVPMGFGQKVENINXXXXXXXXXXXXXXXXXXSVQLNLTLRKLPRETPEIMEEEINNVSDRDTSAVNVNESEINTNAIQSESNHIEGDIYAEVIPDEMVKSSDEKTSDWLMSDDQHPEAGRDNATVEQQTIAEDNHLAVSSIDIEQSVSSNGVNHTTXXXXXXXXXXXLTGSNIATCIDDLIQTGEMWTNEKEQLLSEDDDLRNEALRYLYMREELISIKNDLKTRLTSEANEIARLKRNIESLEEEKSQKTFSVQNQYRKLNESSSSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMQYSDKIIGGRGGQEDCQQEDIADLLKQQQEIMLDNERLEKDNMDLLEQIQLERNHCIELKVALRTHMLLACPSPWPSNIDE 2710
            MTNLELKKHGIFDKTRKDKKEINVAYHTIGDSRTSLDVSNIVIPDLEQKLDDNLHANVTVNLKKSKTFKIMVNKKPKEKEKGSKIDSFKKPKNKKRKRKEIKTESFVIEPIKEVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDI+TDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRPGPEYEEELPETVEGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPELIKVELKKYERQLEKLHKDMLETVNNTPTTASVVVGSNSTGNSISAVQANNIVDQTSGVGAPSTADQELWQIQRTITTLNRKLKSLTTYSVPRFQAESYVPMGFGQKVENINDDDVGGGNCDDGDDDDDDSVQLNLTLRKLPRETPEIMEEEINNVSDRDTSAVNVNESEINTNAIQSESNHIEGDIYAEVIPDEMVKSSDEKTSDWLMSDDQHPEAGRDNATVEQQTIAEDNHLAVSSIDIEQSVSSNGVNHTTEDDNESNSESELTGSNIATCIDDLIQTGEMWTNEKEQLLSEDDDLRNEALRYLYMREELISIKNDLKTRLTSEANEIARLKRNIESLEEEKSQKTFSVQNQYRKLNESSSSPENREDCEGEDNDEENDESEDEEDDPDDSSHDECSEPMQYSDKIIGGRGGQEDCQQEDIADLLKQQQEIMLDNERLEKDNMDLLEQIQLERNHCIELKVALRTHMLLACPSPWPSNIDE
Sbjct:    1 MTNLELKKHGIFDKTRKDKKEINVAYHTIGDSRTSLDVSNIVIPDLEQKLDDNLHANVTVNLKKSKTFKIMVNKKPKEKEKGSKIDSFKKPKNKKRKRKEIKTESFVIEPIKEVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDIDTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDHSSDIFSDLQAPVYVPPVRPGPEYEEELPETVEGINEELKKQVSYLDDLHEQINEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPELIKVELKKYERQLEKLHKDMLETVNNTPTTASVVVGSNSTGNSISAVQANNIVDQTSGVGAPSTADQELWQIQRTITTLNRKLKSLTTYSVPRFQAESYVPMGFGQKVENINDDDVGGGNCDDGDDDDDDSVQLNLTLRKLPRETPEIMEEEINNVSDRDTSAVNVNESEINTNAIQSESNHIEGDIYAEVIPDEMVKSSDEKTSDWLMSDDQHPEAGRDNATVEQQTIAEDNHLAVSSIDIEQSVSSNGVNHTTEDDNESNSESELTGSNIATCIDDLIQTGEMWTNEKEQLLSEDDDLRNEALRYLYMREELISIKNDLKTRLTSEANEIARLKRNIESLEEEKSQKTFSVQNQYRKLNESSSSPENREDCEGEDNDEENDESEDEEDDPDDSSHDECSEPMQYSDKIIGGRGGQEDCQQEDIADLLKQQQEIMLDNERLEKDNMDLLEQIQLERNHCIELKVALRTHMLLACPSPWPSNIDE 873          
BLAST of RalA-binding protein 1 vs. Planmine SMEST
Match: SMESG000068429.1 (SMESG000068429.1)

HSP 1 Score: 63.1586 bits (152), Expect = 8.251e-10
Identity = 48/169 (28.40%), Postives = 80/169 (47.34%), Query Frame = 2
Query:  446 PIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            P+FG  L +    S+ H  Y L      C+ +L+    L  EG++RI G  +++  L    N     +K++  +D  VI   +K +LR L   L+   L     +A+  +  N + R+  +K  L++ LP      L+ +   + KV   S++NKM+  NL IV  P L
Sbjct:  321 PVFGRELSQHLLTSRRHIAYTLEV----CVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNV-FKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAV--NNPNEESRLSAMKMCLSK-LPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNL 481          
BLAST of RalA-binding protein 1 vs. Planmine SMEST
Match: SMESG000068429.1 (SMESG000068429.1)

HSP 1 Score: 63.1586 bits (152), Expect = 8.383e-10
Identity = 48/169 (28.40%), Postives = 80/169 (47.34%), Query Frame = 2
Query:  446 PIFGVSLKEACKNSKSHDGYPLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSVVKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            P+FG  L +    S+ H  Y L      C+ +L+    L  EG++RI G  +++  L    N     +K++  +D  VI   +K +LR L   L+   L     +A+  +  N + R+  +K  L++ LP      L+ +   + KV   S++NKM+  NL IV  P L
