SMED30024061

Overview
NameSMED30024061
Smed IDSMED30024061
Length (bp)1937
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024061 (SMED30024061) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024061 (SMED30024061) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024061 (SMED30024061) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024061 (SMED30024061) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024061

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024061SMESG000016986.1 SMESG000016975.1 SmedASXL_006121SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30024061SMESG000016986.1 SMESG000016975.1 dd_Smed_v4_14434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024061SMESG000016986.1 SMESG000016975.1 dd_Smed_v4_14434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024061SMESG000016986.1 SMESG000016975.1 dd_Smed_v4_14434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024061SMESG000016986.1 SMESG000016975.1 dd_Smed_v4_14434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024061SMESG000016986.1 SMESG000016975.1 dd_Smed_v6_14434_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024061SMESG000016986.1 SMESG000016975.1 OX_Smed_1.0.22447ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30024061SMESG000016986.1 Contig11885newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024061SMESG000016986.1 Contig11885uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30024061 vs. Ensembl Human
Match: ESPN (espin [Source:HGNC Symbol;Acc:HGNC:13281])

HSP 1 Score: 132.494 bits (332), Expect = 1.831e-31
Identity = 72/238 (30.25%), Postives = 124/238 (52.10%), Query Frame = 3
Query:   60 ANIMSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A ++     + L+ L  + + A  G L   ++L+  +   +   +   +    AH+A+ATG+L  L+W       +V D+D  G TVLH+A    +  +V W++      P   T+ GA  +H+    G+F   +LL+E  P  +N +  NGAT    A Q G++++ ++L+ E GA+      +G+  LH AAQ GH   + WLV  T + L+ +D +G T +H+AA   H +++SW
Sbjct:   24 AGLLGPSLRDPLDALP-VHHAARAGKLHCLRFLVEEAALPAA--ARARNGATPAHDASATGHLACLQWLLSQGGCRVQDKDNSGATVLHLAARFGHPEVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVWLVSCTDVSLSEQDKDGATAMHFAASRGHTKVLSW 258          

HSP 2 Score: 69.3218 bits (168), Expect = 1.742e-11
Identity = 58/224 (25.89%), Postives = 99/224 (44.20%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNTAL-----CGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGIT 722
            ++S+  C  +++ DN   T L      GH +   +LL+         +  +      H AAA G+   L+   ++    V  Q   G T L++AC   +L + Q+++Q     P  R  +G T LH     G+  +   L+      ++ +  +GATA  FA   G+  ++ +LL  G         G   LH AA+ G ++  + LV N G  L+ +D +G T
Sbjct:   89 LLSQGGCR-VQDKDNSGATVLHLAARFGHPEVVNWLLHHGG--GDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVWLVSCTDVSLSEQDKDGATAMHFAASRGHTKVLSWLLLHGGEISADLWGGTP-LHDAAENGELECCQILVVN-GAELDVRDRDGYT 307          

HSP 3 Score: 58.9214 bits (141), Expect = 2.603e-8
Identity = 49/219 (22.37%), Postives = 91/219 (41.55%), Query Frame = 3
Query:  219 AHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGAN--------FGLP---------------------------TKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A  AA  G L++L+          + +DP     +H A     L+ ++++++   L    R   GAT  H    +G+    + L+      +  +  +GAT    A + G+ +++ +LL+ G            LP                           TKNG   L++A Q+GH++  ++LV+  G   + +  +G+TP+H AA   H  ++ W
Sbjct:    6 ALQAARQGELDVLRSLHAAGLLGPSLRDPLDALPVHHAARAGKLHCLRFLVEEAALPAAARARNGATPAHDASATGHLACLQWLLSQGGCRVQDKDNSGATVLHLAARFGHPEVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVW 224          
BLAST of SMED30024061 vs. Ensembl Human
Match: ESPN (espin [Source:HGNC Symbol;Acc:HGNC:13281])

HSP 1 Score: 131.724 bits (330), Expect = 5.007e-31
Identity = 72/238 (30.25%), Postives = 122/238 (51.26%), Query Frame = 3
Query:   60 ANIMSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A ++     + L+ L  + + A  G L   ++L+          +   +    AH+A+ATG+L  L+W       +V D+D  G TVLH+A    +  +V W++      P   T+ GA  +H+    G+F   +LL+E  P  +N +  NGAT    A Q G++++ ++L+ E GA+      +G+  LH AAQ GH   + WLV  T + L+ +D +G T +H+AA   H +++SW
Sbjct:   24 AGLLGPSLRDPLDALP-VHHAARAGKLHCLRFLVE--EAALPAAARARNGATPAHDASATGHLACLQWLLSQGGCRVQDKDNSGATVLHLAARFGHPEVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVWLVSCTDVSLSEQDKDGATAMHFAASRGHTKVLSW 258          

HSP 2 Score: 68.5514 bits (166), Expect = 2.739e-11
Identity = 58/224 (25.89%), Postives = 99/224 (44.20%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNTAL-----CGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGIT 722
            ++S+  C  +++ DN   T L      GH +   +LL+         +  +      H AAA G+   L+   ++    V  Q   G T L++AC   +L + Q+++Q     P  R  +G T LH     G+  +   L+      ++ +  +GATA  FA   G+  ++ +LL  G         G   LH AA+ G ++  + LV N G  L+ +D +G T
Sbjct:   89 LLSQGGCR-VQDKDNSGATVLHLAARFGHPEVVNWLLHHGG--GDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVWLVSCTDVSLSEQDKDGATAMHFAASRGHTKVLSWLLLHGGEISADLWGGTP-LHDAAENGELECCQILVVN-GAELDVRDRDGYT 307          

HSP 3 Score: 58.151 bits (139), Expect = 5.239e-8
Identity = 49/219 (22.37%), Postives = 91/219 (41.55%), Query Frame = 3
Query:  219 AHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGAN--------FGLP---------------------------TKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A  AA  G L++L+          + +DP     +H A     L+ ++++++   L    R   GAT  H    +G+    + L+      +  +  +GAT    A + G+ +++ +LL+ G            LP                           TKNG   L++A Q+GH++  ++LV+  G   + +  +G+TP+H AA   H  ++ W
Sbjct:    6 ALQAARQGELDVLRSLHAAGLLGPSLRDPLDALPVHHAARAGKLHCLRFLVEEAALPAAARARNGATPAHDASATGHLACLQWLLSQGGCRVQDKDNSGATVLHLAARFGHPEVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVW 224          
BLAST of SMED30024061 vs. Ensembl Human
Match: ESPNL (espin like [Source:HGNC Symbol;Acc:HGNC:27937])

HSP 1 Score: 117.472 bits (293), Expect = 1.472e-26
Identity = 70/219 (31.96%), Postives = 112/219 (51.14%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            + +    GHL   K+L+  +     + +  ++    AH+AAATG+L  L W  +     + DQD  G++ LH+A    +  +V+W++   H S    T EGA  LH    SG+    KLL       +N R  +GA+    A Q G++ + +FL+ + GA+  L   +G++ LH AA +GH   V WLV  T + L  +D+ G T +H+AA   H  I+
Sbjct:   40 VHHATRAGHLDCVKFLVQRAQLPGNQRA--HNGATPAHDAAATGSLAELCWLVREGGCGLQDQDASGVSPLHLAARFGHPVLVEWLLHEGH-SATLETREGARPLHHAAVSGDLTCLKLLTAAHGSSVNRRTRSGASPLYLACQEGHLHLAQFLVKDCGADVHLRALDGMSALHAAAARGHYSLVVWLVTFTDIGLTARDNEGATALHFAARGGHTPIL 255          

HSP 2 Score: 51.9878 bits (123), Expect = 3.247e-6
Identity = 30/90 (33.33%), Postives = 44/90 (48.89%), Query Frame = 3
Query:  513 GATAAMFATQGGYIDIMEFLLNEGANFGLP----TKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            GA     AT+ G++D ++FL+       LP      NG    H AA  G +  + WLV   G  L  +D +G++P+H AA   H  +V W
Sbjct:   36 GAGLVHHATRAGHLDCVKFLVQRAQ---LPGNQRAHNGATPAHDAAATGSLAELCWLVREGGCGLQDQDASGVSPLHLAARFGHPVLVEW 122          
BLAST of SMED30024061 vs. Ensembl Human
Match: ESPNL (espin like [Source:HGNC Symbol;Acc:HGNC:27937])

HSP 1 Score: 117.472 bits (293), Expect = 1.482e-26
Identity = 70/213 (32.86%), Postives = 110/213 (51.64%), Query Frame = 3
Query:  129 CGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
             GHL   K+L+  +     + +  ++    AH+AAATG+L  L W  +     + DQD  G++ LH+A    +  +V+W++   H S    T EGA  LH    SG+    KLL       +N R  +GA+    A Q G++ + +FL+ + GA+  L   +G++ LH AA +GH   V WLV  T + L  +D+ G T +H+AA   H  I+
Sbjct:   46 AGHLDCVKFLVQRAQLPGNQRA--HNGATPAHDAAATGSLAELCWLVREGGCGLQDQDASGVSPLHLAARFGHPVLVEWLLHEGH-SATLETREGARPLHHAAVSGDLTCLKLLTAAHGSSVNRRTRSGASPLYLACQEGHLHLAQFLVKDCGADVHLRALDGMSALHAAAARGHYSLVVWLVTFTDIGLTARDNEGATALHFAARGGHTPIL 255          

HSP 2 Score: 51.9878 bits (123), Expect = 3.409e-6
Identity = 30/90 (33.33%), Postives = 44/90 (48.89%), Query Frame = 3
Query:  513 GATAAMFATQGGYIDIMEFLLNEGANFGLP----TKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            GA     AT+ G++D ++FL+       LP      NG    H AA  G +  + WLV   G  L  +D +G++P+H AA   H  +V W
Sbjct:   36 GAGLVHHATRAGHLDCVKFLVQRAQ---LPGNQRAHNGATPAHDAAATGSLAELCWLVREGGCGLQDQDASGVSPLHLAARFGHPVLVEW 122          
BLAST of SMED30024061 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 85.5001 bits (210), Expect = 2.048e-16
Identity = 66/215 (30.70%), Postives = 102/215 (47.44%), Query Frame = 3
Query:  123 ALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVS 767
            A  GH +  KYLL    K++ K   K+D   L H AA  G+ N++K   +N  +        G T LH+A    ++  V  +++    S    T++G T LH     G   + +LL+E +    N    NG T    A     +DI++ LL  G +   P  NG   LH+AA+Q  V+  + L++  G   N +   G+TP+H AA   H E+V+
Sbjct:  478 ARAGHTEVAKYLLQNKAKVNAK--AKDDQTPL-HCAARIGHTNMVKLLLENNANPNLATT-AGHTPLHIAAREGHVETVLALLE-KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH-PNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGG-SANAESVQGVTPLHLAAQEGHAEMVA 685          

HSP 2 Score: 78.1814 bits (191), Expect = 3.773e-14
Identity = 63/217 (29.03%), Postives = 108/217 (49.77%), Query Frame = 3
Query:   90 SLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAA 740
            +L++L  +   A CGH +  K LL+   K +K +S   + +   H A    ++ +++   K T + +      GLT LHVA    +L IV+ ++Q    SP     +  T LH    +G+ E+ K L++ + + +N +  +  T    A + G+ ++++ LL   AN  L T  G   LH+AA++GHV+ V  L+E    +       G TP+H AA
Sbjct:  368 TLDHLTPLHVAAHCGHHRVAKVLLD---KGAKPNSRALNGFTPLHIACKKNHVRVMELLLK-TGASIDAVTESGLTPLHVASFMGHLPIVKNLLQ-RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK-VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQAC-MTKKGFTPLHVAA 577          

HSP 3 Score: 74.7146 bits (182), Expect = 4.367e-13
Identity = 71/266 (26.69%), Postives = 120/266 (45.11%), Query Frame = 3
Query:   51 NINANIMSEFTCESLENLDNISNTALCGHLQAFKYLL-NTSNK-ISKKDSL--------KNDNYYLAH--NAAATGNLNL--LKWTFKNTKSKVT------DQDPE-----GLTVLHVACLTANLNIVQWVI---QCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            N+NA     FT   +   +N        HL+  K+LL N +N+ ++ +D          +     +AH  N    G + L  L    +N  ++        D +P+     G T LH+A    NLN+ Q ++      + +P    + G T LH     GN  + +LL++   + I  +  +  T    A + G++ I E LL+ GA     TKNG++ +HMAAQ  H+D V+ L++     ++    + +TP+H AA   HH + 
Sbjct:  136 NVNAQSQKGFTPLYMAAQEN--------HLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP----QNGITPLHIASRRGNVIMVRLLLDRGAQ-IETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDA-EIDDITLDHLTPLHVAAHCGHHRVA 387          

HSP 4 Score: 70.8626 bits (172), Expect = 6.351e-12
Identity = 47/154 (30.52%), Postives = 80/154 (51.95%), Query Frame = 3
Query:  309 GLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            GLT LHVA    NL+IV+ ++     SP +    G T LH        E+ + L++      N   + G T    A Q G+ +++  LL++ AN  L  K+G+  LH+ AQ+GHV     L+++ G+ ++     G TP+H A+ + + ++V +
Sbjct:  602 GLTPLHVAVHHNNLDIVKLLLPRGG-SPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGS-ANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKH-GVMVDATTRMGYTPLHVASHYGNIKLVKF 752          

HSP 5 Score: 67.0106 bits (162), Expect = 9.210e-11
Identity = 57/222 (25.68%), Postives = 102/222 (45.95%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQ---------CTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            G++   + LL+   +I  K     D     H AA  G++ + +    +  + +  +   GL+ +H+A    +L+ V+ ++Q           HL+P          LH     G+  + K+L++   +  N R LNG T    A +  ++ +ME LL  GA+    T++G+  LH+A+  GH+  VK L++  G   N  +    TP+H AA   H E+  +
Sbjct:  283 GNVIMVRLLLDRGAQIETK---TKDELTPLHCAARNGHVRISEILLDH-GAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTP----------LHVAAHCGHHRVAKVLLDKGAK-PNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKY 488          

HSP 6 Score: 59.6918 bits (143), Expect = 1.826e-8
Identity = 43/144 (29.86%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  306 EGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYA 737
            +G+T LH+A    +  +V  ++     +     + G T LH     G+  +  +LI+    +++     G T    A+  G I +++FLL   A+    TK G + LH AAQQGH D V  L++N G   N    +G TP+  A
Sbjct:  667 QGVTPLHLAAQEGHAEMVALLL-SKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIK-HGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKN-GASPNEVSSDGTTPLAIA 807          

HSP 7 Score: 59.3066 bits (142), Expect = 2.657e-8
Identity = 39/124 (31.45%), Postives = 65/124 (52.42%), Query Frame = 3
Query:  309 GLTVLHVACLTANLNIVQWVIQCTHLSPV--TRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLV 674
            GL  LH+A    +   V+ V++  H   +  T T++G TALH    +G  E+ + L+      +N +   G T    A Q  ++++++FLL  GAN  + T++G   L +A QQGH + V  L+
Sbjct:   78 GLNGLHLASKEGH---VKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGAN-VNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI 197          

HSP 8 Score: 57.3806 bits (137), Expect = 8.762e-8
Identity = 36/119 (30.25%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  411 GATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVS 767
            G   LH     G+ ++   L+  E  ++      G TA   A   G  +++  L+N GAN    ++ G   L+MAAQ+ H++ VK+L+EN G   N   ++G TP+  A    H  +V+
Sbjct:   78 GLNGLHLASKEGHVKMVVELLHKE-IILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVA 194          
BLAST of SMED30024061 vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 77.0258 bits (188), Expect = 2.883e-14
Identity = 65/244 (26.64%), Postives = 107/244 (43.85%), Query Frame = 3
Query:   78 FTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEIT-------KLLIETEPRLINMRMLN------GATAAMFATQGGYIDIMEFLLNEGANF-GLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVS 767
            FTC  +         A+ G L   + L+     +  +   K       H AAA G+ N++K   +N  +   D++  G+T LH+      ++I++   +   L      + G  ALH   + GN +         +  + +EP + N  +        G T    A Q G+  ++  LLN+G       T   V  LH+AAQQGH+  V  L+  +  + + KD  G TP+H AA + H+E+VS
Sbjct: 1058 FTCAHI--------AAMKGSLAVVRELMMIDKPMVIQAKTKTLEATTLHMAAAGGHANIVKILLEN-GANAEDENSHGMTALHLGAKNGFISILEAFDKI--LWKRCSRKTGLNALHIAAFYGNSDFVNEMLKHVQATVRSEPPIYNHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVS 1290          

HSP 2 Score: 70.0922 bits (170), Expect = 4.803e-12
Identity = 55/231 (23.81%), Postives = 99/231 (42.86%), Query Frame = 3
Query:  120 TAL-CGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDP-------------EGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            TAL  G    F  +L   +KI  K   +       H AA  GN + +    K+ ++ V  + P              G T LH+A  + + ++V+ ++        T T      LH     G+  +  +L+    +  + +   G T    A Q G+ +++  L+ +G+N  +  +NG   LH A + GH+  VK  ++++   L  +   G  P+ +AA HNH E + +
Sbjct: 1128 TALHLGAKNGFISILEAFDKILWKRCSRKTGLNALHIAAFYGNSDFVNEMLKHVQATVRSEPPIYNHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPL-AETKEGKVPLCFAAAHNHIECLRF 1357          

HSP 3 Score: 65.0846 bits (157), Expect = 1.579e-10
Identity = 73/290 (25.17%), Postives = 128/290 (44.14%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLN--GATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDN-GITPIHYAAVHNHHEI--VSWXXXXXXXXXXXXFMIG--CQNSTLKNESSETIDCLI--NSENSLSIK----------KICDFSALESVQEKLTLILSQYNQNSLIKKKENDNNGIVHCSIPI 1034
            H  A  G+ N+LK  FK  ++     D E  T +HVA    + ++V+ +I     S   RT +G+T LH    SG+       ++   R + + M N  GA     A   G+ D+++ L+  G N  + T++    LH+A Q G    V+ L+  +G  ++ K    G T +H AA  N  E    + +L K         M G  C +   ++ + + +  L+  N+++ +S K          K C+F A   + + L+ +L+Q      +  + ND    +H +  I
Sbjct:  531 HEVAEVGDQNMLKIMFK-LRADANIHDKEDKTPVHVAAERGDTSMVESLIDKFGGSIRARTRDGSTLLHIAACSGHTSTALAFLK---RGVPLFMPNKKGALGLHSAAAAGFNDVVKMLIARGTNVDVRTRDNYTALHVAVQSGKASVVETLL-GSGADIHVKGGELGQTALHIAASLNGAESRDCAMMLLKSGGQPDVAQMDGETCLHIAARSGNKDIMRLLLDENADSKISSKIGETPLQVAAKSCNFEAASMILKHLSEVLTQEQLKEHVNHRTNDGFTALHYAAEI 815          

HSP 4 Score: 59.3066 bits (142), Expect = 8.845e-9
Identity = 45/159 (28.30%), Postives = 74/159 (46.54%), Query Frame = 3
Query:  300 DPEGLTVLHVACLTANLNIVQWVIQCTHLSPV-TRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVE---NTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            D  G T LH+A    +L++V  ++Q  H + V ++++ G   LH     G+ ++  +L++     +    L+  TA  FA + G + + + LL  GAN       G   LH+AA+    D VK  ++   N    L   D NG T  H AA+     +V
Sbjct:  917 DEMGRTALHLAAFNGHLSLVHLLLQ--HKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDHGAALEAITLDNQTALHFAAKFGQLAVSQTLLALGANPNARDDKGQTPLHLAAENDFPDVVKLFLKMRNNNRSVLTAIDHNGFTCAHIAAMKGSLAVV 1073          

