TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30024037
Length (bp)622
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30024037) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30024037) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024037

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024037h1SMcG0010326 Contig4255newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024037h1SMcG0010326 Contig4255uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024037h1SMcG0010328 Contig4255newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024037h1SMcG0010328 Contig4255uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024037h1SMcG0018221 Contig4255newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024037h1SMcG0018221 Contig4255uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
tail regionSMED30024037h1SMcG0018221 SmedASXL_004208SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30024037h1SMcG0018221 dd_Smed_v4_12648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30024037h1SMcG0018221 dd_Smed_v4_12648_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 51.6026 bits (122), Expect = 2.492e-7
Identity = 38/158 (24.05%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   75 NNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQ-------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKP--NANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            N  YIW I      +    +E   ++++  F     GYK+  +       A+  + Y+ ++V  + G+YD  L WPF+  I++++L+QS+     NH   +D K   +   +Q+P +  + KG G  T   L   ++        F+++D + ++ E+
Sbjct:  350 NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAK--PELLAFQRPTIPRNPKGFGYVTFMHLEALRQRT------FIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 51.6026 bits (122), Expect = 2.492e-7
Identity = 38/158 (24.05%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   75 NNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQ-------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKP--NANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            N  YIW I      +    +E   ++++  F     GYK+  +       A+  + Y+ ++V  + G+YD  L WPF+  I++++L+QS+     NH   +D K   +   +Q+P +  + KG G  T   L   ++        F+++D + ++ E+
Sbjct:  350 NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAK--PELLAFQRPTIPRNPKGFGYVTFMHLEALRQRT------FIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 49.6766 bits (117), Expect = 1.363e-6
Identity = 36/128 (28.12%), Postives = 66/128 (51.56%), Query Frame = 3
Query:  147 TKVFKLSPYGYKMAAQAKLDS------GYLGIYVILVPGKYDKLLNWPFENPIQISLLNQS-KPNANHTVTIDPKTMKDEPCWQKP--ILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            ++ F  S  GY++ A+A L+        +L +Y +++ G++D LL WPF   + + LL+QS K N   T   DP +      +++P   +N+   GC    A   S+ +  +N Y    +++D ++LK
Sbjct:  430 SQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSS----FKRPDGEMNI-ASGCPRFVAH--SVLENAKNAY----IKDDTLFLK 546          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 49.6766 bits (117), Expect = 1.363e-6
Identity = 36/128 (28.12%), Postives = 66/128 (51.56%), Query Frame = 3
Query:  147 TKVFKLSPYGYKMAAQAKLDS------GYLGIYVILVPGKYDKLLNWPFENPIQISLLNQS-KPNANHTVTIDPKTMKDEPCWQKP--ILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            ++ F  S  GY++ A+A L+        +L +Y +++ G++D LL WPF   + + LL+QS K N   T   DP +      +++P   +N+   GC    A   S+ +  +N Y    +++D ++LK
Sbjct:  430 SQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSS----FKRPDGEMNI-ASGCPRFVAH--SVLENAKNAY----IKDDTLFLK 546          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 49.6766 bits (117), Expect = 1.363e-6
Identity = 36/128 (28.12%), Postives = 66/128 (51.56%), Query Frame = 3
Query:  147 TKVFKLSPYGYKMAAQAKLDS------GYLGIYVILVPGKYDKLLNWPFENPIQISLLNQS-KPNANHTVTIDPKTMKDEPCWQKP--ILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            ++ F  S  GY++ A+A L+        +L +Y +++ G++D LL WPF   + + LL+QS K N   T   DP +      +++P   +N+   GC    A   S+ +  +N Y    +++D ++LK
Sbjct:  430 SQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSS----FKRPDGEMNI-ASGCPRFVAH--SVLENAKNAY----IKDDTLFLK 546          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 55.0694 bits (131), Expect = 6.732e-9
Identity = 37/104 (35.58%), Postives = 55/104 (52.88%), Query Frame = 3