Sbjct:  318 PVFGRELSQHLLTSRRHIAYTLEV----CVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNV-FKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAV--NNPNEESRLSAMKMCLSK-LPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNL 478          
BLAST of RalA-binding protein 1 vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 60.4622 bits (145), Expect = 5.385e-9
Identity = 55/175 (31.43%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGY--PLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSN---FDIAVITSVVKSFLRDL-KPELIEKSLEASL-FKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +FG SLK      K  +     +P     C   +E D+ L  EGIYRI G  ++I +L + LN   N    +SN   +D+  IT +VK +LR+L +P L+  + E  L    LE+  E       ++       LPE N   +  +  H  KV+  S +N+M   NL ++L P L
Sbjct:  729 LFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIE-DSGLDEEGIYRISGSKNEINELYKKLNK--NPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILS-----LPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTL 895          
BLAST of RalA-binding protein 1 vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 60.4622 bits (145), Expect = 5.460e-9
Identity = 55/175 (31.43%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  449 IFGVSLKEACKNSKSHDGY--PLPAFFRQCINYLETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSN---FDIAVITSVVKSFLRDL-KPELIEKSLEASL-FKALEQHKENMQDRVGIVKKMLTQHLPEENQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPAL 952
            +FG SLK      K  +     +P     C   +E D+ L  EGIYRI G  ++I +L + LN   N    +SN   +D+  IT +VK +LR+L +P L+  + E  L    LE+  E       ++       LPE N   +  +  H  KV+  S +N+M   NL ++L P L
Sbjct:  744 LFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIE-DSGLDEEGIYRISGSKNEINELYKKLNK--NPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILS-----LPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTL 910          
The following BLAST results are available for this feature:
BLAST of RalA-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RALBP17.569e-3433.59ralA binding protein 1 [Source:HGNC Symbol;Acc:HGN... [more]
RALBP17.569e-3433.59ralA binding protein 1 [Source:HGNC Symbol;Acc:HGN... [more]
ARHGAP261.819e-1433.77Rho GTPase activating protein 26 [Source:HGNC Symb... [more]
ARHGAP213.246e-1432.56Rho GTPase activating protein 21 [Source:HGNC Symb... [more]
ARHGAP264.066e-1433.77Rho GTPase activating protein 26 [Source:HGNC Symb... [more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tag-3251.889e-1632.09WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3258.867e-1631.91WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3259.113e-1631.91WW domain-containing protein tag-325 [Source:UniP... [more]
chin-11.550e-1331.95CHImaeriN (Rac-GTPase-activating protein) homolog ... [more]
cyk-42.391e-1130.11CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q... [more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rlip4.520e-3533.96gene:FBgn0026056 transcript:FBtr0336772[more]
Rlip5.035e-3533.96gene:FBgn0026056 transcript:FBtr0084002[more]
RhoGAP68F2.471e-1633.94gene:FBgn0036257 transcript:FBtr0334091[more]
RhoGAP68F3.600e-1633.94gene:FBgn0036257 transcript:FBtr0334093[more]
RhoGAP68F3.683e-1633.94gene:FBgn0036257 transcript:FBtr0075997[more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralbp12.042e-3434.44ralA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ophn11.176e-1535.53oligophrenin 1 [Source:ZFIN;Acc:ZDB-GENE-040718-46... [more]
arhgap35a4.668e-1428.33Rho GTPase activating protein 35a [Source:ZFIN;Acc... [more]