HSP 5 Score: 50.8322 bits (120), Expect = 3.706e-6
Identity = 45/188 (23.94%), Postives = 77/188 (40.96%), Query Frame = 3
Query:  315 TVLHVACLTANLNIVQWVIQCTHLSPV-----TRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRL---------------------------------NGKDDNGITPIHYAAVHNHHEIV 764
            T +H+A  + N  ++  ++       V      +++ G + L   C  G+  +  +L++   R I++    G TA   A   G++ ++  LL   A     +K G   LH+AAQ GHV  V  LV++ G  L                                 N +DD G TP+H AA ++  ++V
Sbjct:  850 TAMHMAARSGNQAVLLAMVNKIGAGAVQIVQNKQSKNGWSPLLEACARGHSGVANILLKHHAR-IDVFDEMGRTALHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDHGAALEAITLDNQTALHFAAKFGQLAVSQTLLALGANPNARDDKGQTPLHLAAENDFPDVV 1036          

HSP 6 Score: 50.8322 bits (120), Expect = 3.867e-6
Identity = 31/120 (25.83%), Postives = 61/120 (50.83%), Query Frame = 3
Query:  321 LHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVEN 680
            LH+A    ++ +V  ++  +      +   G T LH    +G++E+  LLI  +   IN+   NG T   FAT+ G++ +++  ++  A+    TK G   L  AA   H++ +++L++ 
Sbjct: 1243 LHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLI-AQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFAAAHNHIECLRFLLKQ 1361          
BLAST of SMED30024061 vs. Ensembl Celegans
Match: fem-1 (Sex-determining protein fem-1 [Source:UniProtKB/Swiss-Prot;Acc:P17221])

HSP 1 Score: 71.2478 bits (173), Expect = 1.168e-12
Identity = 58/194 (29.90%), Postives = 99/194 (51.03%), Query Frame = 3
Query:  222 HNAAATGNLNLLK-WTF--KNTKSKVTD---QDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEE-------GATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            +NAAA GNL  +K +T   +N +  + D    D +G   L +A    + N+V+++++      V    E       G   L     +G+ EI KLLIE     +N      +T    A   G++DI+++LL +GA+  +P ++G  CL +A+ +  V  V+ L++ TG+ +N K + G T +H AA   + E+V
Sbjct:   13 YNAAAVGNLQRIKVFTINSRNDRQWIIDCFNSDQDGRYPLVIAARNGHANVVEYLLEIGADPSVRGVVEFDNENIQGTPPLWAASAAGHIEIVKLLIEKANADVNQATNTRSTPLRGACYDGHLDIVKYLLEKGADPHIPNRHGHTCLMIASYRNKVGIVEELLK-TGIDVNKKTERGNTALHDAAESGNVEVV 205          

HSP 2 Score: 51.6026 bits (122), Expect = 1.597e-6
Identity = 42/170 (24.71%), Postives = 81/170 (47.65%), Query Frame = 3
Query:   75 EFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTF-KNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE 581
            EF  E+++    +   +  GH++  K L+  +N  +  +   N        A   G+L+++K+   K     + ++   G T L +A     + IV+ +++ T +    +TE G TALH    SGN E+ K+L++    L  M+ + G    M A   G++D++  L ++
Sbjct:   81 EFDNENIQGTPPLWAASAAGHIEIVKLLIEKAN--ADVNQATNTRSTPLRGACYDGHLDIVKYLLEKGADPHIPNR--HGHTCLMIASYRNKVGIVEELLK-TGIDVNKKTERGNTALHDAAESGNVEVVKILLKHGSVL--MKDIQGVDPLMGAALSGFLDVLNVLADQ 243          
BLAST of SMED30024061 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 69.707 bits (169), Expect = 4.849e-12
Identity = 58/227 (25.55%), Postives = 109/227 (48.02%), Query Frame = 3
Query:   90 SLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLR--LNGKDDNGITPIHYAAVHNHHEIV 764
            +++ L  +   A CGH++  K LL+ S   +  +S   + +   H A     + +++   K  ++ +      GLT LHVA     +NIV +++Q    +P   T  G T LH    +   ++ ++LI    + ++ +     T    A++ G  DI+  LL  GAN    T++  + LH+AA++G  +    L+++   +  L  K   G TP+H A+ + + E+V
Sbjct:  356 TVDYLTPLHVAAHCGHVRVAKLLLDRS---ADPNSRALNGFTPLHIACKKNRIKVVELLLK-YRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ-QGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVV 573          

HSP 2 Score: 66.6254 bits (161), Expect = 4.786e-11
Identity = 51/188 (27.13%), Postives = 83/188 (44.15%), Query Frame = 3
Query:  282 SKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENT--------GLRLNGKDDN--------------------GITPIHYAAVHNHHEI 761
            + +   +  GL  LH+A    +  +V+ +I+         T +G TALH    +G   I  +L+E     +N++ +NG T    A Q  + +++++LL  GAN  L T++G   L +A QQGH   V  L+EN          L +  K D+                    G TP+H AA + H  +
Sbjct:   57 TDINTSNANGLNSLHLASKEGHSEVVRELIK-RQAQVDAATRKGNTALHIASLAGQSLIVTILVENGAN-VNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENV 242          

HSP 3 Score: 64.3142 bits (155), Expect = 2.617e-10
Identity = 56/195 (28.72%), Postives = 89/195 (45.64%), Query Frame = 3
Query:  156 LLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPV-TRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYA 737
            +L   N  S K + KN   Y   + AA  N   +  T    K+    +   G T LH++    +  I   +I+  + S V  +   G TA+H C    +  + ++L       IN +   G T    A   G +++++FL+  GA+ G  T+     LH AAQQGH + V++L+EN G   N +   G TP+  A
Sbjct:  607 MLLLENGASAKAAAKNG--YTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIE--NGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE-INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN-GASPNEQTATGQTPLSIA 795          

HSP 4 Score: 63.1586 bits (152), Expect = 5.359e-10
Identity = 54/184 (29.35%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIE--TEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVS 767
            H AA     ++++   +N  +KV  Q  E  T LH+A    N +IV  ++Q    S  T T +  + LH     G  E+  +L++   +  L+  +   G T    A++ G ++++  LL  G    +  KN V  LH+AA   + D V  L+   G        NG TP+H AA  N  EI S
Sbjct:  463 HLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT-TRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN-DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIAS 640          

HSP 5 Score: 62.7734 bits (151), Expect = 8.569e-10
Identity = 59/214 (27.57%), Postives = 95/214 (44.39%), Query Frame = 3
Query:  123 ALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            A  GH Q    L+     IS K      N     + AA G+      T    ++ V D   + LT LHVA    ++ + + ++      P +R   G T LH  C     ++ +LL++     I     +G T    A   G I+I+ +LL +GAN  + T  G   LH+AA+    D V+ L+ N G +++ +     TP+H A+   + +IV
Sbjct:  301 ARSGHDQVVDLLVVQGAPISAK----TKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD-RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAA-IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 6 Score: 50.8322 bits (120), Expect = 3.084e-6
Identity = 41/148 (27.70%), Postives = 72/148 (48.65%), Query Frame = 3
Query:  309 GLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            G T LH+A    + N+ Q +++    +   +     + LH     G   +  LL+ +   +I+ R  +  T    A + G+  +++ L+ +GA     TKNG+  LHMAAQ  HVDA + L+ +    ++    + +TP+H AA   H
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLE-KGANVNYQARHNISPLHVATKWGRTNMANLLL-SRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGH 371          
BLAST of SMED30024061 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 69.707 bits (169), Expect = 4.849e-12
Identity = 58/227 (25.55%), Postives = 109/227 (48.02%), Query Frame = 3
Query:   90 SLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLR--LNGKDDNGITPIHYAAVHNHHEIV 764
            +++ L  +   A CGH++  K LL+ S   +  +S   + +   H A     + +++   K  ++ +      GLT LHVA     +NIV +++Q    +P   T  G T LH    +   ++ ++LI    + ++ +     T    A++ G  DI+  LL  GAN    T++  + LH+AA++G  +    L+++   +  L  K   G TP+H A+ + + E+V
Sbjct:  356 TVDYLTPLHVAAHCGHVRVAKLLLDRS---ADPNSRALNGFTPLHIACKKNRIKVVELLLK-YRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ-QGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVV 573          

HSP 2 Score: 66.6254 bits (161), Expect = 4.786e-11
Identity = 51/188 (27.13%), Postives = 83/188 (44.15%), Query Frame = 3
Query:  282 SKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENT--------GLRLNGKDDN--------------------GITPIHYAAVHNHHEI 761
            + +   +  GL  LH+A    +  +V+ +I+         T +G TALH    +G   I  +L+E     +N++ +NG T    A Q  + +++++LL  GAN  L T++G   L +A QQGH   V  L+EN          L +  K D+                    G TP+H AA + H  +
Sbjct:   57 TDINTSNANGLNSLHLASKEGHSEVVRELIK-RQAQVDAATRKGNTALHIASLAGQSLIVTILVENGAN-VNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENV 242          

HSP 3 Score: 64.3142 bits (155), Expect = 2.617e-10
Identity = 56/195 (28.72%), Postives = 89/195 (45.64%), Query Frame = 3
Query:  156 LLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPV-TRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYA 737
            +L   N  S K + KN   Y   + AA  N   +  T    K+    +   G T LH++    +  I   +I+  + S V  +   G TA+H C    +  + ++L       IN +   G T    A   G +++++FL+  GA+ G  T+     LH AAQQGH + V++L+EN G   N +   G TP+  A
Sbjct:  607 MLLLENGASAKAAAKNG--YTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIE--NGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE-INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN-GASPNEQTATGQTPLSIA 795          

HSP 4 Score: 63.1586 bits (152), Expect = 5.359e-10
Identity = 54/184 (29.35%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIE--TEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVS 767
            H AA     ++++   +N  +KV  Q  E  T LH+A    N +IV  ++Q    S  T T +  + LH     G  E+  +L++   +  L+  +   G T    A++ G ++++  LL  G    +  KN V  LH+AA   + D V  L+   G        NG TP+H AA  N  EI S
Sbjct:  463 HLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT-TRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN-DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIAS 640          

HSP 5 Score: 62.7734 bits (151), Expect = 8.569e-10
Identity = 59/214 (27.57%), Postives = 95/214 (44.39%), Query Frame = 3
Query:  123 ALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            A  GH Q    L+     IS K      N     + AA G+      T    ++ V D   + LT LHVA    ++ + + ++      P +R   G T LH  C     ++ +LL++     I     +G T    A   G I+I+ +LL +GAN  + T  G   LH+AA+    D V+ L+ N G +++ +     TP+H A+   + +IV
Sbjct:  301 ARSGHDQVVDLLVVQGAPISAK----TKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD-RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAA-IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 6 Score: 50.8322 bits (120), Expect = 3.084e-6
Identity = 41/148 (27.70%), Postives = 72/148 (48.65%), Query Frame = 3
Query:  309 GLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            G T LH+A    + N+ Q +++    +   +     + LH     G   +  LL+ +   +I+ R  +  T    A + G+  +++ L+ +GA     TKNG+  LHMAAQ  HVDA + L+ +    ++    + +TP+H AA   H
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLE-KGANVNYQARHNISPLHVATKWGRTNMANLLL-SRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGH 371          
BLAST of SMED30024061 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 69.707 bits (169), Expect = 5.030e-12
Identity = 58/227 (25.55%), Postives = 109/227 (48.02%), Query Frame = 3
Query:   90 SLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLR--LNGKDDNGITPIHYAAVHNHHEIV 764
            +++ L  +   A CGH++  K LL+ S   +  +S   + +   H A     + +++   K  ++ +      GLT LHVA     +NIV +++Q    +P   T  G T LH    +   ++ ++LI    + ++ +     T    A++ G  DI+  LL  GAN    T++  + LH+AA++G  +    L+++   +  L  K   G TP+H A+ + + E+V
Sbjct:  356 TVDYLTPLHVAAHCGHVRVAKLLLDRS---ADPNSRALNGFTPLHIACKKNRIKVVELLLK-YRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ-QGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK-VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVV 573          

HSP 2 Score: 66.6254 bits (161), Expect = 5.093e-11
Identity = 51/188 (27.13%), Postives = 83/188 (44.15%), Query Frame = 3
Query:  282 SKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENT--------GLRLNGKDDN--------------------GITPIHYAAVHNHHEI 761
            + +   +  GL  LH+A    +  +V+ +I+         T +G TALH    +G   I  +L+E     +N++ +NG T    A Q  + +++++LL  GAN  L T++G   L +A QQGH   V  L+EN          L +  K D+                    G TP+H AA + H  +
Sbjct:   57 TDINTSNANGLNSLHLASKEGHSEVVRELIK-RQAQVDAATRKGNTALHIASLAGQSLIVTILVENGAN-VNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENV 242          

HSP 3 Score: 64.3142 bits (155), Expect = 2.784e-10
Identity = 56/195 (28.72%), Postives = 89/195 (45.64%), Query Frame = 3
Query:  156 LLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPV-TRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYA 737
            +L   N  S K + KN   Y   + AA  N   +  T    K+    +   G T LH++    +  I   +I+  + S V  +   G TA+H C    +  + ++L       IN +   G T    A   G +++++FL+  GA+ G  T+     LH AAQQGH + V++L+EN G   N +   G TP+  A
Sbjct:  607 MLLLENGASAKAAAKNG--YTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIE--NGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE-INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN-GASPNEQTATGQTPLSIA 795          

HSP 4 Score: 63.1586 bits (152), Expect = 5.464e-10
Identity = 54/184 (29.35%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIE--TEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVS 767
            H AA     ++++   +N  +KV  Q  E  T LH+A    N +IV  ++Q    S  T T +  + LH     G  E+  +L++   +  L+  +   G T    A++ G ++++  LL  G    +  KN V  LH+AA   + D V  L+   G        NG TP+H AA  N  EI S
Sbjct:  463 HLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT-TRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN-DKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIAS 640          

HSP 5 Score: 62.3882 bits (150), Expect = 8.735e-10
Identity = 59/214 (27.57%), Postives = 95/214 (44.39%), Query Frame = 3
Query:  123 ALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            A  GH Q    L+     IS K      N     + AA G+      T    ++ V D   + LT LHVA    ++ + + ++      P +R   G T LH  C     ++ +LL++     I     +G T    A   G I+I+ +LL +GAN  + T  G   LH+AA+    D V+ L+ N G +++ +     TP+H A+   + +IV
Sbjct:  301 ARSGHDQVVDLLVVQGAPISAK----TKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD-RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAA-IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 6 Score: 50.8322 bits (120), Expect = 3.142e-6
Identity = 41/148 (27.70%), Postives = 72/148 (48.65%), Query Frame = 3
Query:  309 GLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            G T LH+A    + N+ Q +++    +   +     + LH     G   +  LL+ +   +I+ R  +  T    A + G+  +++ L+ +GA     TKNG+  LHMAAQ  HVDA + L+ +    ++    + +TP+H AA   H
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLE-KGANVNYQARHNISPLHVATKWGRTNMANLLL-SRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGH 371          
BLAST of SMED30024061 vs. Ensembl Fly
Match: f (gene:FBgn0262111 transcript:FBtr0304067)

HSP 1 Score: 90.5077 bits (223), Expect = 2.374e-18
Identity = 54/181 (29.83%), Postives = 96/181 (53.04%), Query Frame = 3
Query:  345 NLNIVQWVIQCTHLSPVTRTEE---GATALHFCCWSGNFEITKLLIETEPRL-INMRMLNGATAAMFATQGGYIDIMEFL-LNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSWXXXXXXXXXXXXFMIGCQNSTLKNESSETIDCLI 872
            NL  +  V Q  H   V+ +E    GA ALH+    G  +  +LL+     +  N +M N  T    A Q G++++++FL L  G +  +  ++G+  +H A+Q G +D +KW+V++ G+  N +D +G TP+H+AA   H  +V WLL    +L  +++     N   +N+  E ++ L+
Sbjct:  372 NLGGMGQVGQMYHPGSVSGSERPNGGALALHYAAARGCLDCVQLLVAASVDICANTQMDNDVTPVYLAAQEGHLEVLKFLVLEAGGSLYVRARDGMAPIHAASQMGCLDCLKWMVQDQGVDPNLRDGDGATPLHFAASRGHLSVVRWLLNHGAKLSLDKYGKSPINDAAENQQVECLNVLV 552          
BLAST of SMED30024061 vs. Ensembl Fly
Match: f (gene:FBgn0262111 transcript:FBtr0304069)

HSP 1 Score: 90.5077 bits (223), Expect = 2.447e-18
Identity = 54/181 (29.83%), Postives = 96/181 (53.04%), Query Frame = 3
Query:  345 NLNIVQWVIQCTHLSPVTRTEE---GATALHFCCWSGNFEITKLLIETEPRL-INMRMLNGATAAMFATQGGYIDIMEFL-LNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSWXXXXXXXXXXXXFMIGCQNSTLKNESSETIDCLI 872
            NL  +  V Q  H   V+ +E    GA ALH+    G  +  +LL+     +  N +M N  T    A Q G++++++FL L  G +  +  ++G+  +H A+Q G +D +KW+V++ G+  N +D +G TP+H+AA   H  +V WLL    +L  +++     N   +N+  E ++ L+
Sbjct:  347 NLGGMGQVGQMYHPGSVSGSERPNGGALALHYAAARGCLDCVQLLVAASVDICANTQMDNDVTPVYLAAQEGHLEVLKFLVLEAGGSLYVRARDGMAPIHAASQMGCLDCLKWMVQDQGVDPNLRDGDGATPLHFAASRGHLSVVRWLLNHGAKLSLDKYGKSPINDAAENQQVECLNVLV 527          
BLAST of SMED30024061 vs. Ensembl Fly
Match: f (gene:FBgn0262111 transcript:FBtr0304062)

HSP 1 Score: 90.1225 bits (222), Expect = 3.396e-18
Identity = 54/181 (29.83%), Postives = 96/181 (53.04%), Query Frame = 3
Query:  345 NLNIVQWVIQCTHLSPVTRTEE---GATALHFCCWSGNFEITKLLIETEPRL-INMRMLNGATAAMFATQGGYIDIMEFL-LNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSWXXXXXXXXXXXXFMIGCQNSTLKNESSETIDCLI 872
            NL  +  V Q  H   V+ +E    GA ALH+    G  +  +LL+     +  N +M N  T    A Q G++++++FL L  G +  +  ++G+  +H A+Q G +D +KW+V++ G+  N +D +G TP+H+AA   H  +V WLL    +L  +++     N   +N+  E ++ L+
Sbjct:   18 NLGGMGQVGQMYHPGSVSGSERPNGGALALHYAAARGCLDCVQLLVAASVDICANTQMDNDVTPVYLAAQEGHLEVLKFLVLEAGGSLYVRARDGMAPIHAASQMGCLDCLKWMVQDQGVDPNLRDGDGATPLHFAASRGHLSVVRWLLNHGAKLSLDKYGKSPINDAAENQQVECLNVLV 198          
BLAST of SMED30024061 vs. Ensembl Fly
Match: f (gene:FBgn0262111 transcript:FBtr0304064)

HSP 1 Score: 90.1225 bits (222), Expect = 3.396e-18
Identity = 54/181 (29.83%), Postives = 96/181 (53.04%), Query Frame = 3
Query:  345 NLNIVQWVIQCTHLSPVTRTEE---GATALHFCCWSGNFEITKLLIETEPRL-INMRMLNGATAAMFATQGGYIDIMEFL-LNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSWXXXXXXXXXXXXFMIGCQNSTLKNESSETIDCLI 872
            NL  +  V Q  H   V+ +E    GA ALH+    G  +  +LL+     +  N +M N  T    A Q G++++++FL L  G +  +  ++G+  +H A+Q G +D +KW+V++ G+  N +D +G TP+H+AA   H  +V WLL    +L  +++     N   +N+  E ++ L+
Sbjct:   18 NLGGMGQVGQMYHPGSVSGSERPNGGALALHYAAARGCLDCVQLLVAASVDICANTQMDNDVTPVYLAAQEGHLEVLKFLVLEAGGSLYVRARDGMAPIHAASQMGCLDCLKWMVQDQGVDPNLRDGDGATPLHFAASRGHLSVVRWLLNHGAKLSLDKYGKSPINDAAENQQVECLNVLV 198          
BLAST of SMED30024061 vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347408)