Query:   87 IWTISGVKTLIYNDYKEILNTKVFKL----SPYGYKMAAQAKL--DSGYLG----IYVILVPGKYDKLLNWPFENPIQISLLNQS---KPNANHTVTIDPKTMK 359
            IW I  ++    N+ K   +T +F +      +GYKM A A L  D    G    +YV+L+ G++D  L WPF   I+ISLL+Q+   +   N T  IDP+ +K
Sbjct:  266 IWKIDKLQQRT-NEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLK 368          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 50.447 bits (119), Expect = 3.094e-7
Identity = 36/128 (28.12%), Postives = 62/128 (48.44%), Query Frame = 3
Query:  156 FKLSPYGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCW---QKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            F  S YGYK+ A   L      ++ ++ +Y+ ++PG+YD LL WPF + I  +L  Q   +    V    ++   +P W   Q+P     Q G G    FP  I  +  +  P  F++ D ++L+ ++
Sbjct:  351 FYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVA---ESFVPDPTWENFQRPSNEPDQLGFG----FPRFISHELLHSRP--FIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 50.0618 bits (118), Expect = 3.896e-7
Identity = 36/128 (28.12%), Postives = 62/128 (48.44%), Query Frame = 3
Query:  156 FKLSPYGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCW---QKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            F  S YGYK+ A   L      ++ ++ +Y+ ++PG+YD LL WPF + I  +L  Q   +    V    ++   +P W   Q+P     Q G G    FP  I  +  +  P  F++ D ++L+ ++
Sbjct:  360 FYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVA---ESFVPDPTWENFQRPSNEPDQLGFG----FPRFISHELLHSRP--FIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 55.0694 bits (131), Expect = 1.290e-8
Identity = 51/186 (27.42%), Postives = 83/186 (44.62%), Query Frame = 3
Query:   51 RKELFDSDNNFYIWTISGVKTLIY--NDYKEILNTKVFK-----LSP------YGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN*TFLSRNISI 551
            R+E+ +        ++S    LI+   DY   L     +      SP      YGYK+   A L      +  +L IY+ ++PG+YD LL WPF   +  S+L+QS P+ +    I  +T   +P W+       QK C  + +   S       GYP +F+ +++I  +  +  N  FL  +I I
Sbjct:  289 RQEILELRREMEELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHIT-ETFNPDPNWKN-----FQKPCSSRNSLDESTLG---FGYP-KFISHEEIKKRNYIRDNSIFLKASIEI 464          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 55.0694 bits (131), Expect = 1.290e-8
Identity = 51/186 (27.42%), Postives = 83/186 (44.62%), Query Frame = 3
Query:   51 RKELFDSDNNFYIWTISGVKTLIY--NDYKEILNTKVFK-----LSP------YGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN*TFLSRNISI 551
            R+E+ +        ++S    LI+   DY   L     +      SP      YGYK+   A L      +  +L IY+ ++PG+YD LL WPF   +  S+L+QS P+ +    I  +T   +P W+       QK C  + +   S       GYP +F+ +++I  +  +  N  FL  +I I
Sbjct:  289 RQEILELRREMEELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHIT-ETFNPDPNWKN-----FQKPCSSRNSLDESTLG---FGYP-KFISHEEIKKRNYIRDNSIFLKASIEI 464          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 50.447 bits (119), Expect = 4.087e-7
Identity = 47/177 (26.55%), Postives = 79/177 (44.63%), Query Frame = 3
Query:    9 LMRNNVSLTMNNYFRKEL-FDSDNNFYIWTI---SGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDS------GYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTV-TIDPKTMKDEPCWQKPILNVH-QKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            L   ++ L  +    +EL F + +  +IW I   S  +          + +  F  S YGYKM  +  L+        +L ++ +++ GKYD LL WPF   + + LL+Q+  N  H +    P        +Q+PI  ++   GC L    PL+          S +LR+D I++K
Sbjct:  372 LTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQN--NREHIIDAFRPDVSSTS--FQRPISEMNIASGCPLFC--PLAKLAGK-----SSYLRDDTIFIK 537          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 50.447 bits (119), Expect = 4.373e-7
Identity = 47/177 (26.55%), Postives = 79/177 (44.63%), Query Frame = 3
Query:    9 LMRNNVSLTMNNYFRKEL-FDSDNNFYIWTI---SGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDS------GYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTV-TIDPKTMKDEPCWQKPILNVH-QKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            L   ++ L  +    +EL F + +  +IW I   S  +          + +  F  S YGYKM  +  L+        +L ++ +++ GKYD LL WPF   + + LL+Q+  N  H +    P        +Q+PI  ++   GC L    PL+          S +LR+D I++K
Sbjct:  359 LTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQN--NREHIIDAFRPDVSSTS--FQRPISEMNIASGCPLFC--PLAKLAGK-----SSYLRDDTIFIK 524          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 50.447 bits (119), Expect = 4.373e-7