arhgap35a4.668e-1428.33Rho GTPase activating protein 35a [Source:ZFIN;Acc... [more]
arhgap35b6.405e-1330.20Rho GTPase activating protein 35b [Source:ZFIN;Acc... [more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrm31.126e-3333.09cholinergic receptor, muscarinic 3 [Source:Xenbase... [more]
chrm31.934e-3333.09cholinergic receptor, muscarinic 3 [Source:Xenbase... [more]
bora1.485e-1329.68bora, aurora kinase A activator [Source:Xenbase;Ac... [more]
fadd2.566e-1333.78Fas associated via death domain [Source:Xenbase;Ac... [more]
tox32.725e-1329.95TOX high mobility group box family member 3 [Sourc... [more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ralbp11.003e-3132.44ralA binding protein 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ralbp11.003e-3132.44ralA binding protein 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ralbp13.233e-2032.75ralA binding protein 1 [Source:MGI Symbol;Acc:MGI:... [more]
Arhgap271.830e-1531.36Rho GTPase activating protein 27 [Source:MGI Symbo... [more]
Arhgap273.138e-1531.36Rho GTPase activating protein 27 [Source:MGI Symbo... [more]
back to top
BLAST of RalA-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VDG2|RLIP_DROME5.047e-3433.96RalA-binding protein 1 OS=Drosophila melanogaster ... [more]
sp|Q15311|RBP1_HUMAN3.635e-3333.59RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9PT60|RBP1A_XENLA8.065e-3232.35RalA-binding protein 1-A OS=Xenopus laevis OX=8355... [more]
sp|Q62796|RBP1_RAT4.882e-3132.82RalA-binding protein 1 OS=Rattus norvegicus OX=101... [more]
sp|Q62172|RBP1_MOUSE7.019e-3132.44RalA-binding protein 1 OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of RalA-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E4K02.083e-4836.60Rho-GAP domain-containing protein OS=Macrostomum l... [more]
A0A1I8HIR11.601e-4736.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HMN11.898e-4736.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
E2BNG74.395e-3939.10RalA-binding protein 1 OS=Harpegnathos saltator OX... [more]
A0A026WEJ85.388e-3938.81RalA-binding protein OS=Ooceraea biroi OX=2015173 ... [more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralbp14.819e-3432.96ralA binding protein 1 [Source:NCBI gene;Acc:10304... [more]
ralbp14.819e-3432.96ralA binding protein 1 [Source:NCBI gene;Acc:10304... [more]
ophn14.973e-1535.53oligophrenin 1 [Source:ZFIN;Acc:ZDB-GENE-040718-46... [more]
arhgap271.035e-1330.43rho GTPase-activating protein 27 [Source:NCBI gene... [more]
arhgap271.410e-1330.43rho GTPase-activating protein 27 [Source:NCBI gene... [more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralbp11.526e-3734.10ralA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
arhgap21b2.052e-1232.95Rho GTPase activating protein 21b [Source:ZFIN;Acc... [more]
ENSPMAT00000003939.14.294e-1130.00pep scaffold:Pmarinus_7.0:GL477112:28457:91290:-1 ... [more]
arhgap58.265e-1025.44Rho GTPase activating protein 5 [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000004494.11.579e-926.47pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-... [more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
BEM31.108e-1026.70Rho GTPase activating protein (RhoGAP); involved i... [more]
RGA12.998e-926.21GTPase-activating protein for polarity-establishme... [more]
RGD11.718e-727.92GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