HSP 1 Score: 82.8037 bits (203), Expect = 6.658e-16
Identity = 54/196 (27.55%), Postives = 89/196 (45.41%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDP------------EGLTVLHVACLTANLNIVQWVIQCTHLSPVTRT-EEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H AA  G  + ++    +  + V  + P             G+T LH+A  + N N+V+ ++    +     T E G   LH  C+ G+  +  LL+     L+  +  NG T    A   G+I ++E LL +GA      +NG   LH AA+ GH++ VK L E  G     + + G   I +AA   H+E++ +
Sbjct:  934 HVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCE-AGASPKSETNYGCAAIWFAASEGHNEVLRY 1128          

HSP 2 Score: 74.3294 bits (181), Expect = 2.687e-13
Identity = 63/225 (28.00%), Postives = 100/225 (44.44%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHL-----SPVTR-------TEEGATALHFCCWSGNFEITKLLIETEPRLINMRML-NGATAAMFATQGGYIDIMEFLLNEGAN-FGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            GH    K L+      ++++      +   H AA  G+  +L    K+T S   +    GLT LHVA      + V+ ++          +P  +       TE G T LH   +SGN  + +LL+ +    ++   + NG      A  GG++ ++  LL+  A       +NG   LH+AA  GH+  V+ L+   G  +N  D NG TP+H AA   H E+V
Sbjct:  874 GHADVVKALVRAGASCTEEN---KAGFTAVHLAAQNGHGQVLD-VLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILL-GQGAEINATDRNGWTPLHCAAKAGHLEVV 1093          

HSP 3 Score: 65.0846 bits (157), Expect = 2.008e-10
Identity = 58/218 (26.61%), Postives = 101/218 (46.33%), Query Frame = 3
Query:  120 TALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRT-EEGATALHFCCWSGNFEITKLLIETEPR-LINMR-MLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
             A+ G     K+L+   N +    +L+       H AAA+G + + +   +   + +   D  G   +HVA       + +  +Q  H S V  T ++G T  H     G+ ++ + L++ +   +I+ R  L  AT    A +GG+ D+++ L+  GA+     K G   +H+AAQ GH   +  L     LR+N K   G+TP+H AA +   + V
Sbjct:  733 AAMNGFTHLVKFLIKDHNAVIDILTLRKQTPL--HLAAASGQMEVCQLLLE-LGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQ-QHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSK-KLGLTPLHVAAYYGQADTV 945          

HSP 4 Score: 52.373 bits (124), Expect = 1.342e-6
Identity = 40/162 (24.69%), Postives = 76/162 (46.91%), Query Frame = 3
Query:  282 SKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPV-TRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            ++V   D EG + LH+A     L++   ++  T+ + + +++  G TALH    +G   + K LI+    +I++  L   T    A   G +++ + LL  GAN       G   +H+AAQ  + +  K  ++     +N    +G T  H AA+    +++
Sbjct:  684 ARVDVFDTEGRSALHLAAERGYLHVCDALL--TNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVI 843          

HSP 5 Score: 50.0618 bits (118), Expect = 7.821e-6
Identity = 46/176 (26.14%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLV---ENTGLRLNGKDDNGITPIHYAA 740
            H AAA G+  LLK+ F   ++  +  D +  T +H+A    + ++++ +      S   RT++G+T +H    +G+ E   +L +    L +M   +GA +   A   G+  I+  LL +G    + T +    LH+A +      V+ L+    +  +R  GK     TP+H AA
Sbjct:  306 HIAAAEGDEALLKY-FYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKDGSTLMHIASLNGHAECATMLFKKGVYL-HMPNKDGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVR-GGKLRE--TPLHIAA 476          
BLAST of SMED30024061 vs. Ensembl Zebrafish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 145.591 bits (366), Expect = 1.211e-35
Identity = 70/221 (31.67%), Postives = 125/221 (56.56%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   +YL++ +   +  +SL  +    AH+AAATGNL  L+W   +   +  D+D  G TVLH+A   ++  I+ W+++     P   T+ GA  +H+    G+    +LL+E  P+++N +  NGAT    A Q G+++++++L+ + GA   +   +G+  LH AAQ GH   + WL+  T + L+ +D++G T +H+AA   H +++SW
Sbjct:   40 VHHAARAGKLTCLRYLVDEAGLPA--NSLARNGASPAHDAAATGNLTCLQWLVTHGGCRAADKDSSGATVLHLASRFSHHEIIDWLLKSEEGDPTVATDTGALPVHYAAAKGDLPSLRLLLEHSPQVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 73.9442 bits (180), Expect = 4.108e-13
Identity = 56/184 (30.43%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSG-NFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H AAA G+L  L+   +++   V  Q   G T L++AC   +L +VQ++++     P  R  +G T LH     G N  I  L+  TE  L + R  +GATA  FA   G+  ++ +LL  G    +    G   LH AA+ G ++  + LV N G+ L  +D +G +    A  + H +   +
Sbjct:  143 HYAAAKGDLPSLRLLLEHSPQVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSD-RDNDGATAMHFAASRGHAKVLSWLLLHGGEI-MTDSWGGTPLHDAAENGELECCQILVVN-GVDLGIRDQDGFSAADLAEYNGHQQCAKY 323          

HSP 3 Score: 50.8322 bits (120), Expect = 5.134e-6
Identity = 36/147 (24.49%), Postives = 66/147 (44.90%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+      ++     ND     H AA  G+  ++ W    T+  ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+     L  +R  +G +AA  A   G+    ++L
Sbjct:  183 GHLEVVQYLVKDCG--AEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSWLL--LHGGEIMTDSWGGTPLHDAAENGELECCQILVVNGVDL-GIRDQDGFSAADLAEYNGHQQCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Zebrafish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 144.436 bits (363), Expect = 1.869e-35
Identity = 70/221 (31.67%), Postives = 125/221 (56.56%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   +YL++ +   +  +SL  +    AH+AAATGNL  L+W   +   +  D+D  G TVLH+A   ++  I+ W+++     P   T+ GA  +H+    G+    +LL+E  P+++N +  NGAT    A Q G+++++++L+ + GA   +   +G+  LH AAQ GH   + WL+  T + L+ +D++G T +H+AA   H +++SW
Sbjct:   40 VHHAARAGKLTCLRYLVDEAGLPA--NSLARNGASPAHDAAATGNLTCLQWLVTHGGCRAADKDSSGATVLHLASRFSHHEIIDWLLKSEEGDPTVATDTGALPVHYAAAKGDLPSLRLLLEHSPQVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 72.0182 bits (175), Expect = 1.259e-12
Identity = 56/184 (30.43%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSG-NFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H AAA G+L  L+   +++   V  Q   G T L++AC   +L +VQ++++     P  R  +G T LH     G N  I  L+  TE  L + R  +GATA  FA   G+  ++ +LL  G    +    G   LH AA+ G ++  + LV N G+ L  +D +G +    A  + H +   +
Sbjct:  143 HYAAAKGDLPSLRLLLEHSPQVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSD-RDNDGATAMHFAASRGHAKVLSWLLLHGGEI-MTDSWGGTPLHDAAENGELECCQILVVN-GVDLGIRDQDGFSAADLAEYNGHQQCAKY 323          

HSP 3 Score: 50.447 bits (119), Expect = 6.940e-6
Identity = 37/148 (25.00%), Postives = 68/148 (45.95%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLK-NDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+        + S++ ND     H AA  G+  ++ W    T+  ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+     L  +R  +G +AA  A   G+    ++L
Sbjct:  183 GHLEVVQYLVK---DCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSWLL--LHGGEIMTDSWGGTPLHDAAENGELECCQILVVNGVDL-GIRDQDGFSAADLAEYNGHQQCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Zebrafish
Match: espnlb (espin like b [Source:ZFIN;Acc:ZDB-GENE-070912-481])

HSP 1 Score: 113.62 bits (283), Expect = 1.585e-25
Identity = 60/171 (35.09%), Postives = 93/171 (54.39%), Query Frame = 3
Query:  255 LKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            L+W  K     + D+D EG T LH+A    +   VQW++     +    T+ GA  +H+   SG+    K+L+ + PR ++ +   GAT    A Q G++ ++E+L+ + GAN  +  K+G++ LH AA  GH   V WL   T L L+ +D NG T +H+AA   HH IV
Sbjct:   86 LQWLLKQETCGIEDRDGEGATALHLAARFGHAEAVQWLL-FEGGNTEAETDCGARPVHYAAASGDLTSLKMLMSSSPRCVDCQTGTGATPLYLACQEGHLHVVEYLVKDCGANVHVQAKDGMSVLHAAAHMGHYALVVWLASFTDLDLSCQDKNGATALHFAASEGHHRIV 255          

HSP 2 Score: 72.4034 bits (176), Expect = 1.099e-12
Identity = 65/241 (26.97%), Postives = 116/241 (48.13%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNTAL-----CGHLQAFKYLL-NTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            ++ + TC  +E+ D    TAL      GH +A ++LL    N  ++ D      +Y    AAA+G+L  LK    ++   V  Q   G T L++AC   +L++V+++++    +   + ++G + LH     G++ +   L       ++ +  NGATA  FA   G+  I+E LL  G    L    G   LH AA+ G ++  + L+ N    L  +D +G T +H A  + +H+  ++
Sbjct:   89 LLKQETC-GIEDRDGEGATALHLAARFGHAEAVQWLLFEGGNTEAETDCGARPVHY----AAASGDLTSLKMLMSSSPRCVDCQTGTGATPLYLACQEGHLHVVEYLVKDCGANVHVQAKDGMSVLHAAAHMGHYALVVWLASFTDLDLSCQDKNGATALHFAASEGHHRIVERLLLMGVKV-LKDHWGGTPLHDAAENGELECCRVLLNNHISPLE-RDSDGFTALHLAEYNGYHDCANF 322          
BLAST of SMED30024061 vs. Ensembl Zebrafish
Match: espnla (espin like a [Source:ZFIN;Acc:ZDB-GENE-131121-3])

HSP 1 Score: 87.0409 bits (214), Expect = 2.715e-17
Identity = 53/158 (33.54%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  294 DQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            D+D  G T LH+A     +  V W++     + V  T  GA   H+    G+    KLLI   P  IN +   GAT    A Q G++ ++EFL+ +  A+  L  ++G+  LH AA  GH   V WL   T + L+ +D+ G T +H+AA   HH ++
Sbjct:    2 DRDSGGATPLHLAARFGRVEAVNWLLVHGAEAEV-ETNCGALPAHYAAAKGDLTCLKLLIGRAPGSINRQTNMGATPLYLACQEGHLHVVEFLVKDCQADVHLRAQDGMTPLHAAAHMGHHSLVVWLGTFTDISLSSQDNEGATVLHFAASGGHHHVL 158          

HSP 2 Score: 63.1586 bits (152), Expect = 8.469e-10
Identity = 48/184 (26.09%), Postives = 82/184 (44.57%), Query Frame = 3
Query:  219 AHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            AH AAA G+L  LK         +  Q   G T L++AC   +L++V+++++        R ++G T LH     G+  +   L       ++ +   GAT   FA  GG+  ++E LL  G+        G   LH AA+ G ++  + L+ +  +    +D +G T    A  + H E   +
Sbjct:   44 AHYAAAKGDLTCLKLLIGRAPGSINRQTNMGATPLYLACQEGHLHVVEFLVKDCQADVHLRAQDGMTPLHAAAHMGHHSLVVWLGTFTDISLSSQDNEGATVLHFAASGGHHHVLERLLEMGSKVKKDYWGGTP-LHDAAENGEIECCRILLSHQ-INPKERDIDGFTAADLAEYNGHFECARY 225          

HSP 3 Score: 56.225 bits (134), Expect = 1.046e-7
Identity = 45/185 (24.32%), Postives = 86/185 (46.49%), Query Frame = 3
Query:  120 TALCGHLQAFKYLLNTS-NKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWL 671
             A  G L   K L+  +   I+++ ++     YLA      G+L+++++  K+ ++ V  +  +G+T LH A    + ++V W+   T +S  ++  EGAT LHF    G+  + + L+E   ++   +   G T    A + G I+    LL+   N      +G     +A   GH +  ++L
Sbjct:   47 AAAKGDLTCLKLLIGRAPGSINRQTNMGATPLYLA---CQEGHLHVVEFLVKDCQADVHLRAQDGMTPLHAAAHMGHHSLVVWLGTFTDISLSSQDNEGATVLHFAASGGHHHVLERLLEMGSKV--KKDYWGGTPLHDAAENGEIECCRILLSHQINPKERDIDGFTAADLAEYNGHFECARYL 226          
BLAST of SMED30024061 vs. Ensembl Zebrafish
Match: dapk1 (death-associated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-177])

HSP 1 Score: 82.4185 bits (202), Expect = 9.963e-16
Identity = 62/207 (29.95%), Postives = 95/207 (45.89%), Query Frame = 3
Query:  120 TALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCT-HLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYA 737
             A CG++Q    L+    +I   D       Y A      G L  L       K  +  QD  G T LHVA    N+++VQ++  C+ H +P     E  T LH   W G   + + L E     +N R   G +  + A+  G+ DI+E LL  GA+     K+G   LH+A ++  V+ VK L+ +    ++ +D +G TP+H A
Sbjct:  386 AAGCGNVQIIDVLMKKGAEIQAFDKTGASAIYYAARHGHVGTLRFLH----EKKCPLDIQDKSGETALHVAARYGNVDVVQYL--CSIHANPDLLDREQETPLHCAAWHGYSAVARALCEAGCD-VNARNREGESPLLTASARGFKDIVECLLEHGADMDSADKDGHIALHLAVRRCQVEVVKCLLSHH-CYVDHQDRHGNTPLHIA 584          
BLAST of SMED30024061 vs. Ensembl Xenopus
Match: ENSXETT00000009332.1 (espin [Source:NCBI gene;Acc:100379704])

HSP 1 Score: 130.954 bits (328), Expect = 5.146e-31
Identity = 68/221 (30.77%), Postives = 118/221 (53.39%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   +YL++ +  +   +    +    AH+AAATGNL+ L+W          D+D  G T+LH+A    +  I  W+++      +  T+ GA  +H+    G+    + L+E  P  IN +  NGAT    A Q G+++++++L+ + GA+  +   +G+  LH AAQ GH   + WL+  T + L+ KDD+G T +H+AA   H +++SW
Sbjct:   40 VHHAARGGKLSCLRYLVDEAQLVG--NCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDTGALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 71.2478 bits (173), Expect = 3.538e-12
Identity = 63/237 (26.58%), Postives = 111/237 (46.84%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNT-----ALCGHLQAFKYLL--NTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKN-GVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            ++++  C+  E+ DN   T     A  GH +   +LL   T++ +   D+         H AAA G+L  L+   +   + +  Q   G T L++AC   +L ++Q++++     P  R  +G T LH     G+  +   L+      ++ +  +GATA  FA   G+  ++ +LL  G    + T N G   LH AA+ G ++  + LV N G++L  +D +G T    A  + H
Sbjct:   89 LLTQGGCD-FEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDT----GALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLLLHGGE--ICTDNWGGTPLHDAAENGELECCQILVVN-GIKLGIRDLDGYTAADLAEYNGH 317          

HSP 3 Score: 63.1586 bits (152), Expect = 1.105e-9
Identity = 39/127 (30.71%), Postives = 58/127 (45.67%), Query Frame = 3
Query:  381 HLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGA-NFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKD-----DNGITPIHYAAV 743
             + P  +   GA+A+H     G     + L++    + N R  NGAT A  A   G +  +++LL +G  +F     +G   LH+AA+ GH +   WL     LR    D     D G  P+HYAA 
Sbjct:   26 QIQPDAKDPMGASAVHHAARGGKLSCLRYLVDEAQLVGNCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWL-----LRFGTNDAMVPTDTGALPVHYAAA 147          

HSP 4 Score: 58.151 bits (139), Expect = 4.504e-8
Identity = 38/147 (25.85%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+       +  +  ND     H AA  G+  ++ W    T   ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+    +L  +R L+G TAA  A   G+    ++L
Sbjct:  183 GHLEVIQYLVKDCGADPQMRA--NDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLL--LHGGEICTDNWGGTPLHDAAENGELECCQILVVNGIKL-GIRDLDGYTAADLAEYNGHFHCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Xenopus
Match: ENSXETT00000009314.1 (espin [Source:NCBI gene;Acc:100379704])

HSP 1 Score: 130.954 bits (328), Expect = 5.515e-31
Identity = 68/221 (30.77%), Postives = 118/221 (53.39%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   +YL++ +  +   +    +    AH+AAATGNL+ L+W          D+D  G T+LH+A    +  I  W+++      +  T+ GA  +H+    G+    + L+E  P  IN +  NGAT    A Q G+++++++L+ + GA+  +   +G+  LH AAQ GH   + WL+  T + L+ KDD+G T +H+AA   H +++SW
Sbjct:   40 VHHAARGGKLSCLRYLVDEAQLVG--NCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDTGALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 71.2478 bits (173), Expect = 3.715e-12
Identity = 63/237 (26.58%), Postives = 111/237 (46.84%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNT-----ALCGHLQAFKYLL--NTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKN-GVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            ++++  C+  E+ DN   T     A  GH +   +LL   T++ +   D+         H AAA G+L  L+   +   + +  Q   G T L++AC   +L ++Q++++     P  R  +G T LH     G+  +   L+      ++ +  +GATA  FA   G+  ++ +LL  G    + T N G   LH AA+ G ++  + LV N G++L  +D +G T    A  + H
Sbjct:   89 LLTQGGCD-FEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDT----GALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLLLHGGE--ICTDNWGGTPLHDAAENGELECCQILVVN-GIKLGIRDLDGYTAADLAEYNGH 317          

HSP 3 Score: 63.1586 bits (152), Expect = 1.149e-9
Identity = 39/127 (30.71%), Postives = 58/127 (45.67%), Query Frame = 3
Query:  381 HLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGA-NFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKD-----DNGITPIHYAAV 743
             + P  +   GA+A+H     G     + L++    + N R  NGAT A  A   G +  +++LL +G  +F     +G   LH+AA+ GH +   WL     LR    D     D G  P+HYAA 
Sbjct:   26 QIQPDAKDPMGASAVHHAARGGKLSCLRYLVDEAQLVGNCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWL-----LRFGTNDAMVPTDTGALPVHYAAA 147          

HSP 4 Score: 57.7658 bits (138), Expect = 4.845e-8
Identity = 38/147 (25.85%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+       +  +  ND     H AA  G+  ++ W    T   ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+    +L  +R L+G TAA  A   G+    ++L
Sbjct:  183 GHLEVIQYLVKDCGADPQMRA--NDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLL--LHGGEICTDNWGGTPLHDAAENGELECCQILVVNGIKL-GIRDLDGYTAADLAEYNGHFHCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Xenopus
Match: ENSXETT00000009280.1 (espin [Source:NCBI gene;Acc:100379704])

HSP 1 Score: 130.954 bits (328), Expect = 5.641e-31
Identity = 68/221 (30.77%), Postives = 118/221 (53.39%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   +YL++ +  +   +    +    AH+AAATGNL+ L+W          D+D  G T+LH+A    +  I  W+++      +  T+ GA  +H+    G+    + L+E  P  IN +  NGAT    A Q G+++++++L+ + GA+  +   +G+  LH AAQ GH   + WL+  T + L+ KDD+G T +H+AA   H +++SW
Sbjct:   40 VHHAARGGKLSCLRYLVDEAQLVG--NCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDTGALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 70.8626 bits (172), Expect = 4.793e-12
Identity = 63/237 (26.58%), Postives = 111/237 (46.84%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNT-----ALCGHLQAFKYLL--NTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKN-GVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            ++++  C+  E+ DN   T     A  GH +   +LL   T++ +   D+         H AAA G+L  L+   +   + +  Q   G T L++AC   +L ++Q++++     P  R  +G T LH     G+  +   L+      ++ +  +GATA  FA   G+  ++ +LL  G    + T N G   LH AA+ G ++  + LV N G++L  +D +G T    A  + H
Sbjct:   89 LLTQGGCD-FEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDT----GALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLLLHGGE--ICTDNWGGTPLHDAAENGELECCQILVVN-GIKLGIRDLDGYTAADLAEYNGH 317          