Identity = 47/177 (26.55%), Postives = 79/177 (44.63%), Query Frame = 3
Query:    9 LMRNNVSLTMNNYFRKEL-FDSDNNFYIWTI---SGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDS------GYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTV-TIDPKTMKDEPCWQKPILNVH-QKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            L   ++ L  +    +EL F + +  +IW I   S  +          + +  F  S YGYKM  +  L+        +L ++ +++ GKYD LL WPF   + + LL+Q+  N  H +    P        +Q+PI  ++   GC L    PL+          S +LR+D I++K
Sbjct:  359 LTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQN--NREHIIDAFRPDVSSTS--FQRPISEMNIASGCPLFC--PLAKLAGK-----SSYLRDDTIFIK 524          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 56.6102 bits (135), Expect = 5.118e-9
Identity = 54/201 (26.87%), Postives = 94/201 (46.77%), Query Frame = 3
Query:   12 MRNNVSL--TMNNYFRKELFDSDNNFYIWTISGVKTLIY--NDY-KEILNTKV----------FKLSPYGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN*TFLSRNISI 551
            MR ++S+  ++ +  R+E+ +        ++S    LI+  +DY +++   KV          F    YGYK+   A L      +  YL +Y+ ++PG+YD LL WPF   +  SLL+QS P+ +    I  +T   +P W+       QK  G + +   S       GYP +F+ ++ I  +  +  N  FL  ++ I
Sbjct:  274 MRAHLSMMSSLVSRQRQEILELRKQVEELSVSSEGVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHIT-ETFNPDPNWKN-----FQKPTGSRNSLDESTLG---FGYP-KFISHEDIRKRNYVRDNAIFLRASVEI 464          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 55.8398 bits (133), Expect = 1.055e-8
Identity = 39/156 (25.00%), Postives = 79/156 (50.64%), Query Frame = 3
Query:   75 NNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQ-------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEP---CWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            +  +IW I+   +L+ N  +E   +++++ F     GYK+  +       A+  + Y+ ++V  + G+YD LL WP +  I++S+L+QS+  A   +    + M  +P    +Q+P +  + KG G  T   L   K+ Q      +++ND + ++
Sbjct:  386 SGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVA---MQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQALKQRQ------YVKNDTLLVR 532          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 52.7582 bits (125), Expect = 7.832e-8
Identity = 38/158 (24.05%), Postives = 76/158 (48.10%), Query Frame = 3
Query:   75 NNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQ-------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKP--NANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            N  YIW I      + +  +E   ++++  F     GYK+  +       A+  + Y+ ++V  + G+YD  L WPF+  I++++L+QS+     NH   +D K   +   +Q+P +  + KG G  T   L   ++        F+++D + ++ E+
Sbjct:  358 NGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKP--ELLAFQRPTIPRNPKGFGYVTFMHLEALRQGT------FIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 50.0618 bits (118), Expect = 5.286e-7
Identity = 40/150 (26.67%), Postives = 73/150 (48.67%), Query Frame = 3
Query:   84 YIWTISGVKTLIYNDY---KEILNTKVFKLSPYGYKMAAQAKLD---SG---YLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVH-QKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            ++W I+ V    +         L +  F  + YGYK+  +  L+   SG   +L ++++++ G+YD LL WPF N +   LL+Q+  N  H +      +     +Q+P    +   GC L   FPLS  +  ++ Y    +++D ++LK
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQN--NREHAIDAFRPDLSSAS-FQRPQSETNVASGCPL--FFPLSKLQSPKHAY----VKDDTMFLK 402          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 50.0618 bits (118), Expect = 5.286e-7
Identity = 40/150 (26.67%), Postives = 73/150 (48.67%), Query Frame = 3
Query:   84 YIWTISGVKTLIYNDY---KEILNTKVFKLSPYGYKMAAQAKLD---SG---YLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVH-QKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            ++W I+ V    +         L +  F  + YGYK+  +  L+   SG   +L ++++++ G+YD LL WPF N +   LL+Q+  N  H +      +     +Q+P    +   GC L   FPLS  +  ++ Y    +++D ++LK
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQN--NREHAIDAFRPDLSSAS-FQRPQSETNVASGCPL--FFPLSKLQSPKHAY----VKDDTMFLK 402          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 50.0618 bits (118), Expect = 5.286e-7
Identity = 40/150 (26.67%), Postives = 73/150 (48.67%), Query Frame = 3