RGA27.021e-729.65GTPase-activating protein for polarity-establishme... [more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO340211.323e-3536.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456678.665e-1332.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479951.445e-1128.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478421.017e-1029.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490531.658e-1032.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RalA-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralbp17.625e-3534.19ralA binding protein 1 [Source:NCBI gene;Acc:10117... [more]
ralbp11.068e-3434.19ralA binding protein 1 [Source:NCBI gene;Acc:10117... [more]
ralbp13.215e-2229.52ralA binding protein 1 [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000008703.24.893e-1529.41Rho GTPase activating protein 35 [Source:NCBI gene... [more]
ENSORLT00000036475.11.075e-1432.14rho GTPase-activating protein 23 [Source:NCBI gene... [more]
back to top
BLAST of RalA-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043489.10.000e+099.89SMESG000043489.1[more]
SMESG000068429.18.251e-1028.40SMESG000068429.1[more]
SMESG000068429.18.383e-1028.40SMESG000068429.1[more]
SMESG000025211.15.385e-931.43SMESG000025211.1[more]
SMESG000025211.15.460e-931.43SMESG000025211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024063 ID=SMED30024063|Name=RalA-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2840bp
TGAACTTCATTTTATTTTGATTATTAATTAATAATTTTTTGGAAGTGACA
AACTTTATCACTTTAAGTGAATTTTAGAAATCAATTTCTCAATGACAAAT
TTGGAACTTAAAAAGCATGGAATATTTGACAAAACTCGTAAAGATAAAAA
AGAAATAAATGTTGCCTATCATACCATTGGAGATTCTAGGACTTCACTTG
ATGTATCTAACATTGTTATACCTGATCTTGAACAAAAATTAGACGATAAT
TTGCATGCAAATGTAACGGTTAATTTAAAAAAATCAAAAACATTTAAAAT
AATGGTAAATAAAAAACCGAAAGAAAAAGAAAAAGGTTCTAAAATTGACA
GTTTCAAAAAACCTAAAAATAAAAAACGTAAACGAAAGGAAATCAAAACT
GAATCGTTCGTTATTGAACCAATCAAAGAGGTAGGATTAACACGTCCAAT
TTTTGGAGTATCATTGAAAGAAGCGTGCAAAAATAGTAAATCCCATGACG
GTTATCCATTGCCAGCATTTTTTCGCCAGTGTATAAATTATCTAGAAACA
GACAACCGGTTAAGCTTCGAGGGAATTTATCGGATTCCCGGAGTAAATTC
TCAAATAGTTAAACTCAAGCAATTACTCAACACTGATATCAACACCGATA
AACTCTTATCCAATTTCGATATCGCTGTCATTACAAGCGTCGTAAAATCG
TTTCTCAGAGATCTGAAACCGGAACTTATCGAAAAGTCGTTAGAGGCCTC
ACTATTCAAAGCACTCGAACAGCACAAAGAAAACATGCAGGATAGAGTAG
GCATCGTTAAAAAAATGCTCACTCAACACCTCCCTGAAGAAAATCAATAT
CTGCTCGCATTGATCACCAGTCACATGGGAAAAGTCATTGACATGTCCAA
TCAAAACAAAATGTCACTGGAAAATCTATTAATCGTTCTCAGTCCAGCTC
TGCATTTGCATTTTGGGTTACTCAAAATGTTCTATGATCATTCATCGGAT
ATATTTTCCGATTTACAAGCGCCCGTTTATGTTCCCCCAGTCAGACCCGG
TCCGGAATATGAAGAAGAACTTCCAGAAACTGTAGAAGGCATTAATGAAG
AGTTGAAAAAGCAGGTATCTTATCTGGATGACTTGCACGAGCAGATCAAT
GAAGGATTCGAGACTAAAAACACTGAATATTTAATCTGGGAAGTTCAACT
TATAGTTACGAAATTAAAACGTAAGAAATATATAGCCGAATTGAATGACC
CTGAATTAATAAAGGTGGAATTGAAAAAATACGAAAGACAACTAGAAAAA
CTTCATAAAGATATGTTAGAAACCGTAAACAATACACCAACAACCGCATC
AGTAGTAGTTGGATCTAATTCAACTGGAAATTCAATTTCTGCTGTACAGG
CTAATAATATTGTCGATCAAACCAGTGGTGTCGGTGCTCCTTCGACTGCC
GACCAAGAACTCTGGCAAATTCAGCGAACGATAACAACTTTAAATAGAAA
ATTGAAATCTTTGACAACATATTCTGTGCCAAGATTTCAAGCTGAATCGT
ATGTACCAATGGGGTTCGGTCAAAAAGTAGAAAATATAAATGACGACGAT
GTTGGTGGTGGTAATTGTGATGATGGTGATGATGATGATGATGATAGCGT
CCAGTTGAATTTGACTTTAAGGAAGTTACCCCGAGAAACACCAGAGATTA
TGGAAGAGGAAATTAATAATGTCTCCGACAGGGATACTTCTGCTGTAAAT
GTCAATGAATCAGAAATTAATACAAATGCAATTCAAAGCGAATCAAATCA
TATTGAAGGGGATATATATGCTGAAGTTATCCCCGATGAAATGGTGAAAT
CAAGTGATGAAAAGACTTCGGATTGGTTAATGTCGGATGATCAGCATCCG
GAAGCTGGACGTGACAATGCTACTGTTGAACAGCAGACGATTGCCGAGGA