HSP 3 Score: 68.9366 bits (167), Expect = 2.051e-11
Identity = 51/216 (23.61%), Postives = 91/216 (42.13%), Query Frame = 3
Query:  228 AAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGAN--------FGLP---------------------------TKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            AA  G++  L+      + +   +DP G + +H A     L+ +++++    L    R   GAT  H    +GN    + L+         +  +GAT    A + G+ +I  +LL  G N          LP                           TKNG   L++A Q+GH++ +++LV++ G     + ++G+TP+H AA   H  ++ W
Sbjct:    9 AARQGDVETLRSLHTLGQIQPDAKDPMGASAVHHAARGGKLSCLRYLVDEAQLVGNCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDTGALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVW 224          

HSP 4 Score: 57.7658 bits (138), Expect = 5.253e-8
Identity = 38/147 (25.85%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+       +  +  ND     H AA  G+  ++ W    T   ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+    +L  +R L+G TAA  A   G+    ++L
Sbjct:  183 GHLEVIQYLVKDCGADPQMRA--NDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLL--LHGGEICTDNWGGTPLHDAAENGELECCQILVVNGIKL-GIRDLDGYTAADLAEYNGHFHCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Xenopus
Match: ENSXETT00000009422.1 (espin [Source:NCBI gene;Acc:100379704])

HSP 1 Score: 131.339 bits (329), Expect = 6.037e-31
Identity = 68/221 (30.77%), Postives = 118/221 (53.39%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   +YL++ +  +   +    +    AH+AAATGNL+ L+W          D+D  G T+LH+A    +  I  W+++      +  T+ GA  +H+    G+    + L+E  P  IN +  NGAT    A Q G+++++++L+ + GA+  +   +G+  LH AAQ GH   + WL+  T + L+ KDD+G T +H+AA   H +++SW
Sbjct:   40 VHHAARGGKLSCLRYLVDEAQLVG--NCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDTGALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 71.2478 bits (173), Expect = 3.666e-12
Identity = 63/237 (26.58%), Postives = 111/237 (46.84%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNT-----ALCGHLQAFKYLL--NTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKN-GVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            ++++  C+  E+ DN   T     A  GH +   +LL   T++ +   D+         H AAA G+L  L+   +   + +  Q   G T L++AC   +L ++Q++++     P  R  +G T LH     G+  +   L+      ++ +  +GATA  FA   G+  ++ +LL  G    + T N G   LH AA+ G ++  + LV N G++L  +D +G T    A  + H
Sbjct:   89 LLTQGGCD-FEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDT----GALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLLLHGGE--ICTDNWGGTPLHDAAENGELECCQILVVN-GIKLGIRDLDGYTAADLAEYNGH 317          

HSP 3 Score: 68.9366 bits (167), Expect = 2.252e-11
Identity = 51/216 (23.61%), Postives = 91/216 (42.13%), Query Frame = 3
Query:  228 AAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGAN--------FGLP---------------------------TKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            AA  G++  L+      + +   +DP G + +H A     L+ +++++    L    R   GAT  H    +GN    + L+         +  +GAT    A + G+ +I  +LL  G N          LP                           TKNG   L++A Q+GH++ +++LV++ G     + ++G+TP+H AA   H  ++ W
Sbjct:    9 AARQGDVETLRSLHTLGQIQPDAKDPMGASAVHHAARGGKLSCLRYLVDEAQLVGNCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDTGALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVW 224          

HSP 4 Score: 57.7658 bits (138), Expect = 5.383e-8
Identity = 38/147 (25.85%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+       +  +  ND     H AA  G+  ++ W    T   ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+    +L  +R L+G TAA  A   G+    ++L
Sbjct:  183 GHLEVIQYLVKDCGADPQMRA--NDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLL--LHGGEICTDNWGGTPLHDAAENGELECCQILVVNGIKL-GIRDLDGYTAADLAEYNGHFHCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Xenopus
Match: ENSXETT00000009376.1 (espin [Source:NCBI gene;Acc:100379704])

HSP 1 Score: 131.339 bits (329), Expect = 6.555e-31
Identity = 68/221 (30.77%), Postives = 118/221 (53.39%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   +YL++ +  +   +    +    AH+AAATGNL+ L+W          D+D  G T+LH+A    +  I  W+++      +  T+ GA  +H+    G+    + L+E  P  IN +  NGAT    A Q G+++++++L+ + GA+  +   +G+  LH AAQ GH   + WL+  T + L+ KDD+G T +H+AA   H +++SW
Sbjct:   40 VHHAARGGKLSCLRYLVDEAQLVG--NCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDTGALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 71.2478 bits (173), Expect = 3.864e-12
Identity = 63/237 (26.58%), Postives = 111/237 (46.84%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNT-----ALCGHLQAFKYLL--NTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKN-GVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            ++++  C+  E+ DN   T     A  GH +   +LL   T++ +   D+         H AAA G+L  L+   +   + +  Q   G T L++AC   +L ++Q++++     P  R  +G T LH     G+  +   L+      ++ +  +GATA  FA   G+  ++ +LL  G    + T N G   LH AA+ G ++  + LV N G++L  +D +G T    A  + H
Sbjct:   89 LLTQGGCD-FEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDT----GALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLLLHGGE--ICTDNWGGTPLHDAAENGELECCQILVVN-GIKLGIRDLDGYTAADLAEYNGH 317          

HSP 3 Score: 68.9366 bits (167), Expect = 2.353e-11
Identity = 52/216 (24.07%), Postives = 91/216 (42.13%), Query Frame = 3
Query:  228 AAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLH-------VACL---------------------------TANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGAN-FGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            AA  G++  L+      + +   +DP G + +H       ++CL                           T NL+ +QW++         +   GAT LH     G+ EIT  L+        +    GA    +A   G +  ++ LL    N     TKNG   L++A Q+GH++ +++LV++ G     + ++G+TP+H AA   H  ++ W
Sbjct:    9 AARQGDVETLRSLHTLGQIQPDAKDPMGASAVHHAARGGKLSCLRYLVDEAQLVGNCRARNGATPAHDAAATGNLSCLQWLLTQGGCDFEDKDNSGATILHLAARFGHHEITSWLLRFGTNDAMVPTDTGALPVHYAAAKGDLPTLQHLLEYCPNAINSQTKNGATPLYLACQEGHLEVIQYLVKDCGADPQMRANDGMTPLHAAAQMGHSTVIVW 224          

HSP 4 Score: 57.7658 bits (138), Expect = 5.574e-8
Identity = 38/147 (25.85%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+       +  +  ND     H AA  G+  ++ W    T   ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+    +L  +R L+G TAA  A   G+    ++L
Sbjct:  183 GHLEVIQYLVKDCGADPQMRA--NDGMTPLHAAAQMGHSTVIVWLMSFTDISLSDKDDDGATAMHFAASRGHAKVLSWLL--LHGGEICTDNWGGTPLHDAAENGELECCQILVVNGIKL-GIRDLDGYTAADLAEYNGHFHCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Mouse
Match: Espn (espin [Source:MGI Symbol;Acc:MGI:1861630])

HSP 1 Score: 122.094 bits (305), Expect = 3.062e-28
Identity = 71/238 (29.83%), Postives = 123/238 (51.68%), Query Frame = 3
Query:   60 ANIMSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A ++     +SL+ L  + + A  G L   +YL+      +   S   +    AH+AAATG L+ L+W       +V ++D  G TVLH+A    + ++V+W++     +    T+ GA  +H+    G+    KLL+   P  +N +  NGAT    A Q G++++ ++L+ E  A+  L  ++G+  LH AAQ GH   + WLV    +  + +D +G T +H+AA   H +++SW
Sbjct:   24 AGLLGPSLRDSLDALP-VHHAARSGKLHCLRYLVEEVALPAV--SRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSW 258          

HSP 2 Score: 70.8626 bits (172), Expect = 3.714e-12
Identity = 44/139 (31.65%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  330 ACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGA-NFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAV 743
            A    +L++++ +     L P  R    A  +H    SG     + L+E        R  NGAT A  A   GY+  +++LL +G         +G   LH+AA+ GH D VKWL+   G       D G  PIHYAA 
Sbjct:    9 AARRGDLDVLRSLHAAGLLGPSLRDSLDALPVHHAARSGKLHCLRYLVEEVALPAVSRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAA 147          

HSP 3 Score: 68.9366 bits (167), Expect = 1.522e-11
Identity = 65/235 (27.66%), Postives = 102/235 (43.40%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNTAL-----CGHLQAFKYLLNTSNKISKKDSLKNDNYYLA-HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            ++++  C   E  DN   T L      GH    K+LL      S   ++  D   L  H AAA G+L  LK    +    V  Q   G T L++AC   +L + ++++Q     P  R ++G T LH     G+  +   L+       + +  +GATA  FA   G+  ++ +LL  GA        G   LH AA+ G ++  + L  N G  L+ +D +G T    A  + H
Sbjct:   89 LLTQGGCRVQEK-DNSGATVLHLAARFGHPDVVKWLLYQGGANS---AITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSWLLLHGAEISQDLWGGTP-LHDAAENGELECCQILAVN-GAGLDVRDHDGYTAADLAEFNGH 317          
BLAST of SMED30024061 vs. Ensembl Mouse
Match: Espn (espin [Source:MGI Symbol;Acc:MGI:1861630])

HSP 1 Score: 121.709 bits (304), Expect = 3.302e-28
Identity = 71/238 (29.83%), Postives = 123/238 (51.68%), Query Frame = 3
Query:   60 ANIMSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A ++     +SL+ L  + + A  G L   +YL+      +   S   +    AH+AAATG L+ L+W       +V ++D  G TVLH+A    + ++V+W++     +    T+ GA  +H+    G+    KLL+   P  +N +  NGAT    A Q G++++ ++L+ E  A+  L  ++G+  LH AAQ GH   + WLV    +  + +D +G T +H+AA   H +++SW
Sbjct:   24 AGLLGPSLRDSLDALP-VHHAARSGKLHCLRYLVEEVALPAV--SRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSW 258          

HSP 2 Score: 70.4774 bits (171), Expect = 4.468e-12
Identity = 44/139 (31.65%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  330 ACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGA-NFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAV 743
            A    +L++++ +     L P  R    A  +H    SG     + L+E        R  NGAT A  A   GY+  +++LL +G         +G   LH+AA+ GH D VKWL+   G       D G  PIHYAA 
Sbjct:    9 AARRGDLDVLRSLHAAGLLGPSLRDSLDALPVHHAARSGKLHCLRYLVEEVALPAVSRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAA 147          

HSP 3 Score: 68.9366 bits (167), Expect = 1.556e-11
Identity = 65/235 (27.66%), Postives = 102/235 (43.40%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNTAL-----CGHLQAFKYLLNTSNKISKKDSLKNDNYYLA-HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            ++++  C   E  DN   T L      GH    K+LL      S   ++  D   L  H AAA G+L  LK    +    V  Q   G T L++AC   +L + ++++Q     P  R ++G T LH     G+  +   L+       + +  +GATA  FA   G+  ++ +LL  GA        G   LH AA+ G ++  + L  N G  L+ +D +G T    A  + H
Sbjct:   89 LLTQGGCRVQEK-DNSGATVLHLAARFGHPDVVKWLLYQGGANS---AITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSWLLLHGAEISQDLWGGTP-LHDAAENGELECCQILAVN-GAGLDVRDHDGYTAADLAEFNGH 317          
BLAST of SMED30024061 vs. Ensembl Mouse
Match: Espn (espin [Source:MGI Symbol;Acc:MGI:1861630])

HSP 1 Score: 121.709 bits (304), Expect = 3.973e-28
Identity = 71/238 (29.83%), Postives = 123/238 (51.68%), Query Frame = 3
Query:   60 ANIMSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A ++     +SL+ L  + + A  G L   +YL+      +   S   +    AH+AAATG L+ L+W       +V ++D  G TVLH+A    + ++V+W++     +    T+ GA  +H+    G+    KLL+   P  +N +  NGAT    A Q G++++ ++L+ E  A+  L  ++G+  LH AAQ GH   + WLV    +  + +D +G T +H+AA   H +++SW
Sbjct:   24 AGLLGPSLRDSLDALP-VHHAARSGKLHCLRYLVEEVALPAV--SRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSW 258          

HSP 2 Score: 70.0922 bits (170), Expect = 5.890e-12
Identity = 44/139 (31.65%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  330 ACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGA-NFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAV 743
            A    +L++++ +     L P  R    A  +H    SG     + L+E        R  NGAT A  A   GY+  +++LL +G         +G   LH+AA+ GH D VKWL+   G       D G  PIHYAA 
Sbjct:    9 AARRGDLDVLRSLHAAGLLGPSLRDSLDALPVHHAARSGKLHCLRYLVEEVALPAVSRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAA 147          

HSP 3 Score: 68.1662 bits (165), Expect = 2.195e-11
Identity = 65/235 (27.66%), Postives = 102/235 (43.40%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNTAL-----CGHLQAFKYLLNTSNKISKKDSLKNDNYYLA-HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            ++++  C   E  DN   T L      GH    K+LL      S   ++  D   L  H AAA G+L  LK    +    V  Q   G T L++AC   +L + ++++Q     P  R ++G T LH     G+  +   L+       + +  +GATA  FA   G+  ++ +LL  GA        G   LH AA+ G ++  + L  N G  L+ +D +G T    A  + H
Sbjct:   89 LLTQGGCRVQEK-DNSGATVLHLAARFGHPDVVKWLLYQGGANS---AITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSWLLLHGAEISQDLWGGTP-LHDAAENGELECCQILAVN-GAGLDVRDHDGYTAADLAEFNGH 317          
BLAST of SMED30024061 vs. Ensembl Mouse
Match: Espn (espin [Source:MGI Symbol;Acc:MGI:1861630])

HSP 1 Score: 119.398 bits (298), Expect = 2.838e-27
Identity = 61/185 (32.97%), Postives = 103/185 (55.68%), Query Frame = 3
Query:  219 AHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            AH+AAATG L+ L+W       +V ++D  G TVLH+A    + ++V+W++     +    T+ GA  +H+    G+    KLL+   P  +N +  NGAT    A Q G++++ ++L+ E  A+  L  ++G+  LH AAQ GH   + WLV    +  + +D +G T +H+AA   H +++SW
Sbjct:   74 AHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSW 258          

HSP 2 Score: 69.707 bits (169), Expect = 1.068e-11
Identity = 59/208 (28.37%), Postives = 92/208 (44.23%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLA-HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            GH    K+LL      S   ++  D   L  H AAA G+L  LK    +    V  Q   G T L++AC   +L + ++++Q     P  R ++G T LH     G+  +   L+       + +  +GATA  FA   G+  ++ +LL  GA        G   LH AA+ G ++  + L  N G  L+ +D +G T    A  + H
Sbjct:  115 GHPDVVKWLLYQGGANS---AITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSWLLLHGAEISQDLWGGTP-LHDAAENGELECCQILAVN-GAGLDVRDHDGYTAADLAEFNGH 317          

HSP 3 Score: 67.781 bits (164), Expect = 4.058e-11
Identity = 44/138 (31.88%), Postives = 62/138 (44.93%), Query Frame = 3
Query:  330 ACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGA-NFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAA 740
            A    +L++++ +     L P  R    A  +H    SG     + L+E        R  NGAT A  A   GY+  +++LL +G         +G   LH+AA+ GH D VKWL+   G       D G  PIHYAA
Sbjct:    9 AARRGDLDVLRSLHAAGLLGPSLRDSLDALPVHHAARSGKLHCLRYLVEEVALPAVSRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAA 146          
BLAST of SMED30024061 vs. Ensembl Mouse
Match: Espnl (espin-like [Source:MGI Symbol;Acc:MGI:2685402])

HSP 1 Score: 117.857 bits (294), Expect = 6.862e-27
Identity = 69/219 (31.51%), Postives = 112/219 (51.14%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            + +    GHL   K+L+  +     + +  ++     H+AAATGNL  L W  ++    + DQD  G++ LH+A    +  +V+W+++  H +    T EGA  LH    SG+    KLL       +N R  +GA+    A Q G++ + +FL+ + GA+  L   +G++ LH AA  GH   V WLV  T + L  +D+ G T +H+AA   H  I+
Sbjct:   40 VHHATRAGHLDCVKFLVQRAKLPGNQQA--HNGATPVHDAAATGNLAELCWLVRDAGCGLQDQDASGVSPLHLAARFGHPALVEWLLREGHAA-TLETLEGALPLHHAAVSGDLTCLKLLTAAHSSGVNQRTCSGASPLYLACQEGHLHLAQFLVKDCGADVRLRALDGMSSLHAAAAHGHYSLVVWLVTFTDIGLTARDNEGATALHFAARGGHTPIL 255          

HSP 2 Score: 55.8398 bits (133), Expect = 1.685e-7
Identity = 47/215 (21.86%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  228 AAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEG-------ANFGLP---------------------------TKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A+  G++  L+  F+    +    D  G  ++H A    +L+ V++++Q   L    +   GAT +H    +GN      L+      +  +  +G +    A + G+  ++E+LL EG           LP                           T +G + L++A Q+GH+   ++LV++ G  +  +  +G++ +H AA H H+ +V W
Sbjct:    9 ASKDGDMATLERLFEAGALRPDITDDLGAGLVHHATRAGHLDCVKFLVQRAKLPGNQQAHNGATPVHDAAATGNLAELCWLVRDAGCGLQDQDASGVSPLHLAARFGHPALVEWLLREGHAATLETLEGALPLHHAAVSGDLTCLKLLTAAHSSGVNQRTCSGASPLYLACQEGHLHLAQFLVKDCGADVRLRALDGMSSLHAAAAHGHYSLVVW 223          
BLAST of SMED30024061 vs. UniProt/SwissProt
Match: sp|B1AK53|ESPN_HUMAN (Espin OS=Homo sapiens OX=9606 GN=ESPN PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 8.793e-31
Identity = 72/238 (30.25%), Postives = 124/238 (52.10%), Query Frame = 3
Query:   60 ANIMSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A ++     + L+ L  + + A  G L   ++L+  +   +   +   +    AH+A+ATG+L  L+W       +V D+D  G TVLH+A    +  +V W++      P   T+ GA  +H+    G+F   +LL+E  P  +N +  NGAT    A Q G++++ ++L+ E GA+      +G+  LH AAQ GH   + WLV  T + L+ +D +G T +H+AA   H +++SW
Sbjct:   24 AGLLGPSLRDPLDALP-VHHAARAGKLHCLRFLVEEAALPAA--ARARNGATPAHDASATGHLACLQWLLSQGGCRVQDKDNSGATVLHLAARFGHPEVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVWLVSCTDVSLSEQDKDGATAMHFAASRGHTKVLSW 258          

HSP 2 Score: 69.3218 bits (168), Expect = 8.364e-11
Identity = 58/224 (25.89%), Postives = 99/224 (44.20%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNTAL-----CGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGIT 722
            ++S+  C  +++ DN   T L      GH +   +LL+         +  +      H AAA G+   L+   ++    V  Q   G T L++AC   +L + Q+++Q     P  R  +G T LH     G+  +   L+      ++ +  +GATA  FA   G+  ++ +LL  G         G   LH AA+ G ++  + LV N G  L+ +D +G T
Sbjct:   89 LLSQGGCR-VQDKDNSGATVLHLAARFGHPEVVNWLLHHGG--GDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVWLVSCTDVSLSEQDKDGATAMHFAASRGHTKVLSWLLLHGGEISADLWGGTP-LHDAAENGELECCQILVVN-GAELDVRDRDGYT 307          

HSP 3 Score: 58.9214 bits (141), Expect = 1.250e-7
Identity = 49/219 (22.37%), Postives = 91/219 (41.55%), Query Frame = 3
Query:  219 AHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGAN--------FGLP---------------------------TKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A  AA  G L++L+          + +DP     +H A     L+ ++++++   L    R   GAT  H    +G+    + L+      +  +  +GAT    A + G+ +++ +LL+ G            LP                           TKNG   L++A Q+GH++  ++LV+  G   + +  +G+TP+H AA   H  ++ W
Sbjct:    6 ALQAARQGELDVLRSLHAAGLLGPSLRDPLDALPVHHAARAGKLHCLRFLVEEAALPAAARARNGATPAHDASATGHLACLQWLLSQGGCRVQDKDNSGATVLHLAARFGHPEVVNWLLHHGGGDPTAATDMGALPIHYAAAKGDFPSLRLLVEHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHARAHDGMTPLHAAAQMGHSPVIVW 224          
BLAST of SMED30024061 vs. UniProt/SwissProt
Match: sp|Q9ET47|ESPN_MOUSE (Espin OS=Mus musculus OX=10090 GN=Espn PE=1 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 2.142e-27
Identity = 71/238 (29.83%), Postives = 123/238 (51.68%), Query Frame = 3
Query:   60 ANIMSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A ++     +SL+ L  + + A  G L   +YL+      +   S   +    AH+AAATG L+ L+W       +V ++D  G TVLH+A    + ++V+W++     +    T+ GA  +H+    G+    KLL+   P  +N +  NGAT    A Q G++++ ++L+ E  A+  L  ++G+  LH AAQ GH   + WLV    +  + +D +G T +H+AA   H +++SW
Sbjct:   24 AGLLGPSLRDSLDALP-VHHAARSGKLHCLRYLVEEVALPAV--SRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSW 258          