Query:   84 YIWTISGVKTLIYNDY---KEILNTKVFKLSPYGYKMAAQAKLD---SG---YLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVH-QKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            ++W I+ V    +         L +  F  + YGYK+  +  L+   SG   +L ++++++ G+YD LL WPF N +   LL+Q+  N  H +      +     +Q+P    +   GC L   FPLS  +  ++ Y    +++D ++LK
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQN--NREHAIDAFRPDLSSAS-FQRPQSETNVASGCPL--FFPLSKLQSPKHAY----VKDDTMFLK 402          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf4 (TNF receptor associated factor 4 [Source:MGI Symbol;Acc:MGI:1202880])

HSP 1 Score: 50.0618 bits (118), Expect = 7.103e-7
Identity = 39/125 (31.20%), Postives = 56/125 (44.80%), Query Frame = 3
Query:   54 KELFDSDNNFYIWTISGVKTLIYNDYKEILNTKVFKLSP------YGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCW---QKP 383
            +EL    +   IW I      +  + K   N + F  SP      YGYK+   A L      +  +L IY+ ++PG +D LL WPF   +  SLL+QS P       +  +T   +P W   QKP
Sbjct:  300 EELSIGSDGVLIWKIGSYGRRL-QEAKAKPNLECF--SPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVT-ETFHPDPNWKNFQKP 420          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.351e-8
Identity = 40/153 (26.14%), Postives = 72/153 (47.06%), Query Frame = 3
Query:   75 NNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQ-------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            N  +IW I G   L  +  +E   ++++  F     GYK+  +       A+  + Y+ ++V  + G YD LL WP +  I++S+L+QS+  A         T  D   +Q+P    + KG G  T   L+  K+ Q      +++ND + ++
Sbjct:  384 NGVFIWRIKGFSGLQKSQEEEKPVVIHSPGFYTGDPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGDYDSLLPWPLQGTIRLSILDQSESTARQDQVEVMDTKPDLLAFQRPTAPRNPKGFGYVTFMHLNTLKQRQ------YVKNDTLLVR 530          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q28DL4|TRAF6_XENTR (TNF receptor-associated factor 6 OS=Xenopus tropicalis OX=8364 GN=traf6 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 5.537e-8
Identity = 39/156 (25.00%), Postives = 79/156 (50.64%), Query Frame = 3
Query:   75 NNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQ-------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEP---CWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            +  +IW I+   +L+ N  +E   +++++ F     GYK+  +       A+  + Y+ ++V  + G+YD LL WP +  I++S+L+QS+  A   +    + M  +P    +Q+P +  + KG G  T   L   K+ Q      +++ND + ++
Sbjct:  386 SGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVA---MQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQALKQRQ------YVKNDTLLVR 532          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.324e-7
Identity = 42/165 (25.45%), Postives = 77/165 (46.67%), Query Frame = 3
Query:   60 LFDSD----NNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQ-------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEP---CWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            L D D    N  +IW I G   L     +E   ++++  F     GYK+  +       A+  + Y+ ++V  + G+YD LL WP    I++S+L+QS+      +    + M  +P    +Q+P    + KG G  T   L+  K+ Q      +++ND ++++
Sbjct:  375 LLDVDGHHCNGVFIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSE---GAIIQDQEEVMDTKPDLLAFQRPTTQRNPKGFGYVTFMHLNTLKQRQ------YVKNDTLFVR 530          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.994e-7
Identity = 39/158 (24.68%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   75 NNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQ-------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKP--NANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            N  YIW I      +    +E   ++++  F     GYK+  +       A+  + Y+ ++V  + G+YD  L WPF+  I++++L+QS+     NH   +D K   D   +Q+P +  + KG G  T   L   ++        F+++D + ++ E+
Sbjct:  350 NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAK--PDLLAFQRPTIPRNPKGFGYVTFMHLEALRQRT------FIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.994e-7
Identity = 39/158 (24.68%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   75 NNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQ-------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKP--NANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            N  YIW I      +    +E   ++++  F     GYK+  +       A+  + Y+ ++V  + G+YD  L WPF+  I++++L+QS+     NH   +D K   D   +Q+P +  + KG G  T   L   ++        F+++D + ++ E+