CAATCACTTGGCAGTCAGTAGTATTGACATTGAACAATCAGTTAGTTCCA
ATGGCGTGAATCACACTACTGAAGATGATAATGAATCAAATTCTGAATCA
GAATTGACTGGATCAAATATAGCCACATGTATTGATGATTTAATTCAAAC
TGGTGAAATGTGGACCAATGAAAAAGAACAGCTTCTATCCGAAGACGATG
ATCTTAGAAATGAGGCATTGAGATATTTATACATGAGAGAGGAGCTGATT
TCCATTAAGAATGATTTAAAAACTCGACTTACTTCGGAGGCCAATGAAAT
CGCCCGTTTGAAAAGAAATATCGAGAGTTTAGAGGAGGAGAAATCACAGA
AAACTTTCAGTGTGCAAAATCAATATCGAAAGTTGAACGAATCGTCATCG
TCACCAGAGAATAGAGAAGATTGTGAAGGAGAAGATAACGATGAGGAGAA
CGATGAAAGTGAAGATGAAGAGGATGATCCCGATGACAGCAGCCATGATG
AGTGCTCGGAGCCGATGCAATATTCAGATAAGATTATCGGAGGTCGCGGA
GGTCAGGAGGATTGTCAGCAGGAGGATATCGCAGACCTCCTGAAGCAGCA
GCAGGAAATCATGCTCGACAACGAACGGCTGGAAAAGGACAATATGGATC
TCCTGGAACAAATCCAATTGGAACGCAATCACTGTATAGAGTTGAAGGTT
GCACTAAGGACTCACATGTTGCTGGCCTGCCCGTCTCCATGGCCTTCTAA
TATCGATGAATGATGATGATTATTACGCAATTGTTGTTTTCTGTGTTTTT
CAGAAAATTATTTTTCTTTATACAAGTATATTATTAGTTTTGAATTTCAA
TAAGGTTTATCGATTTTCAGTGATTTTTAGTTCCCACGCA
back to top

protein sequence of SMED30024063-orf-1

>SMED30024063-orf-1 ID=SMED30024063-orf-1|Name=SMED30024063-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=874bp
MTNLELKKHGIFDKTRKDKKEINVAYHTIGDSRTSLDVSNIVIPDLEQKL
DDNLHANVTVNLKKSKTFKIMVNKKPKEKEKGSKIDSFKKPKNKKRKRKE
IKTESFVIEPIKEVGLTRPIFGVSLKEACKNSKSHDGYPLPAFFRQCINY
LETDNRLSFEGIYRIPGVNSQIVKLKQLLNTDINTDKLLSNFDIAVITSV
VKSFLRDLKPELIEKSLEASLFKALEQHKENMQDRVGIVKKMLTQHLPEE
NQYLLALITSHMGKVIDMSNQNKMSLENLLIVLSPALHLHFGLLKMFYDH
SSDIFSDLQAPVYVPPVRPGPEYEEELPETVEGINEELKKQVSYLDDLHE
QINEGFETKNTEYLIWEVQLIVTKLKRKKYIAELNDPELIKVELKKYERQ
LEKLHKDMLETVNNTPTTASVVVGSNSTGNSISAVQANNIVDQTSGVGAP
STADQELWQIQRTITTLNRKLKSLTTYSVPRFQAESYVPMGFGQKVENIN
DDDVGGGNCDDGDDDDDDSVQLNLTLRKLPRETPEIMEEEINNVSDRDTS
AVNVNESEINTNAIQSESNHIEGDIYAEVIPDEMVKSSDEKTSDWLMSDD
QHPEAGRDNATVEQQTIAEDNHLAVSSIDIEQSVSSNGVNHTTEDDNESN
SESELTGSNIATCIDDLIQTGEMWTNEKEQLLSEDDDLRNEALRYLYMRE
ELISIKNDLKTRLTSEANEIARLKRNIESLEEEKSQKTFSVQNQYRKLNE
SSSSPENREDCEGEDNDEENDESEDEEDDPDDSSHDECSEPMQYSDKIIG
GRGGQEDCQQEDIADLLKQQQEIMLDNERLEKDNMDLLEQIQLERNHCIE
LKVALRTHMLLACPSPWPSNIDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0017160Ral GTPase binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0043547positive regulation of GTPase activity
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR039767RALBP1
IPR000198RhoGAP_dom
IPR008936Rho_GTPase_activation_prot
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 394..414
NoneNo IPR availableCOILSCoilCoilcoord: 706..740
NoneNo IPR availableCOILSCoilCoilcoord: 813..847
NoneNo IPR availableGENE3DG3DSA:1.20.58.90coord: 322..381
e-value: 5.7E-17
score: 63.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 632..658
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 73..99
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 760..785
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 732..790
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 73..87
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 736..751
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 138..323
e-value: 2.7E-26
score: 103.3
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 141..288
e-value: 1.6E-31
score: 109.2
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 123..313
score: 30.669
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 48..310
e-value: 2.3E-43
score: 150.1
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 117..295
IPR039767RalA-binding protein 1PANTHERPTHR12783RALA BINDING PROTEIN 1 RALBP1coord: 64..405