HSP 2 Score: 70.8626 bits (172), Expect = 2.598e-11
Identity = 44/139 (31.65%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  330 ACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGA-NFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAV 743
            A    +L++++ +     L P  R    A  +H    SG     + L+E        R  NGAT A  A   GY+  +++LL +G         +G   LH+AA+ GH D VKWL+   G       D G  PIHYAA 
Sbjct:    9 AARRGDLDVLRSLHAAGLLGPSLRDSLDALPVHHAARSGKLHCLRYLVEEVALPAVSRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAA 147          

HSP 3 Score: 68.9366 bits (167), Expect = 1.065e-10
Identity = 65/235 (27.66%), Postives = 102/235 (43.40%), Query Frame = 3
Query:   66 IMSEFTCESLENLDNISNTAL-----CGHLQAFKYLLNTSNKISKKDSLKNDNYYLA-HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNH 752
            ++++  C   E  DN   T L      GH    K+LL      S   ++  D   L  H AAA G+L  LK    +    V  Q   G T L++AC   +L + ++++Q     P  R ++G T LH     G+  +   L+       + +  +GATA  FA   G+  ++ +LL  GA        G   LH AA+ G ++  + L  N G  L+ +D +G T    A  + H
Sbjct:   89 LLTQGGCRVQEK-DNSGATVLHLAARFGHPDVVKWLLYQGGANS---AITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSWLLLHGAEISQDLWGGTP-LHDAAENGELECCQILAVN-GAGLDVRDHDGYTAADLAEFNGH 317          
BLAST of SMED30024061 vs. UniProt/SwissProt
Match: sp|Q3UYR4|ESPNL_MOUSE (Espin-like protein OS=Mus musculus OX=10090 GN=Espnl PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 4.800e-26
Identity = 69/219 (31.51%), Postives = 112/219 (51.14%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            + +    GHL   K+L+  +     + +  ++     H+AAATGNL  L W  ++    + DQD  G++ LH+A    +  +V+W+++  H +    T EGA  LH    SG+    KLL       +N R  +GA+    A Q G++ + +FL+ + GA+  L   +G++ LH AA  GH   V WLV  T + L  +D+ G T +H+AA   H  I+
Sbjct:   40 VHHATRAGHLDCVKFLVQRAKLPGNQQA--HNGATPVHDAAATGNLAELCWLVRDAGCGLQDQDASGVSPLHLAARFGHPALVEWLLREGHAA-TLETLEGALPLHHAAVSGDLTCLKLLTAAHSSGVNQRTCSGASPLYLACQEGHLHLAQFLVKDCGADVRLRALDGMSSLHAAAAHGHYSLVVWLVTFTDIGLTARDNEGATALHFAARGGHTPIL 255          

HSP 2 Score: 55.8398 bits (133), Expect = 1.179e-6
Identity = 47/215 (21.86%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  228 AAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEG-------ANFGLP---------------------------TKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A+  G++  L+  F+    +    D  G  ++H A    +L+ V++++Q   L    +   GAT +H    +GN      L+      +  +  +G +    A + G+  ++E+LL EG           LP                           T +G + L++A Q+GH+   ++LV++ G  +  +  +G++ +H AA H H+ +V W
Sbjct:    9 ASKDGDMATLERLFEAGALRPDITDDLGAGLVHHATRAGHLDCVKFLVQRAKLPGNQQAHNGATPVHDAAATGNLAELCWLVRDAGCGLQDQDASGVSPLHLAARFGHPALVEWLLREGHAATLETLEGALPLHHAAVSGDLTCLKLLTAAHSSGVNQRTCSGASPLYLACQEGHLHLAQFLVKDCGADVRLRALDGMSSLHAAAAHGHYSLVVW 223          
BLAST of SMED30024061 vs. UniProt/SwissProt
Match: sp|Q6ZVH7|ESPNL_HUMAN (Espin-like protein OS=Homo sapiens OX=9606 GN=ESPNL PE=1 SV=3)

HSP 1 Score: 117.472 bits (293), Expect = 7.070e-26
Identity = 70/219 (31.96%), Postives = 112/219 (51.14%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            + +    GHL   K+L+  +     + +  ++    AH+AAATG+L  L W  +     + DQD  G++ LH+A    +  +V+W++   H S    T EGA  LH    SG+    KLL       +N R  +GA+    A Q G++ + +FL+ + GA+  L   +G++ LH AA +GH   V WLV  T + L  +D+ G T +H+AA   H  I+
Sbjct:   40 VHHATRAGHLDCVKFLVQRAQLPGNQRA--HNGATPAHDAAATGSLAELCWLVREGGCGLQDQDASGVSPLHLAARFGHPVLVEWLLHEGH-SATLETREGARPLHHAAVSGDLTCLKLLTAAHGSSVNRRTRSGASPLYLACQEGHLHLAQFLVKDCGADVHLRALDGMSALHAAAARGHYSLVVWLVTFTDIGLTARDNEGATALHFAARGGHTPIL 255          
BLAST of SMED30024061 vs. UniProt/SwissProt
Match: sp|Q63618|ESPN_RAT (Espin OS=Rattus norvegicus OX=10116 GN=Espn PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 1.755e-25
Identity = 70/238 (29.41%), Postives = 120/238 (50.42%), Query Frame = 3
Query:   60 ANIMSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A ++     + L+ L  + + A  G L   +YL+      +   S   +    AH+AAATG L+ L+W       +V ++D  G TVLH+A    + ++V W++     +    T+ GA  +H+    G+    KLL+   P  +N +  NGAT    A Q G++++ ++L+ E  A+  L  ++G+  LH AAQ GH   + WLV    +    +D +G T +H+AA   H +++SW
Sbjct:   24 AGLLGPSLRDPLDALP-VHHAARSGKLHCLRYLVEEVALPAV--SRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVNWLLYQGGANSAITTDTGALPIHYAAAKGDLPSMKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFE-QDHDGATAMHFAASRGHTKVLSW 257          

HSP 2 Score: 69.3218 bits (168), Expect = 6.454e-11
Identity = 48/185 (25.95%), Postives = 90/185 (48.65%), Query Frame = 3
Query:  219 AHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A  AA  G+L++L+          + +DP     +H A  +  L+ ++++++   L  V+R   GAT  H    +G     + L+      +  +  +GAT    A + G+ D++ +LL + GAN  + T  G   +H AA +G + ++K LV +    +N + +NG TP++ A    H E+  +
Sbjct:    6 AMQAARRGDLDVLRSLHAAGLLGPSLRDPLDALPVHHAARSGKLHCLRYLVEEVALPAVSRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVNWLLYQGGANSAITTDTGALPIHYAAAKGDLPSMKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKY 190          
BLAST of SMED30024061 vs. TrEMBL
Match: A0A210PTN4 (Espin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21771 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 2.015e-36
Identity = 71/216 (32.87%), Postives = 125/216 (57.87%), Query Frame = 3
Query:  123 ALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            A  G L   +YL+   N  +KK +        AH+A+ATG   +L+W  K T   V DQD  G TV H+A    +  +++W++  T    + ++  GA  +HF    GN ++  ++++  PR +N++M+NG T    A+Q G+++I++ L+ +G +  + + +G++CLH A Q G +D VKWL+E+     N +D +G TP+H+AA   H++++ W
Sbjct:   42 ARGGRLDVVEYLIKKRNFSAKKRT--RVGATAAHDASATGKTAVLQWLLKQTTCVVNDQDGTGATVTHLAARYGHGRLIEWLMDETDADVMMKSASGALPIHFAVSGGNPDVVNIIVKETPRTVNLQMVNGVTPVYLASQEGHLNILKLLVQKGGSIKMKSFDGMSCLHAATQLGRMDCVKWLIEDQKHNPNDRDFDGATPLHFAASRGHYKVIDW 255          
BLAST of SMED30024061 vs. TrEMBL
Match: K1RMU7 (Espin OS=Crassostrea gigas OX=29159 GN=CGI_10022140 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.568e-34
Identity = 69/187 (36.90%), Postives = 115/187 (61.50%), Query Frame = 3
Query:  219 AHNAAATGNLNLLKWTFKNTKSKVT--DQDPEGLTVLHVACLTANLNIVQWVIQCTHLS-PVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            AH+AAA+G L+ L+W  K  K  ++  DQD  G T+LH+A    + ++V+W++  T     V +   GA  LHF    G+ +  ++L++  PR +NM+M+NGAT    A Q G +++++ L+ +G    + + +G++CLH AAQ GH++ VK+LV +    +N +D +G +P+HYAA   H E+V W
Sbjct:   73 AHDAAASGKLSTLQWLLKQAKPPLSEDDQDGTGATILHLAARYGHASVVEWILDKTQTDLTVIKAASGALPLHFAASGGSVDTVQILLKESPRSVNMQMMNGATPIYIAAQSGQLEVLKLLVQKGGTVKINSYDGMSCLHAAAQSGHLECVKFLVLDQKCNVNERDFDGASPLHYAASLGHVEVVRW 259          

HSP 2 Score: 64.3142 bits (155), Expect = 7.534e-7
Identity = 40/153 (26.14%), Postives = 79/153 (51.63%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVEN 680
            H AA+ G+++ ++   K +   V  Q   G T +++A  +  L +++ ++Q      +  + +G + LH    SG+ E  K L+  +   +N R  +GA+   +A   G+++++ +LL +G         G + LH AA+ GH+  V+ L+EN
Sbjct:  145 HFAASGGSVDTVQILLKESPRSVNMQMMNGATPIYIAAQSGQLEVLKLLVQKGGTVKIN-SYDGMSCLHAAAQSGHLECVKFLVLDQKCNVNERDFDGASPLHYAASLGHVEVVRWLLTQGGAKVTLDNLGGSPLHNAAEVGHLKVVRVLLEN 296          
BLAST of SMED30024061 vs. TrEMBL
Match: A0A3B3SQA3 (Espin OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 6.226e-34
Identity = 73/221 (33.03%), Postives = 125/221 (56.56%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   +YL+  +       SL  +    AH+AAATGNL  L+W       + +D+D  G TVLH+A   ++  I+QW+++     P   T+ GA  +H+    G+    +LL+E  P ++N +  NGAT    A Q G+++++++L+ + GA   + + +G++ LH AAQ GH+  + WLV  T   L+ +D++G TP+H+AA   H +++SW
Sbjct:   40 VHHAARSGKLTCLRYLVEDAGLPGS--SLAKNGASPAHDAAATGNLACLQWLVTRGGCRASDRDSSGATVLHLASRFSHHEIIQWLLRGGRADPKVATDTGALPVHYAAAKGDLPSLRLLLEHSPSVVNAQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPRIRSHDGMSPLHAAAQMGHITVIVWLVSFTPTSLSERDNDGATPMHFAASRGHAKVLSW 258          

HSP 2 Score: 78.9518 bits (193), Expect = 1.935e-11
Identity = 52/183 (28.42%), Postives = 89/183 (48.63%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H AAA G+L  L+   +++ S V  Q   G T L++AC   +L +VQ++++     P  R+ +G + LH     G+  +   L+   P  ++ R  +GAT   FA   G+  ++ +LL  G    +    G   LH AA+ G ++  + LV N G+ L  +D +G +    A  + H E   +
Sbjct:  143 HYAAAKGDLPSLRLLLEHSPSVVNAQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPRIRSHDGMSPLHAAAQMGHITVIVWLVSFTPTSLSERDNDGATPMHFAASRGHAKVLSWLLLHGGEI-VSDGWGGTPLHDAAENGELECCQILVVN-GVHLGTRDRDGFSAADLAEYNGHSECARY 323          
BLAST of SMED30024061 vs. TrEMBL
Match: B0S4T8 (Espin OS=Danio rerio OX=7955 GN=espn PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.709e-32
Identity = 70/221 (31.67%), Postives = 125/221 (56.56%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   +YL++ +   +  +SL  +    AH+AAATGNL  L+W   +   +  D+D  G TVLH+A   ++  I+ W+++     P   T+ GA  +H+    G+    +LL+E  P+++N +  NGAT    A Q G+++++++L+ + GA   +   +G+  LH AAQ GH   + WL+  T + L+ +D++G T +H+AA   H +++SW
Sbjct:   40 VHHAARAGKLTCLRYLVDEAGLPA--NSLARNGASPAHDAAATGNLTCLQWLVTHGGCRAADKDSSGATVLHLASRFSHHEIIDWLLKSEEGDPTVATDTGALPVHYAAAKGDLPSLRLLLEHSPQVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 73.9442 bits (180), Expect = 9.191e-10
Identity = 56/184 (30.43%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSG-NFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H AAA G+L  L+   +++   V  Q   G T L++AC   +L +VQ++++     P  R  +G T LH     G N  I  L+  TE  L + R  +GATA  FA   G+  ++ +LL  G    +    G   LH AA+ G ++  + LV N G+ L  +D +G +    A  + H +   +
Sbjct:  143 HYAAAKGDLPSLRLLLEHSPQVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSD-RDNDGATAMHFAASRGHAKVLSWLLLHGGEI-MTDSWGGTPLHDAAENGELECCQILVVN-GVDLGIRDQDGFSAADLAEYNGHQQCAKY 323          
BLAST of SMED30024061 vs. TrEMBL
Match: A0A3P8WZE2 (Espin OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.915e-32
Identity = 70/221 (31.67%), Postives = 121/221 (54.75%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   ++L+  +  +   + L  +    AH+AAATGNL  L+W       +  D+D  G TVLH+A   ++  I +W+++   + P   T+ GA  +H+    G+    +LL+   P ++N +  NGAT    A Q G+++++++L+ + GA  G+   +G+  LH AAQ GH   + WL+  T +RL  KD +G T +H+AA   H +++SW
Sbjct:   43 VHHAARAGKLNCLRFLVEEAGLVG--NCLAKNGASPAHDAAATGNLACLQWLLTQGGCRAEDRDSSGATVLHLASRFSHHEITEWLLKSGEVDPGATTDTGALPIHYAAAKGDLSSLRLLLGHSPSVVNSQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPGIRANDGMTPLHAAAQMGHNTVIVWLISFTEIRLTDKDGDGATAMHFAASRGHAKVLSW 261          
BLAST of SMED30024061 vs. Ensembl Cavefish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 139.813 bits (351), Expect = 4.372e-34
Identity = 69/221 (31.22%), Postives = 123/221 (55.66%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   ++L+  +   +  DS+ N+    AH+AAATGNL  L+W       + +D+D  G TVLH+A   ++  I  W+++    +P   T+ GA  +H+    G+    +LL+   P ++N +  NGAT    A Q G+++++++L+ + GA   +   +G+  LH AAQ GH   + WL+  T + L+ +D++G T +H+AA   H +++SW
Sbjct:   40 VHHAARAGKLTCLRFLVEEAGLPA--DSVANNGATPAHDAAATGNLACLQWLLTQGGCRASDKDSSGATVLHLASRFSHHEITDWLLKSGEGNPSIATDTGALPVHYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 70.4774 bits (171), Expect = 3.978e-12
Identity = 57/184 (30.98%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSG-NFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H AAA G+L  L+    ++   V  Q   G T L++AC   +L +VQ++++     P  R  +G T LH     G N  I  L+  TE  L + R  +GATA  FA   G+  ++ +LL  G    +    G   LH AA+ G ++  + LV N G+ L  +D +G T    A  + H +   +
Sbjct:  143 HYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSD-RDNDGATAMHFAASRGHAKVLSWLLLHGGEI-ITDGWGGTPLHDAAENGELECCQILVVN-GVDLGIRDQDGFTAADLAEYNGHPQCAKY 323          

HSP 3 Score: 51.2174 bits (121), Expect = 3.623e-6
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLK-NDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+        + S++ ND     H AA  G+  ++ W    T+  ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+     L  +R  +G TAA  A   G+    ++L
Sbjct:  183 GHLEVVQYLVK---DCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSWLL--LHGGEIITDGWGGTPLHDAAENGELECCQILVVNGVDL-GIRDQDGFTAADLAEYNGHPQCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Cavefish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 139.813 bits (351), Expect = 4.505e-34
Identity = 69/221 (31.22%), Postives = 123/221 (55.66%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   ++L+  +   +  DS+ N+    AH+AAATGNL  L+W       + +D+D  G TVLH+A   ++  I  W+++    +P   T+ GA  +H+    G+    +LL+   P ++N +  NGAT    A Q G+++++++L+ + GA   +   +G+  LH AAQ GH   + WL+  T + L+ +D++G T +H+AA   H +++SW
Sbjct:   40 VHHAARAGKLTCLRFLVEEAGLPA--DSVANNGATPAHDAAATGNLACLQWLLTQGGCRASDKDSSGATVLHLASRFSHHEITDWLLKSGEGNPSIATDTGALPVHYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 70.4774 bits (171), Expect = 3.221e-12
Identity = 57/184 (30.98%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSG-NFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H AAA G+L  L+    ++   V  Q   G T L++AC   +L +VQ++++     P  R  +G T LH     G N  I  L+  TE  L + R  +GATA  FA   G+  ++ +LL  G    +    G   LH AA+ G ++  + LV N G+ L  +D +G T    A  + H +   +
Sbjct:  143 HYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSD-RDNDGATAMHFAASRGHAKVLSWLLLHGGEI-ITDGWGGTPLHDAAENGELECCQILVVN-GVDLGIRDQDGFTAADLAEYNGHPQCAKY 323          

HSP 3 Score: 51.2174 bits (121), Expect = 3.277e-6
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLK-NDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+        + S++ ND     H AA  G+  ++ W    T+  ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+     L  +R  +G TAA  A   G+    ++L
Sbjct:  183 GHLEVVQYLVK---DCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSWLL--LHGGEIITDGWGGTPLHDAAENGELECCQILVVNGVDL-GIRDQDGFTAADLAEYNGHPQCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Cavefish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 139.428 bits (350), Expect = 4.974e-34
Identity = 69/221 (31.22%), Postives = 123/221 (55.66%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   ++L+  +   +  DS+ N+    AH+AAATGNL  L+W       + +D+D  G TVLH+A   ++  I  W+++    +P   T+ GA  +H+    G+    +LL+   P ++N +  NGAT    A Q G+++++++L+ + GA   +   +G+  LH AAQ GH   + WL+  T + L+ +D++G T +H+AA   H +++SW
Sbjct:   40 VHHAARAGKLTCLRFLVEEAGLPA--DSVANNGATPAHDAAATGNLACLQWLLTQGGCRASDKDSSGATVLHLASRFSHHEITDWLLKSGEGNPSIATDTGALPVHYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 70.4774 bits (171), Expect = 3.184e-12
Identity = 57/184 (30.98%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSG-NFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H AAA G+L  L+    ++   V  Q   G T L++AC   +L +VQ++++     P  R  +G T LH     G N  I  L+  TE  L + R  +GATA  FA   G+  ++ +LL  G    +    G   LH AA+ G ++  + LV N G+ L  +D +G T    A  + H +   +
Sbjct:  143 HYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSD-RDNDGATAMHFAASRGHAKVLSWLLLHGGEI-ITDGWGGTPLHDAAENGELECCQILVVN-GVDLGIRDQDGFTAADLAEYNGHPQCAKY 323          