Sbjct:  350 NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAK--PDLLAFQRPTIPRNPKGFGYVTFMHLEALRQRT------FIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A448XSQ0 (MATH domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS37444 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.093e-12
Identity = 39/118 (33.05%), Postives = 64/118 (54.24%), Query Frame = 3
Query:  174 GYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEP--CWQKP--ILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELL 515
            GY + A+ +L + +LG++V LVPG++D  L WPF+  I ++LL+Q++   +    + P  M  +    W +P  + + H  G G      L       +G  S FLRND+IY+K  L+
Sbjct:    5 GYCLQAKVELTTDHLGLFVRLVPGRFDGQLVWPFDQEIALTLLDQTEARDDVYRVLKPYHMDSDEKGIWDQPSAVSSQHNSGWGFPRFAELGEIIGFDDGVESRFLRNDRIYVKICLV 122          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A158R829 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4771 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.824e-11
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 3
Query:   78 NFYIWTISGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDE---PCWQKPI-LNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLK 518
            N++IW I+    L   +  E    + F L   GY+M A+ +  +   GIY+ LVPG YD  L+WPF + I  S+L+Q+    NH V +    + DE     WQ+P  ++ +Q G GL     L     ++   PS +LRN  +Y++  L K
Sbjct:  994 NWHIWRIANFAQLEECNGGEW--CEPFYLGQPGYRMQAKLEFTTYLFGIYIKLVPGDYDDCLSWPFSSDIYFSILDQTGA-GNHIVRVLRPYLNDEDEREVWQRPTRVSCNQVGWGLPD-IGLRSLVHSRICRPSPYLRNGTLYIQITLGK 1140          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A068Y7B9 (TNF receptor associated factor 4 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000552700 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.333e-11
Identity = 51/154 (33.12%), Postives = 78/154 (50.65%), Query Frame = 3
Query:   69 SDNNFYIWTISGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDE---PCWQKPI-LNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLK 518
            S  N++IW I+    L   +  E    + F L   GY+M A+ +  +   GIY+ LVPG YD  L+WPF + I  S+L+Q+    NH V +    + DE     WQ+P  ++ +Q G GL     L     ++   PS +LRN  +Y++  L K
Sbjct:  307 SCGNWHIWRIANFAQLEECNGGEWC--EPFYLGQPGYRMQAKLEFTTYLFGIYIKLVPGDYDDCLSWPFSSDIYFSILDQTGA-GNHIVRVLRPYLNDEDEREVWQRPTRMSCNQVGWGLPD-IGLRSLVHSRLCRPSPYLRNGTLYIQITLGK 456          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3P7L842 (MATH domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS9396 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.374e-11
Identity = 49/162 (30.25%), Postives = 78/162 (48.15%), Query Frame = 3
Query:   72 DNNFYIWTI---SGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPC-------WQKPILNVHQK--GCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN 521
            D N++IW +   + ++     D+ E      F L   GY+M A+ +  +   G Y+ L+ G YD  L WPF+  +  S+L+Q+   ANH V    + ++  PC       W +P     +K  G GL      S+F   + G PS +LRND +Y++  L K 
Sbjct:   40 DCNWFIWRVDNFADIEEKCCGDWCE-----PFYLGQPGYRMQAKIEFSTYMFGAYIRLICGDYDACLQWPFDRDVYFSILDQTG-CANHIV----RVLRPYPCDSDEKGIWDRPKAGECEKQIGWGLPDLGLRSLF-CTKMGKPSAYLRNDTLYIQISLGKT 190          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A068WMW7 (TNF receptor associated factor 4 OS=Echinococcus granulosus OX=6210 GN=EgrG_000552700 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.491e-11
Identity = 51/154 (33.12%), Postives = 78/154 (50.65%), Query Frame = 3
Query:   69 SDNNFYIWTISGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDE---PCWQKPI-LNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLK 518
            S  N++IW I+    L   +  E    + F L   GY+M A+ +  +   GIY+ LVPG YD  L+WPF + I  S+L+Q+    NH V +    + DE     WQ+P  ++ +Q G GL     L     ++   PS +LRN  +Y++  L K
Sbjct:  314 SCGNWHIWRIANFAQLEECNGGEWC--EPFYLGQPGYRMQAKLEFTTYLFGIYIKLVPGDYDDCLSWPFSSDIYFSILDQTGA-GNHIVRVLRPYLNDEDEREVWQRPTRMSCNQVGWGLPD-IGLRSLVHSRLCRPSPYLRNGTLYIQITLGK 463          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 57.7658 bits (138), Expect = 1.337e-9
Identity = 46/188 (24.47%), Postives = 86/188 (45.74%), Query Frame = 3
Query:   12 MRNNVSLTMNNYFRKELFDSDNNF-----------YIWTISGVKTLIYND---YKEILNTKVFKLSPYGYKMAAQAKLD-------SGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            +RN    T     RK+L   + +            Y+W + G  T I N    +  +L++  F     GYK+  +  L        S Y+ ++V  + G++D  L+WP +  I++++L+Q++    H V +  +T  D   +Q+P +  + KG G  T   L     +Q G    F+R+D + ++ E+