HSP 3 Score: 51.2174 bits (121), Expect = 2.937e-6
Identity = 38/148 (25.68%), Postives = 68/148 (45.95%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLK-NDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+        + S++ ND     H AA  G+  ++ W    T+  ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+     L  +R  +G TAA  A   G+    ++L
Sbjct:  183 GHLEVVQYLVK---DCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSWLL--LHGGEIITDGWGGTPLHDAAENGELECCQILVVNGVDL-GIRDQDGFTAADLAEYNGHPQCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Cavefish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 139.428 bits (350), Expect = 5.117e-34
Identity = 69/221 (31.22%), Postives = 123/221 (55.66%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   ++L+  +   +  DS+ N+    AH+AAATGNL  L+W       + +D+D  G TVLH+A   ++  I  W+++    +P   T+ GA  +H+    G+    +LL+   P ++N +  NGAT    A Q G+++++++L+ + GA   +   +G+  LH AAQ GH   + WL+  T + L+ +D++G T +H+AA   H +++SW
Sbjct:   40 VHHAARAGKLTCLRFLVEEAGLPA--DSVANNGATPAHDAAATGNLACLQWLLTQGGCRASDKDSSGATVLHLASRFSHHEITDWLLKSGEGNPSIATDTGALPVHYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSW 258          

HSP 2 Score: 71.2478 bits (173), Expect = 2.067e-12
Identity = 57/184 (30.98%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSG-NFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H AAA G+L  L+    ++   V  Q   G T L++AC   +L +VQ++++     P  R  +G T LH     G N  I  L+  TE  L + R  +GATA  FA   G+  ++ +LL  G    +    G   LH AA+ G ++  + LV N G+ L  +D +G T    A  + H +   +
Sbjct:  143 HYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLACQEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSD-RDNDGATAMHFAASRGHAKVLSWLLLHGGEI-ITDGWGGTPLHDAAENGELECCQILVVN-GVDLGIRDQDGFTAADLAEYNGHPQCAKY 323          

HSP 3 Score: 51.9878 bits (123), Expect = 1.992e-6
Identity = 37/147 (25.17%), Postives = 66/147 (44.90%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFL 572
            GHL+  +YL+      ++     ND     H AA  G+  ++ W    T+  ++D+D +G T +H A    +  ++ W++   H   +     G T LH    +G  E  ++L+     L  +R  +G TAA  A   G+    ++L
Sbjct:  183 GHLEVVQYLVKDCG--AEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEISLSDRDNDGATAMHFAASRGHAKVLSWLL--LHGGEIITDGWGGTPLHDAAENGELECCQILVVNGVDL-GIRDQDGFTAADLAEYNGHPQCAKYL 324          
BLAST of SMED30024061 vs. Ensembl Cavefish
Match: espnlb (espin like b [Source:ZFIN;Acc:ZDB-GENE-070912-481])

HSP 1 Score: 112.849 bits (281), Expect = 2.287e-25
Identity = 67/219 (30.59%), Postives = 111/219 (50.68%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            + + A CG L   ++L+  +   +   ++       AH+AAATG+   L+W  ++      DQD EG T LH+A    +   VQW++     S    T+ GA  +H+   SG+    +LL           M+ GAT    A Q G++ ++E+L+ + GA+  +  ++G++ LH AA  GH   V WL   T + ++ +D NG T +H+AA   HH I+
Sbjct:   40 VHHAARCGRLDCLRFLVVEAGLQAHCRAMNGATS--AHDAAATGHTQELRWLLEHGDCGDEDQDGEGATALHLATRFGHAEAVQWLLSAGG-STEAETDCGALPVHYAAASGHLTCLQLL-----------MITGATPLYLACQEGHLHVVEYLVKDCGADVHIRAQDGMSPLHAAAHMGHYGLVVWLASFTDIDVSCQDQNGATALHFAASEGHHRIL 244          

HSP 2 Score: 50.447 bits (119), Expect = 5.728e-6
Identity = 51/212 (24.06%), Postives = 89/212 (41.98%), Query Frame = 3
Query:   45 LFNINANIMSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTK---NGVNCLHMAAQQGHVDAVKWL 671
            L +   +  +E  C +L     +   A  GHL   + L+ T               YLA      G+L+++++  K+  + V  +  +G++ LH A    +  +V W+   T +    + + GATALHF    G+  I + L+    R++  R   G T    A + G ++    LL   AN   P +   +G + + +A   GH D    L
Sbjct:  123 LLSAGGSTEAETDCGALP----VHYAAASGHLTCLQLLMITGAT----------PLYLA---CQEGHLHVVEYLVKDCGADVHIRAQDGMSPLHAAAHMGHYGLVVWLASFTDIDVSCQDQNGATALHFAASEGHHRILERLLLMGARVV--RDGWGGTPLHDAAENGELECCRVLL---ANHVSPLEKDVDGFSAVDLAEYNGHGDCATLL 312          
BLAST of SMED30024061 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010100.1 (pep scaffold:Pmarinus_7.0:GL477764:15685:34523:-1 gene:ENSPMAG00000009140.1 transcript:ENSPMAT00000010100.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 1.011e-28
Identity = 68/222 (30.63%), Postives = 110/222 (49.55%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE--GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L A ++L+  + ++S +          AH+AAA G L  L++  ++      ++D  G TVLHVA       +V W++Q     P   TE  A  +H+    G+ + T  L++  P  +N R   G T    A Q  ++  + F L E  GA+  + +++G+  LH AAQ GH   + WL E T L LN  D +G++P+H+AA   H   + W
Sbjct:   39 VHHAARAGSLTALRFLVGEA-RLSARIRTGPARASPAHDAAARGQLACLRYLLEDGACDSEERDGAGCTVLHVAARFGCTAVVNWLLQSGRCDPRAVTEARALPIHYSAVRGDPDSTNALLQAAPDTVNARTREGVTPVYLACQERHL-FLSFRLVEKWGADVTIQSEDGMTPLHAAAQNGHTPLLAWLTEFTVLNLNHVDGDGVSPLHFAAGGGHCSTMDW 258          

HSP 2 Score: 53.1434 bits (126), Expect = 8.492e-8
Identity = 47/183 (25.68%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            H +A  G+ +      +     V  +  EG+T +++AC   +L +   +++        ++E+G T LH    +G+  +   L E     +N    +G +   FA  GG+   M++LL  GA   +    G   LH AA  GH+   + L+ +    +N KD  G TP+  A  + H E V +
Sbjct:  143 HYSAVRGDPDSTNALLQAAPDTVNARTREGVTPVYLACQERHLFLSFRLVEKWGADVTIQSEDGMTPLHAAAQNGHTPLLAWLTEFTVLNLNHVDGDGVSPLHFAAGGGHCSTMDWLLAHGAKNQV-DLTGCYPLHDAADNGHIKCCEILLMHEA-DVNAKDSWGYTPVDLAEENGHTECVEY 323          
BLAST of SMED30024061 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 7.693e-16
Identity = 64/257 (24.90%), Postives = 111/257 (43.19%), Query Frame = 3
Query:   90 SLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRL--------------------------------INMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            +L+ L  +   A CGH +  K LL+   + + +     + +   H A     + +++   K+  S  T  +  GLT +HVA    +LN+VQ ++Q    S  T    G T LH    +G  E+ K L+++  R+                                 N    +G+T   FA++ G+ D+   LL  GA+    TK G   LH+A++ G ++    L+E      + K  NG+TP+H A  ++H ++ 
Sbjct:  341 TLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNAR---ALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTE-SGLTPIHVASFMGHLNVVQLLLQNGASSNATNVR-GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYA-SADPKGKNGLTPLHVATHYDHQKVA 591          

HSP 2 Score: 75.8702 bits (185), Expect = 1.444e-14
Identity = 63/209 (30.14%), Postives = 104/209 (49.76%), Query Frame = 3
Query:  147 FKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTR-TEEGATALHFCCWSGNFEITKLLIET--EPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
             K LL+   KI   D+   D     H AA +G+  +++   +   + +  +   GL+ LH+A    +L  VQ ++     +PV   T +  T LH     G++ + KLL++   EP   N R LNG T    A +   I +ME LL  GA+    T++G+  +H+A+  GH++ V+ L++N G   N  +  G TP+H A+     E+V
Sbjct:  261 VKLLLDRGAKI---DTKTRDGLTPLHCAARSGHEKVIEMLLER-DAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQ--APVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEP---NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQN-GASSNATNVRGETPLHMASRAGQLEVV 459          

HSP 3 Score: 67.0106 bits (162), Expect = 8.704e-12
Identity = 42/124 (33.87%), Postives = 69/124 (55.65%), Query Frame = 3
Query:  309 GLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVEN 680
            GL  LH+A    ++++V  +++       T T+ G TALH    +G  +I ++L+E     IN +  NG T    A Q  +++I++FLL+ GAN  + T++G   L +A QQGH   V  L+E+
Sbjct:   43 GLNALHLASKEGHVDVVTELLK-REAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGAN-INAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES 164          

HSP 4 Score: 66.6254 bits (161), Expect = 1.196e-11
Identity = 54/196 (27.55%), Postives = 79/196 (40.31%), Query Frame = 3
Query:  285 KVTDQDPEG---LTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQ---------------------------------GHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            K    DP+G   LT LHVA    +  +   ++     SP +  + G T LH        E+ K+L+E      NM    G      A Q G+ D++  LL   A+  L TK G+  +H+AAQ+                                 G++  V +L+ N  L +N K  NG TP+H AA   H  +V
Sbjct:  564 KYASADPKGKNGLTPLHVATHYDHQKVALLLLDKG-ASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAE-TNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRAL-VNAKTRNGYTPLHQAAQQGHTHVV 756          

HSP 5 Score: 63.1586 bits (152), Expect = 1.455e-10
Identity = 64/249 (25.70%), Postives = 108/249 (43.37%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETE-------PRL-INMR-----------------------MLNGATAAMF-----ATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            GH+     LL    +I     + N   ++A  A  T  + +L     N    +  Q   G T L++A    +L IV++++       V  TE+G T L      G+ ++  LL+E++       P L I  R                       MLN  T + F     A   G +++   LLN GA      +NG+  LH+AA++G+ + VK L++  G +++ K  +G+TP+H AA   H +++  
Sbjct:   54 GHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGAN----INAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVA-TEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDR-GAKIDTKTRDGLTPLHCAARSGHEKVIEM 296          

HSP 6 Score: 53.5286 bits (127), Expect = 1.304e-7
Identity = 60/238 (25.21%), Postives = 100/238 (42.02%), Query Frame = 3
Query:  129 CGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQ-CTHLSPVTRTEEGATALHFCCWSGNFEITKLLIE----TEPRLIN-----------------MRML-----------NGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLV-ENTGLRLNGKDDNGITPIHYAA 740
             G L+  K LL +  ++  K   + D   L H A+  G   +++   +   S        G T L+ A    + ++   +++    +SPVT+  +G T LH     G  E+  LL+E     +P+  N                 + +L           NG T    A +   +++ + LL  GA   + T+ GV  LH+AAQ+GH D V  L+  +  + L  K   G+T +H AA
Sbjct:  453 AGQLEVVKTLLQSGARVGVK--AREDQTPL-HIASRLGKAEIVQLLLQR-GSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTK--KGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK--GGLTAMHLAA 682          
BLAST of SMED30024061 vs. Ensembl Sea Lamprey
Match: ankrd16 (ankyrin repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE-041210-253])

HSP 1 Score: 77.7962 bits (190), Expect = 8.452e-16
Identity = 59/222 (26.58%), Postives = 108/222 (48.65%), Query Frame = 3
Query:   96 ENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYY-LAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNE-GANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNG-ITPIHYAAVHNH 752
            E    +   A  GH    + LL    ++   DSLK  ++  L       G+L++++    +  S ++ ++ +G + LHVAC T +  +V  ++  +  +  TR+  G T LH     GN E+T++L++    + + R   G T  + A + G++D+   LL +  ++       G   LH+AA    +DA+++LVE  G+ +N  D    +  +HYAA   H
Sbjct:   38 EQKRPLHEAAAAGHGPCVRLLLRHGARV---DSLKRADWTPLMMACTRAGSLDVVRELLAHGAS-LSVRNKDGWSALHVACRTGDSAVVGALLDASPTAWGTRSSVGRTPLHTSAMHGNLEVTQMLLDRCAFVPDGRDSCGVTPFVDAVRHGHLDVARLLLEKHQSDVSATDAVGAQALHLAAVTCQLDALRFLVEELGVDVNVCDARARLCAVHYAAKEGH 255          

HSP 2 Score: 51.6026 bits (122), Expect = 2.795e-7
Identity = 31/124 (25.00%), Postives = 59/124 (47.58%), Query Frame = 3
Query:  390 PVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEI 761
            P     E    LH    +G+    +LL+    R+ +++  +     M  T+ G +D++  LL  GA+  +  K+G + LH+A + G    V  L++ +      +   G TP+H +A+H + E+
Sbjct:   32 PEVANREQKRPLHEAAAAGHGPCVRLLLRHGARVDSLKRADWTPLMMACTRAGSLDVVRELLAHGASLSVRNKDGWSALHVACRTGDSAVVGALLDASPTAWGTRSSVGRTPLHTSAMHGNLEV 155          
BLAST of SMED30024061 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 1.162e-15
Identity = 65/228 (28.51%), Postives = 106/228 (46.49%), Query Frame = 3
Query:   90 SLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKS--KVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVS 767
            +L+ L  +   A CGH +  K LL+   K +  +    + +   H A     + +++   K   S   VT+    GLT +HV+    NLNIV  ++Q    SP      G TALH    +G  E+ + L+    + ++ +     T    A + G ++I++ LL   A+    T NG   LH+AA++GH D    L+E+ G  L      G TP+H A+ +   E+ S
Sbjct:   69 TLDYLTALHVAAHCGHYRTAKVLLD---KGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTES---GLTPMHVSAFMGNLNIVLILLQGG-ASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQ-VDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEH-GASLAVTTKKGFTPLHVASKYGKMEVAS 287          

HSP 2 Score: 62.7734 bits (151), Expect = 2.069e-10
Identity = 53/190 (27.89%), Postives = 95/190 (50.00%), Query Frame = 3
Query:  198 KNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTR-TEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            + D     H AA +G+  +++   +   + +  +   GL+ LH+A    ++  VQ ++Q  + +PV   T +  TALH     G++   K+L++      N+R LNG T    A +   I +ME LL  GA+    T++G+  +H++A  G+++ V  L++  G   N  +  G T +H AA     E+V
Sbjct:    3 RQDGLTPLHCAARSGHEQVVEILLEQ-GAPILAKTKNGLSPLHMATQGDHVECVQVLMQ--YRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGAN-PNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQG-GASPNATNVRGETALHMAARAGQTEVV 187          

HSP 3 Score: 62.3882 bits (150), Expect = 3.039e-10
Identity = 56/207 (27.05%), Postives = 93/207 (44.93%), Query Frame = 3
Query:  123 ALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKS-KVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAA 740
            A  G L+  + LL     ++  D+  ++ Y   H AA  G+ ++     ++  S  VT +  +G T LHVA     + +   ++Q    SP    + G T LH      N ++  LL++ +    +    NG T    A +   ++I   LL  GA     T+ GV  LH+ AQ+GH D    L+      +N    +G++P+H AA
Sbjct:  212 ARLGKLEIVQLLLQ---HMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTK--KGFTPLHVASKYGKMEVASLLLQ-RFASPDAAGKNGLTPLHVASHYDNQKVALLLLD-QGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYA-DVNHATKSGLSPLHLAA 410          

HSP 4 Score: 50.0618 bits (118), Expect = 1.820e-6
Identity = 37/112 (33.04%), Postives = 52/112 (46.43%), Query Frame = 3
Query:  402 TEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYA 737
            T+ G + LH         + ++L++     +N     G T  + A   G I ++ FLL  GA+    TKNG   LH AAQQGH   V  L++  G R N    NG T +  A
Sbjct:  399 TKSGLSPLHLAAQEDKVNVAEILVKHGAH-VNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK-CGARPNDVTVNGNTALAIA 508          
BLAST of SMED30024061 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 7.418e-15
Identity = 64/260 (24.62%), Postives = 115/260 (44.23%), Query Frame = 3
Query:   90 SLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRL--------------------------------INMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVE---NTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            +L+ L  +   A CGH +  K LL+   +  + ++   + +   H A     + +++   K+  S  T  +  GLT +HVA    +LN+VQ ++Q    S  T    G T LH    +G  E+ K L+++  R+                                 N    +G+T   FA++ G+ D+   LL  GA+    TK G   LH+A++ G ++    L+E   +   ++ G+  NG+TP+H A  ++H ++ 
Sbjct:  334 TLDYLTPLHVAAHCGHYRVAKLLLD---RGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTE-SGLTPIHVASFMGHLNVVQLLLQNGASSNATNVR-GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQ--NGLTPLHVATHYDHQKVA 586          

HSP 2 Score: 75.8702 bits (185), Expect = 1.479e-14
Identity = 63/209 (30.14%), Postives = 104/209 (49.76%), Query Frame = 3
Query:  147 FKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTR-TEEGATALHFCCWSGNFEITKLLIET--EPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
             K LL+   KI   D+   D     H AA +G+  +++   +   + +  +   GL+ LH+A    +L  VQ ++     +PV   T +  T LH     G++ + KLL++   EP   N R LNG T    A +   I +ME LL  GA+    T++G+  +H+A+  GH++ V+ L++N G   N  +  G TP+H A+     E+V
Sbjct:  254 VKLLLDRGAKI---DTKTRDGLTPLHCAARSGHEKVIEMLLER-DAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQ--APVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEP---NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQN-GASSNATNVRGETPLHMASRAGQLEVV 452          

HSP 3 Score: 68.1662 bits (165), Expect = 3.396e-12
Identity = 66/247 (26.72%), Postives = 96/247 (38.87%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNL---NLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQ---------------------------------GHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            GH      LL     IS    +    +   H A+  G L    LL   + +   KV  Q+  GLT LHVA    +  +   ++     SP +  + G T LH        E+ K+L+E      NM    G      A Q G+ D++  LL   A+  L TK G+  +H+AAQ+                                 G++  V +L+ N  L +N K  NG TP+H AA   H  +V
Sbjct:  513 GHGDVASLLLENGADIS---PVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQN--GLTPLHVATHYDHQKVALLLLDKG-ASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAE-TNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRAL-VNAKTRNGYTPLHQAAQQGHTHVV 751          

HSP 4 Score: 66.6254 bits (161), Expect = 1.203e-11
Identity = 42/124 (33.87%), Postives = 69/124 (55.65%), Query Frame = 3
Query:  309 GLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVEN 680
            GL  LH+A    ++++V  +++       T T+ G TALH    +G  +I ++L+E     IN +  NG T    A Q  +++I++FLL+ GAN  + T++G   L +A QQGH   V  L+E+
Sbjct:   44 GLNALHLASKEGHVDVVTELLK-REAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGAN-INAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES 165          

HSP 5 Score: 62.7734 bits (151), Expect = 2.016e-10
Identity = 61/241 (25.31%), Postives = 106/241 (43.98%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETE-------PRL-INMRMLNGATAAMF--------------------ATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            GH+     LL    +I     + N   ++A  A  T  + +L     N    +  Q   G T L++A    +L IV++++       V  TE+G T L      G+ ++  LL+E++       P L I  R  +   AA+                     A   G +++   LLN GA      +NG+  LH+AA++G+ + VK L++  G +++ K  +G+TP+H AA   H +++  
Sbjct:   55 GHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGAN----INAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVA-TEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDR-GAKIDTKTRDGLTPLHCAARSGHEKVIEM 289          
BLAST of SMED30024061 vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 47.7506 bits (112), Expect = 3.443e-6
Identity = 33/124 (26.61%), Postives = 62/124 (50.00%), Query Frame = 3
Query:  405 EEGATALHFCCWSGNFEITKLLIETEPRLI-NMRMLNGATAAMFATQGGYIDIMEFLLNEGANFG--LPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVS 767
            +E +  L      GN  I K L+   P L+ N+   NG ++  +A+  G   I  +L+  G +    + T  G  C+H+A  +GH   +  L++     +N + +NG  PIH A ++++++ +S
Sbjct:    3 KEPSVRLREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLS 126          
BLAST of SMED30024061 vs. Ensembl Nematostella
Match: EDO34823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNB2])