Sbjct:  318 IRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAE--GQHHVEV-METKPDLQAFQRPTVQRNPKGFGYVTFMQLQAL--HQRG----FVRDDVLMVRCEV 496          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 57.7658 bits (138), Expect = 1.382e-9
Identity = 46/188 (24.47%), Postives = 86/188 (45.74%), Query Frame = 3
Query:   12 MRNNVSLTMNNYFRKELFDSDNNF-----------YIWTISGVKTLIYND---YKEILNTKVFKLSPYGYKMAAQAKLD-------SGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            +RN    T     RK+L   + +            Y+W + G  T I N    +  +L++  F     GYK+  +  L        S Y+ ++V  + G++D  L+WP +  I++++L+Q++    H V +  +T  D   +Q+P +  + KG G  T   L     +Q G    F+R+D + ++ E+
Sbjct:  342 IRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAE--GQHHVEV-METKPDLQAFQRPTVQRNPKGFGYVTFMQLQAL--HQRG----FVRDDVLMVRCEV 520          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 57.7658 bits (138), Expect = 1.382e-9
Identity = 46/188 (24.47%), Postives = 86/188 (45.74%), Query Frame = 3
Query:   12 MRNNVSLTMNNYFRKELFDSDNNF-----------YIWTISGVKTLIYND---YKEILNTKVFKLSPYGYKMAAQAKLD-------SGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            +RN    T     RK+L   + +            Y+W + G  T I N    +  +L++  F     GYK+  +  L        S Y+ ++V  + G++D  L+WP +  I++++L+Q++    H V +  +T  D   +Q+P +  + KG G  T   L     +Q G    F+R+D + ++ E+
Sbjct:  342 IRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAE--GQHHVEV-METKPDLQAFQRPTVQRNPKGFGYVTFMQLQAL--HQRG----FVRDDVLMVRCEV 520          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 53.1434 bits (126), Expect = 3.952e-8
Identity = 51/186 (27.42%), Postives = 82/186 (44.09%), Query Frame = 3
Query:   51 RKELFDSDNNFYIWTISGVKTLIY--NDYKEILN-----------TKVFKLSPYGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN*TFLSRNISI 551
            R+E+ +        ++S    LI+  NDY   L            +  F    YGYK+   A L      +  +L IY+ ++PG+YD LL WPF   +  S+L+QS P+ +    I  +T   +P W+       QK    + +   S       GYP +F+ +D+I  +  +  N  FL  +I I
Sbjct:  289 RQEIIELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHIT-ETFNPDPNWKN-----FQKPSSSRNSLDESTLG---FGYP-KFISHDEIRKRNYIRDNAIFLKASIEI 464          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4b (TNF receptor-associated factor 4-like [Source:NCBI gene;Acc:103043275])

HSP 1 Score: 50.447 bits (119), Expect = 3.389e-7
Identity = 31/99 (31.31%), Postives = 49/99 (49.49%), Query Frame = 3
Query:   54 KELFDSDNNFYIWTISG-VKTLIYNDYKEILNTKVFKLSPY----GYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKP 317
            +EL  S +   +W I    + L     +   + ++F  + Y    GY++   A L      +  YL IY+ ++PG+YD LL WPF   +  SLL+QS P
Sbjct:  300 EELSGSQDGVLLWKIPDYCRRLQEARTRTTGSAELFSPAFYSHRHGYRLQVSAFLNGNGSGEGSYLSIYIRVLPGEYDGLLEWPFPYRVTFSLLDQSDP 398          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 4.888e-10
Identity = 28/79 (35.44%), Postives = 48/79 (60.76%), Query Frame = 3
Query:  141 LNTKVFKLSPYGYKMAAQAKLDSG------YLGIYVILVPGKYDKLLNWPFENPIQISLLNQ--SKPNANHTVTIDPKT 353
            L ++ F  SP+GYKM A+A L+        +L ++ +++ G+YD LL WPF   + +SLL+Q  ++ + + T T DP +
Sbjct:  292 LYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPAS 370          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.553e-8
Identity = 31/122 (25.41%), Postives = 62/122 (50.82%), Query Frame = 3
Query:  156 FKLSPYGYKMAAQAKLDSG------YLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            F  SP+GY+M A+A L+        +L ++ +++ G+YD LL WPF   + ++LL+Q       + T  P        +++P  +++     + +  PL  F  +     + +L++D I++K
Sbjct:  354 FYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSS--FRRPTSDMN-----IASGCPL--FVSHVALESASYLQDDTIFIK 466          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO30276 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T189])

HSP 1 Score: 56.9954 bits (136), Expect = 1.676e-10
Identity = 34/110 (30.91%), Postives = 58/110 (52.73%), Query Frame = 3
Query:   84 YIWTISGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDSG------YLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTM--KDEPCWQKPIL 389
            ++W I   K L    Y+EI +   F  S YGYK+  +A L +       +L +Y  ++ G+YD LL WPF   I + +++QS    + T+ I+P  +    + C+ +PI+