HSP 1 Score: 68.5514 bits (166), Expect = 4.784e-12
Identity = 32/120 (26.67%), Postives = 61/120 (50.83%), Query Frame = 3
Query:  423 LHFCCWSGNFE----ITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            +H  C+   ++    +  +++ +    +N    +G T    A Q G  D ++FL   GA   + +++G++ +H AAQ GH+D + +L  +  + +  +D  G TP HYAA   H  ++ W
Sbjct:    1 MHPACYRNRYQAKPAVKAVIVASS---VNESATDGTTPLYLAAQDGNFDCLKFLHGVGAKCNITSRDGMHPIHAAAQNGHLDCLGYLAIHGRVSMTERDRTGATPAHYAAGQGHLSVLKW 117          
BLAST of SMED30024061 vs. Ensembl Nematostella
Match: EDO35910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK80])

HSP 1 Score: 59.6918 bits (143), Expect = 9.315e-10
Identity = 31/86 (36.05%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  513 GATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            G T  M A Q GYID+ME LL  GA+      +G  C+ ++   G  +  K L E  G+    +D NG+T +H+AA   H +++ W
Sbjct:  141 GLTPLMVAAQKGYIDVMETLLEFGADPNYFNSSGKTCMMISCYSGQEEPAKLLRER-GVEWGSRDKNGLTSVHWAADGGHDDLLLW 225          

HSP 2 Score: 53.9138 bits (128), Expect = 6.270e-8
Identity = 52/216 (24.07%), Postives = 92/216 (42.59%), Query Frame = 3
Query:  102 LDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIE--TEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDD-NGITPIHYAA 740
            LD ++N    G+   FK L   +  + +   +      L H AA        +W+  N     T ++P     LH A    +L+ V+ ++   +       + G T L      G  ++ + L+E   +P   N    +G T  M +   G  +  + L   G  +G   KNG+  +H AA  GH D + W++++ G +++ +D  NG TP+   A
Sbjct:   48 LDPLTNYQGYGNSHVFKSLEPNTEYLCRSRFVDGSQQTLGHGAA--------RWSQPN--HVFTAKEPPSGAELHKAVARQDLDQVRKILSENNSVVEVMDKFGLTPLMVAAQKGYIDVMETLLEFGADPNYFNS---SGKTCMMISCYSGQEEPAKLLRERGVEWGSRDKNGLTSVHWAADGGHDDLLLWMLKD-GAQVDLEDTYNGWTPLMRVA 249          
BLAST of SMED30024061 vs. Ensembl Nematostella
Match: EDO43381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU3])

HSP 1 Score: 61.2326 bits (147), Expect = 9.379e-10
Identity = 44/148 (29.73%), Postives = 67/148 (45.27%), Query Frame = 3
Query:  321 LHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            +H A    +L  ++ +I           E+G TALH    +G+ +  K L  +   L       G TA   A  GG+++ M  L   G+     T +    LH+AA  GH++ VKWL+ N   R   +D NG T +  A  + H +IV
Sbjct:  905 IHDAAKKGDLARIKELIGVAPAMKSVPDEKGMTALHIASSNGHLDCVKWLAVSGVDL-GQETPTGYTAIHLAAMGGHVNCMMILSAMGSVVNCKTVDDQTPLHLAAMSGHLECVKWLLANRS-RTEAEDSNGRTALDIAEEYGHEDIV 1050          

HSP 2 Score: 58.9214 bits (141), Expect = 5.997e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  414 ATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
              ++H     G+    K LI   P + ++    G TA   A+  G++D +++L   G + G  T  G   +H+AA  GHV+ +  ++   G  +N K  +  TP+H AA+  H E V W
Sbjct:  902 GPSIHDAAKKGDLARIKELIGVAPAMKSVPDEKGMTALHIASSNGHLDCVKWLAVSGVDLGQETPTGYTAIHLAAMGGHVNCM-MILSAMGSVVNCKTVDDQTPLHLAAMSGHLECVKW 1019          

HSP 3 Score: 52.7582 bits (125), Expect = 5.005e-7
Identity = 37/148 (25.00%), Postives = 69/148 (46.62%), Query Frame = 3
Query:  222 HNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWV-IQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAV 662
            H+AA  G+L  +K       +  +  D +G+T LH+A    +L+ V+W+ +    L   T T  G TA+H     G+     +++     ++N + ++  T    A   G+++ +++LL   +       NG   L +A + GH D V
Sbjct:  906 HDAAKKGDLARIKELIGVAPAMKSVPDEKGMTALHIASSNGHLDCVKWLAVSGVDLGQETPT--GYTAIHLAAMGGHVNCM-MILSAMGSVVNCKTVDDQTPLHLAAMSGHLECVKWLLANRSRTEAEDSNGRTALDIAEEYGHEDIV 1050          
BLAST of SMED30024061 vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 57.7658 bits (138), Expect = 2.039e-9
Identity = 39/120 (32.50%), Postives = 61/120 (50.83%), Query Frame = 3
Query:  417 TALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPT-KNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV-SW 770
            + L F CW G+ ++ +LL+      I  R   G T  MFA  GG+ D+   LL +GA   +P+  N    L  A  +GH D VK L++ T   +  +  +G TP+  AA +  + +V +W
Sbjct:   89 SPLTFACWKGHCDVVELLLARSAN-IEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTS-NIEHRTKDGCTPLMLAARYVKYCVVLTW 206          
BLAST of SMED30024061 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 56.225 bits (134), Expect = 1.365e-8
Identity = 52/184 (28.26%), Postives = 79/184 (42.93%), Query Frame = 3
Query:  297 QDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYI-------DIMEFLLNEGANFGLPT--------------------KNGVN---------CLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAA 740
            Q+ +GLT LH AC+  N ++V+ V+     S   R  EG T+LH     G+ EI K LIE           NGA  A    +G          D+ + L +E  N G+                      KN +N          LH+A+ +G++  +  L++  G+ +N KD +  TP+H AA
Sbjct:   78 QNVDGLTALHQACIDENFDLVK-VLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIE-----------NGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQ-LGVEINAKDADNWTPLHAAA 248          
BLAST of SMED30024061 vs. Ensembl Medaka
Match: espn (espin [Source:NCBI gene;Acc:101175480])

HSP 1 Score: 139.813 bits (351), Expect = 4.642e-34
Identity = 71/221 (32.13%), Postives = 120/221 (54.30%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLL-NEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   ++L+  +      +S+ N+    AH+AAATGNL  L+W       +  D+D  G TVLH+A   ++  I +W+++   + P   T+ GA  +H+    G+    +LL+   P L+N +  NGAT    A Q G+++++++L+ N GA+  +   +G+  LH AAQ GH   + WL   T + L  KD +G T +H+AA   H +++SW
Sbjct:   42 VHHAARAGKLTCVRFLVEEAGLPG--NSIANNGATPAHDAAATGNLTCLQWLLTQGGCRPQDRDSSGATVLHLASRFSHHEITEWLLKSGEVDPGVSTDTGALPVHYASAKGDLPSLRLLLGHSPNLVNTQTKNGATPLYLACQEGHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDKDSDGATAMHFAASRGHAKVLSW 260          

HSP 2 Score: 53.9138 bits (128), Expect = 4.510e-7
Identity = 38/154 (24.68%), Postives = 73/154 (47.40%), Query Frame = 3
Query:  228 AAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITK-LLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWL--VEN 680
            A   G+L ++++  KN  +  + +  +G+T LH A    +  ++ W+   T +S   +  +GATA+HF    G+ ++   LL+     +I+     G T    A + G ++  + L+  G + G+  ++G     +A   G     K+L  VEN
Sbjct:  181 ACQEGHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDKDSDGATAMHFAASRGHAKVLSWLLLHGGEIVIDHW---GGTPLHDAAENGELECCQILVVNGVDLGIRDQDGFTAADLAEYNGQSQCAKYLRTVEN 331          

HSP 3 Score: 49.6766 bits (117), Expect = 8.657e-6
Identity = 30/112 (26.79%), Postives = 52/112 (46.43%), Query Frame = 3
Query:  411 GATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGA-NFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAV 743
            GA+ +H    +G     + L+E      N    NGAT A  A   G +  +++LL +G         +G   LH+A++  H +  +WL+++  +      D G  P+HYA+ 
Sbjct:   38 GASPVHHAARAGKLTCVRFLVEEAGLPGNSIANNGATPAHDAAATGNLTCLQWLLTQGGCRPQDRDSSGATVLHLASRFSHHEITEWLLKSGEVDPGVSTDTGALPVHYASA 149          
BLAST of SMED30024061 vs. Ensembl Medaka
Match: espn (espin [Source:NCBI gene;Acc:101175480])

HSP 1 Score: 139.043 bits (349), Expect = 9.162e-34
Identity = 71/221 (32.13%), Postives = 120/221 (54.30%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLL-NEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   ++L+  +      +S+ N+    AH+AAATGNL  L+W       +  D+D  G TVLH+A   ++  I +W+++   + P   T+ GA  +H+    G+    +LL+   P L+N +  NGAT    A Q G+++++++L+ N GA+  +   +G+  LH AAQ GH   + WL   T + L  KD +G T +H+AA   H +++SW
Sbjct:   42 VHHAARAGKLTCVRFLVEEAGLPG--NSIANNGATPAHDAAATGNLTCLQWLLTQGGCRPQDRDSSGATVLHLASRFSHHEITEWLLKSGEVDPGVSTDTGALPVHYASAKGDLPSLRLLLGHSPNLVNTQTKNGATPLYLACQEGHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDKDSDGATAMHFAASRGHAKVLSW 260          

HSP 2 Score: 52.7582 bits (125), Expect = 1.134e-6
Identity = 37/150 (24.67%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  240 GNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITK-LLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWL--VEN 680
            G+L ++++  KN  +  + +  +G+T LH A    +  ++ W+   T +S   +  +GATA+HF    G+ ++   LL+     +I+     G T    A + G ++  + L+  G + G+  ++G     +A   G     K+L  VEN
Sbjct:  185 GHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDKDSDGATAMHFAASRGHAKVLSWLLLHGGEIVIDHW---GGTPLHDAAENGELECCQILVVNGVDLGIRDQDGFTAADLAEYNGQSQCAKYLRTVEN 331          
BLAST of SMED30024061 vs. Ensembl Medaka
Match: espn (espin [Source:NCBI gene;Acc:101175480])

HSP 1 Score: 138.658 bits (348), Expect = 1.022e-33
Identity = 71/221 (32.13%), Postives = 120/221 (54.30%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLL-NEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   ++L+  +      +S+ N+    AH+AAATGNL  L+W       +  D+D  G TVLH+A   ++  I +W+++   + P   T+ GA  +H+    G+    +LL+   P L+N +  NGAT    A Q G+++++++L+ N GA+  +   +G+  LH AAQ GH   + WL   T + L  KD +G T +H+AA   H +++SW
Sbjct:   42 VHHAARAGKLTCVRFLVEEAGLPG--NSIANNGATPAHDAAATGNLTCLQWLLTQGGCRPQDRDSSGATVLHLASRFSHHEITEWLLKSGEVDPGVSTDTGALPVHYASAKGDLPSLRLLLGHSPNLVNTQTKNGATPLYLACQEGHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDKDSDGATAMHFAASRGHAKVLSW 260          

HSP 2 Score: 52.7582 bits (125), Expect = 1.118e-6
Identity = 37/150 (24.67%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  240 GNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITK-LLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWL--VEN 680
            G+L ++++  KN  +  + +  +G+T LH A    +  ++ W+   T +S   +  +GATA+HF    G+ ++   LL+     +I+     G T    A + G ++  + L+  G + G+  ++G     +A   G     K+L  VEN
Sbjct:  185 GHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDKDSDGATAMHFAASRGHAKVLSWLLLHGGEIVIDHW---GGTPLHDAAENGELECCQILVVNGVDLGIRDQDGFTAADLAEYNGQSQCAKYLRTVEN 331          
BLAST of SMED30024061 vs. Ensembl Medaka
Match: espn (espin [Source:NCBI gene;Acc:101175480])

HSP 1 Score: 138.658 bits (348), Expect = 1.036e-33
Identity = 71/221 (32.13%), Postives = 120/221 (54.30%), Query Frame = 3
Query:  111 ISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLL-NEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            + + A  G L   ++L+  +      +S+ N+    AH+AAATGNL  L+W       +  D+D  G TVLH+A   ++  I +W+++   + P   T+ GA  +H+    G+    +LL+   P L+N +  NGAT    A Q G+++++++L+ N GA+  +   +G+  LH AAQ GH   + WL   T + L  KD +G T +H+AA   H +++SW
Sbjct:   42 VHHAARAGKLTCVRFLVEEAGLPG--NSIANNGATPAHDAAATGNLTCLQWLLTQGGCRPQDRDSSGATVLHLASRFSHHEITEWLLKSGEVDPGVSTDTGALPVHYASAKGDLPSLRLLLGHSPNLVNTQTKNGATPLYLACQEGHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDKDSDGATAMHFAASRGHAKVLSW 260          

HSP 2 Score: 52.7582 bits (125), Expect = 1.118e-6
Identity = 37/150 (24.67%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  240 GNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITK-LLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWL--VEN 680
            G+L ++++  KN  +  + +  +G+T LH A    +  ++ W+   T +S   +  +GATA+HF    G+ ++   LL+     +I+     G T    A + G ++  + L+  G + G+  ++G     +A   G     K+L  VEN
Sbjct:  185 GHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDKDSDGATAMHFAASRGHAKVLSWLLLHGGEIVIDHW---GGTPLHDAAENGELECCQILVVNGVDLGIRDQDGFTAADLAEYNGQSQCAKYLRTVEN 331          
BLAST of SMED30024061 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 81.6481 bits (200), Expect = 1.741e-15
Identity = 70/259 (27.03%), Postives = 118/259 (45.56%), Query Frame = 3
Query:   90 SLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKS--KVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVE--------------------------------NTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
            +L++L  +   A CGH +  K LL+   K +K +S   + +   H A    +L ++    K++ S   VT+    GLT LHVA    +LNIV+ ++Q    SP     +  T LH    SG+FE+ + L++     ++ +  +  T    A + G+ ++++ LL   AN    T  G + LH+AA++GHV  V+ L++                                  G   N    NG+TP+H A  HN+ ++V
Sbjct:  273 TLDHLTPLHVAAHCGHHRMAKVLLD---KGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTES---GLTPLHVASFMGHLNIVKILLQ-KGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAP-VDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVV 523          

HSP 2 Score: 75.485 bits (184), Expect = 1.366e-13
Identity = 59/213 (27.70%), Postives = 98/213 (46.01%), Query Frame = 3
Query:  132 GHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            GH+Q  + LL+   + +K   +    +   H A+  G +++ +   +   +        GLT LHVA    NL++V  ++     SP +    G TALH        E+   L++      N   L G T    A+Q G  DI+  L+++ AN  L  K+G+  LH+ AQ+GHV     LV+  G  +      G TP+H A  + + ++V +
Sbjct:  452 GHVQTVRLLLDMEAQQTK---MTKKGFTPLHVASKYGKVDVAELLLERGANP-NAAGKNGLTPLHVAVHHNNLDVVNLLVSKGG-SPHSAARNGYTALHIAAKQNQVEVANSLLQHGAS-ANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQ-GASVYAATRMGYTPLHVACHYGNIKMVKF 657          

HSP 3 Score: 73.1738 bits (178), Expect = 5.906e-13
Identity = 63/224 (28.12%), Postives = 102/224 (45.54%), Query Frame = 3
Query:   99 NLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIE--TEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIV 764
             L  I   A   H+   K LL  + +I   D +  D+    H AA  G+  + K    +  +K   +   G T LH+AC   +L ++  +++ +  S    TE G T LH   + G+  I K+L++    P   N+++    T    A++ G+ ++ EFLL   A      K+    LH AA+ GH + VK L+E+     N     G +P+H AA   H + V
Sbjct:  243 GLSPIHMAAQGDHMDCVKQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMAK-VLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHS-ASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKV---ETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKA-NPNSTTTAGHSPLHIAAREGHVQTV 457          

HSP 4 Score: 67.0106 bits (162), Expect = 5.581e-11
Identity = 58/190 (30.53%), Postives = 90/190 (47.37%), Query Frame = 3
Query:  225 NAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPV--TRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVE---NTGLRLNGKDD-------NGITPIHYAAVHNHHE 758
             AA +GNL+      KN    +   +  GL  LH+A    +   V+ V++  H   V  T T++G TALH    +G  ++   L+      +N +   G T    A Q  ++++++FLL  GAN  +PT++G   L +A QQGH + V  L+       +RL    D        G TP+H AA   H+E
Sbjct:   13 RAARSGNLDKALEHIKNGID-INTANQNGLNALHLASKEGH---VKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTN-VNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAA---HYE 194          

HSP 5 Score: 64.6994 bits (156), Expect = 2.383e-10
Identity = 66/234 (28.21%), Postives = 101/234 (43.16%), Query Frame = 3
Query:  120 TALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQ---------------CTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDD----NGITPIHYAAVHNHHEIV 764
             AL G  Q    L+N    ++ +        Y+A   A   +L ++K+  +N  ++    + +G T L VA    + N+V  +I                C  LS VT    G T LH      N  + +LL+       N    +  T    A + G+  I+E LL+ GA     TKNG++ +HMAAQ  H+D VK L     L+ N + D    + +TP+H AA   HH + 
Sbjct:   80 AALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMA---AQENHLEVVKFLLENGANQSIPTE-DGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLS-VT----GFTPLHIAAHYENLNVAQLLL-------NRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQL-----LQYNAEIDDITLDHLTPLHVAAHCGHHRMA 292          

HSP 6 Score: 63.1586 bits (152), Expect = 8.079e-10
Identity = 49/199 (24.62%), Postives = 93/199 (46.73%), Query Frame = 3
Query:  201 NDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQ---------CTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            ND     H AA  G+  +++    N  + +  +   GL+ +H+A    +++ V+ ++Q           HL+P          LH     G+  + K+L++   +  N R LNG T    A +  ++ +M+ LL   A+    T++G+  LH+A+  GH++ VK L++  G   +  +    TP+H A+   H E+  +
Sbjct:  208 NDELTPLHCAARNGHFRIIEILLDN-GAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTP----------LHVAAHCGHHRMAKVLLDKGAK-PNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQK-GASPSASNVKVETPLHMASRSGHFEVAEF 393          

HSP 7 Score: 53.1434 bits (126), Expect = 9.081e-7
Identity = 34/123 (27.64%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  309 GLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVE 677
            G T LH+A     + +   ++Q    S    + +G T LH     G  +I  LLI  +   +N+   +G T      Q G++ I + L+ +GA+    T+ G   LH+A   G++  VK+L++
Sbjct:  540 GYTALHIAAKQNQVEVANSLLQHG-ASANAESLQGVTPLHLASQEGRPDIVSLLISKQAN-VNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQ 660          

HSP 8 Score: 51.2174 bits (121), Expect = 4.099e-6
Identity = 33/93 (35.48%), Postives = 47/93 (50.54%), Query Frame = 3
Query:  492 INMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSW 770
            IN    NG  A   A++ G++ ++  LL+ G      TK G   LH+AA  G    V  LV N G  +N +   G TP++ AA  NH E+V +
Sbjct:   33 INTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELV-NYGTNVNAQSQKGFTPLYMAAQENHLEVVKF 124          
BLAST of SMED30024061 vs. Planmine SMEST
Match: SMESG000016975.1 (SMESG000016975.1)