Sbjct:   23 FVWRICDYKDL----YEEIYSPS-FYTSKYGYKVQLKAYLHTNPFNGETHLWLYACIMVGEYDALLEWPFRRKITLYVIDQSDQRKHETLLINPDDVLPDRKKCFHRPIM 127          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO31692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX78])

HSP 1 Score: 56.9954 bits (136), Expect = 7.455e-10
Identity = 34/110 (30.91%), Postives = 58/110 (52.73%), Query Frame = 3
Query:   84 YIWTISGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDSG------YLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTM--KDEPCWQKPIL 389
            ++W I   K L    Y+EI +   F  S YGYK+  +A L +       +L +Y  ++ G+YD LL WPF   I + +++QS    + T+ I+P  +    + C+ +PI+
Sbjct:  260 FVWRICDYKDL----YEEIYSPS-FYTSKYGYKVQLKAYLHTNPFNGETHLWLYACIMVGEYDALLEWPFRRKITLYVIDQSDQRKHETLLINPDDVLPDRKKCFHRPIM 364          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO31690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX76])

HSP 1 Score: 56.225 bits (134), Expect = 1.555e-9
Identity = 39/148 (26.35%), Postives = 70/148 (47.30%), Query Frame = 3
Query:   84 YIWTISGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDSG------YLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTM--KDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            ++W I   K L    Y EI +   F  S YGYK+  +A L +       +L +Y  ++ G+YD LL WPF   I + +++QS    + T+ I+P  +    + C+ +PI        G    + L+ F   +      F+++  +++K
Sbjct:  260 FVWRICDYKDL----YGEIYSPS-FYTSKYGYKVQLKANLRTNPFNGGTHLSLYACIMVGEYDALLEWPFRRKITLYVIDQSDQRKHETLLINPDDVLPDRKKCFHRPIT-------GNNVGYGLTRFLSLEELTSGGFIKDGVMFIK 395          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO36181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJA2])

HSP 1 Score: 50.8322 bits (120), Expect = 1.456e-8
Identity = 27/84 (32.14%), Postives = 47/84 (55.95%), Query Frame = 3
Query:   84 YIWTISGVKTLIYNDY---KEILNTKVFKLSPYGYKMAAQAKLDSG------YLGIYVILVPGKYDKLLNWPFENPIQISLLNQ 308
            ++W I       YND    K+ +++++F  S YGYKM  ++ L+        +L ++V +  G+YD LL WPF+  I + L++Q
Sbjct:   17 FVWRIRN-----YNDQYEKKQTISSRLFYTSRYGYKMRLKSHLNGNGDGKGTHLSLFVQITKGEYDALLEWPFKRKITLYLIDQ 95          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 52.7582 bits (125), Expect = 2.380e-8
Identity = 38/131 (29.01%), Postives = 66/131 (50.38%), Query Frame = 3
Query:  135 EILNTKVFKLSPYGYKMAAQA------KLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTI--DPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLK 503
            +I+ +  F  S YGYKM  +A           +L + + ++ G+YD +L WPF   I +SL+NQS+   + TV I  D  T   +  +++PI N    GCG       S F  +      +++++D I+++
Sbjct:  361 DIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWRSETVEIYPDDATPDKKHKFERPIEN-ENVGCG------YSCFISHMELNSGDYIKDDVIFIE 484          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 56.225 bits (134), Expect = 4.424e-9
Identity = 50/186 (26.88%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   51 RKELFDSDNNFYIWTISGVKTLIY--NDYKEILNTKVFK-----LSP------YGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN*TFLSRNISI 551
            R+E+ +        ++S    LI+  NDY   L     +      SP      YGYK+   A L      +  +L +Y+ ++PG+YD LL WPF   +  S+L+QS P+ +    I  +T   +P W+       QK C  + +   S       GYP +F+ +++I  +  +  N  F+  +I I
Sbjct:  282 RQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHIT-ETFNPDPNWKN-----FQKPCSTRNSLDESTLG---FGYP-KFISHEEIKKRNYIRDNCIFIKASIEI 457          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 56.225 bits (134), Expect = 4.490e-9
Identity = 50/186 (26.88%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   51 RKELFDSDNNFYIWTISGVKTLIY--NDYKEILNTKVFK-----LSP------YGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN*TFLSRNISI 551
            R+E+ +        ++S    LI+  NDY   L     +      SP      YGYK+   A L      +  +L +Y+ ++PG+YD LL WPF   +  S+L+QS P+ +    I  +T   +P W+       QK C  + +   S       GYP +F+ +++I  +  +  N  F+  +I I
Sbjct:  289 RQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHIT-ETFNPDPNWKN-----FQKPCSTRNSLDESTLG---FGYP-KFISHEEIKKRNYIRDNCIFIKASIEI 464          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 56.225 bits (134), Expect = 4.632e-9