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 405/411 (98.54%), Postives = 410/411 (99.76%), Query Frame = 3
Query:  672 VENTGLRLNGKDDNGITPIHYAAVHNHHEIVSWXXXXXXXXXXXXFMIGCQNSTLKNESSETIDCLINSENSLSIKKICDFSALESVQEKLTLILSQYNQNSLIKKKENDNNGIVHCSIPIXXXXXXXXXXXXXRSQYQKILRQSYLSIKLSDHNQISEETQTVEWHERTGSYIRHMTDINSLGYKEIPRPSISEQRIDCVXXXXXXXXXXXXXXNASDSPTTFTNIATLKKKTNRKYINHRRGSSSDDIKISLIQELKKINTLRSMNSPTNNYPXXXXXXXXXXXXXXXXXXXXXXKIRTRNYITDSAPNLTLIFXXXXXXXXXXVMPKWKTDLVVKQTSNKQKDEENSKQMNETPAWKRQLMESKGISPNKSRKQSESSNISTVETDELSPPRISKVTQLVNQWQYNAT 1904
            VENTGLRLNGKDDNGITPIHYAAVHNHHEIVSWLLEKEVRLLKERFMIGCQNSTLKNESSETIDCLINSENSLSIKKICDFSALESVQEKLTLILSQYNQ+SLIKKKEN+NNGIV CSIPISVLLLLQSALVDLRSQYQKILRQSYLSIKLSDHNQISEETQTVEWHERTGSYIRHMTDINSLGYKEIPRPSISEQRIDCVPPPPPLVSPPQFIPNASDSPTTFTNIATLKKKTNRKYINHRRGSSSDDIKISLIQELKKINTLRSMNSPTNNYPEDTESASNTDSSSLNDSNSLSAKIRTRNYITDSAPNLTLIFNSNGSGNSSS+MPKWKTDLVVKQTSNKQKDEENSKQMNETPAWKRQLME+KGISPNKSRKQSESSN+STVETDELSPPRISKVTQLVNQWQYNAT
Sbjct:  422 VENTGLRLNGKDDNGITPIHYAAVHNHHEIVSWLLEKEVRLLKERFMIGCQNSTLKNESSETIDCLINSENSLSIKKICDFSALESVQEKLTLILSQYNQSSLIKKKENENNGIVQCSIPISVLLLLQSALVDLRSQYQKILRQSYLSIKLSDHNQISEETQTVEWHERTGSYIRHMTDINSLGYKEIPRPSISEQRIDCVPPPPPLVSPPQFIPNASDSPTTFTNIATLKKKTNRKYINHRRGSSSDDIKISLIQELKKINTLRSMNSPTNNYPEDTESASNTDSSSLNDSNSLSAKIRTRNYITDSAPNLTLIFNSNGSGNSSSLMPKWKTDLVVKQTSNKQKDEENSKQMNETPAWKRQLMENKGISPNKSRKQSESSNMSTVETDELSPPRISKVTQLVNQWQYNAT 832          
BLAST of SMED30024061 vs. Planmine SMEST
Match: SMESG000016975.1 (SMESG000016975.1)

HSP 1 Score: 471.47 bits (1212), Expect = 1.262e-163
Identity = 299/305 (98.03%), Postives = 304/305 (99.67%), Query Frame = 3
Query:  990 KENDNNGIVHCSIPIXXXXXXXXXXXXXRSQYQKILRQSYLSIKLSDHNQISEETQTVEWHERTGSYIRHMTDINSLGYKEIPRPSISEQRIDCVXXXXXXXXXXXXXXNASDSPTTFTNIATLKKKTNRKYINHRRGSSSDDIKISLIQELKKINTLRSMNSPTNNYPXXXXXXXXXXXXXXXXXXXXXXKIRTRNYITDSAPNLTLIFXXXXXXXXXXVMPKWKTDLVVKQTSNKQKDEENSKQMNETPAWKRQLMESKGISPNKSRKQSESSNISTVETDELSPPRISKVTQLVNQWQYNAT 1904
            +EN+NNGIV CSIPISVLLLLQSALVDLRSQYQKILRQSYLSIKLSDHNQISEETQTVEWHERTGSYIRHMTDINSLGYKEIPRPSISEQRIDCVPPPPPLVSPPQFIPNASDSPTTFTNIATLKKKTNRKYINHRRGSSSDDIKISLIQELKKINTLRSMNSPTNNYPEDTESASNTDSSSLNDSNSLSAKIRTRNYITDSAPNLTLIFNSNGSGNSSS+MPKWKTDLVVKQTSNKQKDEENSKQMNETPAWKRQLME+KGISPNKSRKQSESSN+STVETDELSPPRISKVTQLVNQWQYNAT
Sbjct:    8 QENENNGIVQCSIPISVLLLLQSALVDLRSQYQKILRQSYLSIKLSDHNQISEETQTVEWHERTGSYIRHMTDINSLGYKEIPRPSISEQRIDCVPPPPPLVSPPQFIPNASDSPTTFTNIATLKKKTNRKYINHRRGSSSDDIKISLIQELKKINTLRSMNSPTNNYPEDTESASNTDSSSLNDSNSLSAKIRTRNYITDSAPNLTLIFNSNGSGNSSSLMPKWKTDLVVKQTSNKQKDEENSKQMNETPAWKRQLMENKGISPNKSRKQSESSNMSTVETDELSPPRISKVTQLVNQWQYNAT 312          
BLAST of SMED30024061 vs. Planmine SMEST
Match: SMESG000016986.1 (SMESG000016986.1)

HSP 1 Score: 424.861 bits (1091), Expect = 2.880e-146
Identity = 202/204 (99.02%), Postives = 204/204 (100.00%), Query Frame = 3
Query:   69 MSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVEN 680
            MSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLV++
Sbjct:    1 MSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVKD 204          
BLAST of SMED30024061 vs. Planmine SMEST
Match: SMESG000016986.1 (SMESG000016986.1)

HSP 1 Score: 421.779 bits (1083), Expect = 2.268e-145
Identity = 201/201 (100.00%), Postives = 201/201 (100.00%), Query Frame = 3
Query:   69 MSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWL 671
            MSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWL
Sbjct:    1 MSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWL 201          
BLAST of SMED30024061 vs. Planmine SMEST
Match: SMESG000003436.1 (SMESG000003436.1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.098e-17
Identity = 64/223 (28.70%), Postives = 112/223 (50.22%), Query Frame = 3
Query:  120 TALCGHLQAFKYLLNTSNKISKKDSLKNDNYYLAHNAAATGNLNLLKWTFKNTKS-KVTDQDPEGLTVLHVA----CLTANLNIVQWVIQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETE-PR-LINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLVENTGLRLNGKDDNGITPIHYAAVHNHHEIVS 767
             A  GHL+  ++L+     ISK++    D   + H AA    +N+L++ F+  +  K+ DQD  G++   +A    C+ +   +++  I  + L    +      A H  C +G+  I  LLIE E P+ L+N    +  +   +A + G+I I+E L+ +GAN   PT NG   LH+  Q+   D +  L++  G  +N ++  G TP+H A + N   +V+
Sbjct:  122 AAYFGHLEVVQFLVEKGAVISKRNKQGCD---IVHIAAEGNFVNILEYMFRKHRHFKLDDQDYNGMSPFLLAVSKNCVLSAKALIEKDIDVSQLDKTNKN-----AWHLACKNGHENIFNLLIEMEVPKELMNKLDSSDKSPLHYACENGFIKIVELLIEQGANLSKPTGNGFTPLHIVTQKSFADIILLLIK-AGADINCQNMQGNTPLHIATLSNLPSMVT 335          

HSP 2 Score: 55.8398 bits (133), Expect = 6.744e-8
Identity = 30/112 (26.79%), Postives = 62/112 (55.36%), Query Frame = 3
Query:  417 TALHFCCWSGNFEITKLLIETEPRLINMRMLNGATAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKWLV-ENTGLRLNGKDDNGITPIHYAAVHN 749
            TALH     G+ E T++LI      +++    G T  ++A   G++++++FL+ +GA      K G + +H+AA+   V+ ++++  ++   +L+ +D NG++P   A   N
Sbjct:   83 TALHMAASQGHIEATRILIVEGKVSVDIPDKYGMTPLLWAAYFGHLEVVQFLVEKGAVISKRNKQGCDIVHIAAEGNFVNILEYMFRKHRHFKLDDQDYNGMSPFLLAVSKN 194          
The following BLAST results are available for this feature:
BLAST of SMED30024061 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ESPN1.831e-3130.25espin [Source:HGNC Symbol;Acc:HGNC:13281][more]
ESPN5.007e-3130.25espin [Source:HGNC Symbol;Acc:HGNC:13281][more]
ESPNL1.472e-2631.96espin like [Source:HGNC Symbol;Acc:HGNC:27937][more]
ESPNL1.482e-2632.86espin like [Source:HGNC Symbol;Acc:HGNC:27937][more]
ANK12.048e-1630.70ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
back to top
BLAST of SMED30024061 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-42.883e-1426.64TRP (Transient receptor potential) channel family ... [more]
fem-11.168e-1229.90Sex-determining protein fem-1 [Source:UniProtKB/S... [more]
unc-444.849e-1225.55AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.849e-1225.55AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.030e-1225.55AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30024061 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
f2.374e-1829.83gene:FBgn0262111 transcript:FBtr0304067[more]
f2.447e-1829.83gene:FBgn0262111 transcript:FBtr0304069[more]
f3.396e-1829.83gene:FBgn0262111 transcript:FBtr0304062[more]
f3.396e-1829.83gene:FBgn0262111 transcript:FBtr0304064[more]
nompC6.658e-1627.55gene:FBgn0016920 transcript:FBtr0347408[more]
back to top
BLAST of SMED30024061 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
espn1.211e-3531.67espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espn1.869e-3531.67espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espnlb1.585e-2535.09espin like b [Source:ZFIN;Acc:ZDB-GENE-070912-481][more]
espnla2.715e-1733.54espin like a [Source:ZFIN;Acc:ZDB-GENE-131121-3][more]
dapk19.963e-1629.95death-associated protein kinase 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30024061 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000009332.15.146e-3130.77espin [Source:NCBI gene;Acc:100379704][more]
ENSXETT00000009314.15.515e-3130.77espin [Source:NCBI gene;Acc:100379704][more]
ENSXETT00000009280.15.641e-3130.77espin [Source:NCBI gene;Acc:100379704][more]
ENSXETT00000009422.16.037e-3130.77espin [Source:NCBI gene;Acc:100379704][more]
ENSXETT00000009376.16.555e-3130.77espin [Source:NCBI gene;Acc:100379704][more]
back to top
BLAST of SMED30024061 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Espn3.062e-2829.83espin [Source:MGI Symbol;Acc:MGI:1861630][more]
Espn3.302e-2829.83espin [Source:MGI Symbol;Acc:MGI:1861630][more]
Espn3.973e-2829.83espin [Source:MGI Symbol;Acc:MGI:1861630][more]
Espn2.838e-2732.97espin [Source:MGI Symbol;Acc:MGI:1861630][more]
Espnl6.862e-2731.51espin-like [Source:MGI Symbol;Acc:MGI:2685402][more]
back to top
BLAST of SMED30024061 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B1AK53|ESPN_HUMAN8.793e-3130.25Espin OS=Homo sapiens OX=9606 GN=ESPN PE=1 SV=1[more]
sp|Q9ET47|ESPN_MOUSE2.142e-2729.83Espin OS=Mus musculus OX=10090 GN=Espn PE=1 SV=2[more]
sp|Q3UYR4|ESPNL_MOUSE4.800e-2631.51Espin-like protein OS=Mus musculus OX=10090 GN=Esp... [more]
sp|Q6ZVH7|ESPNL_HUMAN7.070e-2631.96Espin-like protein OS=Homo sapiens OX=9606 GN=ESPN... [more]
sp|Q63618|ESPN_RAT1.755e-2529.41Espin OS=Rattus norvegicus OX=10116 GN=Espn PE=1 S... [more]
back to top
BLAST of SMED30024061 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PTN42.015e-3632.87Espin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_P... [more]
K1RMU71.568e-3436.90Espin OS=Crassostrea gigas OX=29159 GN=CGI_1002214... [more]
A0A3B3SQA36.226e-3433.03Espin OS=Paramormyrops kingsleyae OX=1676925 PE=4 ... [more]
B0S4T82.709e-3231.67Espin OS=Danio rerio OX=7955 GN=espn PE=4 SV=1[more]
A0A3P8WZE22.915e-3231.67Espin OS=Cynoglossus semilaevis OX=244447 PE=4 SV=... [more]
back to top
BLAST of SMED30024061 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
espn4.372e-3431.22espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espn4.505e-3431.22espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espn4.974e-3431.22espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espn5.117e-3431.22espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espnlb2.287e-2530.59espin like b [Source:ZFIN;Acc:ZDB-GENE-070912-481][more]
back to top
BLAST of SMED30024061 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010100.11.011e-2830.63pep scaffold:Pmarinus_7.0:GL477764:15685:34523:-1 ... [more]
ENSPMAT00000000093.17.693e-1624.90pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ankrd168.452e-1626.58ankyrin repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000007446.11.162e-1528.51pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000000095.17.418e-1524.62pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
back to top
BLAST of SMED30024061 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
AVO23.443e-626.61Component of a complex containing the Tor2p kinase... [more]
back to top
BLAST of SMED30024061 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348234.784e-1226.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359109.315e-1036.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433819.379e-1029.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281782.039e-932.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436901.365e-828.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30024061 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
espn4.642e-3432.13espin [Source:NCBI gene;Acc:101175480][more]
espn9.162e-3432.13espin [Source:NCBI gene;Acc:101175480][more]
espn1.022e-3332.13espin [Source:NCBI gene;Acc:101175480][more]
espn1.036e-3332.13espin [Source:NCBI gene;Acc:101175480][more]
ank1a1.741e-1527.03ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
back to top
BLAST of SMED30024061 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016975.10.000e+098.54SMESG000016975.1[more]
SMESG000016975.11.262e-16398.03SMESG000016975.1[more]
SMESG000016986.12.880e-14699.02SMESG000016986.1[more]
SMESG000016986.12.268e-145100.00SMESG000016986.1[more]
SMESG000003436.11.098e-1728.70SMESG000003436.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024061 ID=SMED30024061|Name=SMED30024061|organism=Schmidtea mediterranea sexual|type=transcript|length=1937bp
GCAACCTTGAAATTATTATAAAAACGTAAAAACAACAAATTTAACTTTTC
AACATTAATGCTAACATAATGTCTGAATTTACATGCGAATCACTGGAAAA
TTTGGACAATATTTCTAACACAGCACTTTGTGGACACCTGCAAGCATTTA
AATATCTACTCAACACCTCAAATAAAATATCAAAAAAAGATTCTTTAAAA
AATGATAACTATTATTTGGCTCATAATGCGGCAGCTACAGGCAATTTGAA
TTTACTCAAATGGACATTTAAAAATACAAAATCCAAAGTGACAGACCAAG
ACCCTGAAGGATTGACGGTTTTGCATGTCGCCTGTCTAACTGCAAATTTG
AATATCGTCCAGTGGGTGATTCAGTGTACCCATTTATCACCAGTAACACG
AACAGAGGAAGGAGCGACGGCTTTACATTTCTGTTGTTGGTCTGGCAATT
TTGAGATTACGAAATTGTTGATTGAAACTGAGCCAAGATTGATAAATATG
AGAATGCTGAATGGTGCCACGGCCGCCATGTTTGCAACCCAGGGCGGGTA
CATTGACATCATGGAATTTCTGCTAAATGAAGGAGCTAATTTTGGGCTGC
CAACGAAAAACGGAGTCAACTGCCTTCACATGGCAGCTCAACAGGGTCAT
GTGGACGCTGTAAAATGGCTGGTGGAGAATACTGGCTTGCGATTAAATGG
TAAAGACGATAACGGTATAACACCTATTCATTATGCGGCTGTCCACAATC
ACCATGAAATCGTCAGTTGGCTTTTAGAAAAAGAAGTTCGGCTTCTCAAA
GAAAGATTCATGATTGGATGTCAAAATTCTACTCTAAAAAATGAATCTTC
AGAAACAATCGATTGTCTTATTAACTCAGAAAATTCACTTTCAATTAAAA
AAATATGTGACTTTTCTGCCCTGGAATCTGTTCAAGAAAAGTTGACGTTG
ATCTTATCCCAGTATAACCAAAATTCATTAATCAAGAAAAAGGAGAACGA
TAATAATGGAATTGTTCATTGTTCAATACCCATTAGTGTTCTTCTTTTAC
TCCAATCTGCTTTAGTAGATTTAAGATCTCAGTATCAAAAAATTCTTCGC
CAGTCTTATTTATCTATAAAACTGTCTGACCACAACCAAATATCAGAGGA
AACTCAAACTGTGGAATGGCATGAAAGGACAGGCAGCTATATCAGGCATA
TGACAGATATTAATTCTCTGGGATACAAAGAGATTCCTCGACCATCTATT
AGTGAGCAAAGGATTGATTGCGTTCCTCCTCCACCACCACTAGTTTCTCC
ACCGCAATTTATCCCAAATGCGTCTGATAGTCCAACGACGTTCACAAATA
TCGCAACATTAAAAAAAAAAACCAATAGAAAATATATTAATCATAGACGA
GGATCGAGTTCCGATGATATTAAGATATCGCTGATTCAAGAACTGAAAAA
GATTAACACGCTACGATCCATGAATAGTCCGACGAACAATTATCCAGAAG
ACACTGAATCTGCATCAAATACCGACTCAAGCAGTCTTAATGACAGCAAC
AGTCTCAGTGCCAAAATTAGAACAAGAAATTACATAACCGACAGTGCACC
GAATTTGACTTTGATATTTAATTCAAATGGAAGTGGTAATTCAAGCTCAG
TAATGCCTAAATGGAAAACCGATCTGGTTGTCAAACAAACTTCAAACAAA
CAAAAGGATGAGGAAAATTCGAAGCAAATGAATGAAACACCCGCTTGGAA
ACGTCAGTTGATGGAAAGCAAAGGAATTAGTCCAAATAAAAGCCGAAAAC
AAAGTGAATCTTCGAACATATCGACAGTGGAAACTGATGAACTGTCCCCC
CCTAGAATATCCAAAGTTACACAACTAGTCAATCAATGGCAATATAATGC
GACATAATGCCAACATATATCATTCGTTTATTTAAAC
back to top

protein sequence of SMED30024061-orf-1

>SMED30024061-orf-1 ID=SMED30024061-orf-1|Name=SMED30024061-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=613bp
MSEFTCESLENLDNISNTALCGHLQAFKYLLNTSNKISKKDSLKNDNYYL
AHNAAATGNLNLLKWTFKNTKSKVTDQDPEGLTVLHVACLTANLNIVQWV
IQCTHLSPVTRTEEGATALHFCCWSGNFEITKLLIETEPRLINMRMLNGA
TAAMFATQGGYIDIMEFLLNEGANFGLPTKNGVNCLHMAAQQGHVDAVKW
LVENTGLRLNGKDDNGITPIHYAAVHNHHEIVSWLLEKEVRLLKERFMIG
CQNSTLKNESSETIDCLINSENSLSIKKICDFSALESVQEKLTLILSQYN
QNSLIKKKENDNNGIVHCSIPISVLLLLQSALVDLRSQYQKILRQSYLSI
KLSDHNQISEETQTVEWHERTGSYIRHMTDINSLGYKEIPRPSISEQRID
CVPPPPPLVSPPQFIPNASDSPTTFTNIATLKKKTNRKYINHRRGSSSDD
IKISLIQELKKINTLRSMNSPTNNYPEDTESASNTDSSSLNDSNSLSAKI
RTRNYITDSAPNLTLIFNSNGSGNSSSVMPKWKTDLVVKQTSNKQKDEEN
SKQMNETPAWKRQLMESKGISPNKSRKQSESSNISTVETDELSPPRISKV
TQLVNQWQYNAT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
GO:0051015actin filament binding
Vocabulary: biological process
TermDefinition
GO:0051017actin filament bundle assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 181..211
e-value: 0.12
score: 21.5
coord: 114..144
e-value: 0.039
score: 23.1
coord: 148..177
e-value: 0.11
score: 21.6
coord: 215..244
e-value: 0.0013
score: 28.0
coord: 80..111
e-value: 150.0
score: 11.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 215..238
score: 9.805
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 148..180
score: 9.938
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 181..204
score: 8.79
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 10..319
e-value: 1.1E-49
score: 171.1
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 15..240
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 154..239
e-value: 1.3E-16
score: 61.0
coord: 52..137
e-value: 5.9E-12
score: 46.0
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 10..238
score: 37.507
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 540..555
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 538..597
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 568..597
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 464..495
NoneNo IPR availablePANTHERPTHR24153:SF0ESPIN-LIKE PROTEINcoord: 18..242
NoneNo IPR availablePANTHERPTHR24153FAMILY NOT NAMEDcoord: 18..242