Identity = 50/186 (26.88%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   51 RKELFDSDNNFYIWTISGVKTLIY--NDYKEILNTKVFK-----LSP------YGYKMAAQAKL------DSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN*TFLSRNISI 551
            R+E+ +        ++S    LI+  NDY   L     +      SP      YGYK+   A L      +  +L +Y+ ++PG+YD LL WPF   +  S+L+QS P+ +    I  +T   +P W+       QK C  + +   S       GYP +F+ +++I  +  +  N  F+  +I I
Sbjct:  289 RQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHIT-ETFNPDPNWKN-----FQKPCSTRNSLDESTLG---FGYP-KFISHEEIKKRNYIRDNCIFIKASIEI 464          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 52.7582 bits (125), Expect = 5.721e-8
Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 3
Query:  138 ILNTKVFKLSPYGYKMAAQAKLDSG------YLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKP 383
             L++  F     GYKMA +A L+        +L +YV+L+PG +D LL WPF+  + +S+L+QS    + +    P       C+ +P
Sbjct:  451 CLSSVPFHTGRCGYKMAMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQSGARNHQSFNFRPDPTN--TCFHQP 536          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000028762.1 (SMESG000028762.1)

HSP 1 Score: 346.28 bits (887), Expect = 2.111e-123
Identity = 168/170 (98.82%), Postives = 169/170 (99.41%), Query Frame = 3
Query:   12 MRNNVSLTMNNYFRKELFDSDNNFYIWTISGVKTLIYNDYKEILNTKVFKLSPYGYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN 521
            MRNNVSLTMNNYFRKELFDSDNNFYIWTISGVKTLIYND+KEILNTKVFKLSPYGYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCW KPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN
Sbjct:    1 MRNNVSLTMNNYFRKELFDSDNNFYIWTISGVKTLIYNDFKEILNTKVFKLSPYGYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWHKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLKN 170          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 62.003 bits (149), Expect = 3.556e-11
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 3
Query:   66 DSDNNFYIWTISGVKTLIYNDYKE---ILNTKVFKLSPYGYKMAAQA-----KLDSG-YLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTI--DPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKF 506
            D  N  +IW I  +K+ I N  +     + +  F  S +GYK+  +       L  G +L ++  L+ G+YD LL WPF   + +SLL+Q     +++ T   DPK+    PC+Q+PIL+ +     + +  P   +  +   + S + +ND IY+K 
Sbjct:  292 DFRNGSFIWKIKDLKSQIQNAERSERLSITSDPFYTSEFGYKLCLRVYPSGDGLGKGTHLSVFFALMKGEYDDLLPWPFRQKLTLSLLDQENFTKHYSDTFKPDPKS----PCFQRPILDSN-----IASGSP-KFYSISHLSFNSIYYKNDTIYIKI 439          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000020135.1 (SMESG000020135.1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.432e-10
Identity = 43/127 (33.86%), Postives = 59/127 (46.46%), Query Frame = 3
Query:  156 FKLSPYGYKMAAQ------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSK--PNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            F    YGYKM  Q      A+  + YL +++ L+    D +L WPF N    SL+NQ    P++  T T D   M  E C  KPIL     G G      L     N      ++ RNDQI++KF++
Sbjct:  322 FYTHQYGYKMCLQLFPNGNAEYANNYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQRTRLPHSRSTTTYDNFQM--EKCLDKPILE-RNVGYGYLDFMDLKELFNN-----DDWTRNDQIFIKFKV 440          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000020135.1 (SMESG000020135.1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.496e-10
Identity = 43/127 (33.86%), Postives = 59/127 (46.46%), Query Frame = 3
Query:  156 FKLSPYGYKMAAQ------AKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSK--PNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFEL 512
            F    YGYKM  Q      A+  + YL +++ L+    D +L WPF N    SL+NQ    P++  T T D   M  E C  KPIL     G G      L     N      ++ RNDQI++KF++
Sbjct:  310 FYTHQYGYKMCLQLFPNGNAEYANNYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQRTRLPHSRSTTTYDNFQM--EKCLDKPILE-RNVGYGYLDFMDLKELFNN-----DDWTRNDQIFIKFKV 428          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000049767.1 (SMESG000049767.1)

HSP 1 Score: 57.7658 bits (138), Expect = 8.848e-10
Identity = 30/103 (29.13%), Postives = 54/103 (52.43%), Query Frame = 3
Query:   81 FYIWTISGVKTLIYNDYKEILNTKVFKLSPYGYKM--AAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPCWQKP 383
            F+ W I  +     N   E++ +K F   P+GYKM  A   + D G +G+Y  L+ G +D  L+WPF+  + + +++ +  N  H+ ++      D+  W+KP
Sbjct:  433 FFEWEIDKISEQRRN---ELIYSKPFYFRPFGYKMCLAVIFRGDYGDIGVYFYLMRGDFDNNLDWPFKYSVAVDVIDSANGNIIHSESVKYSDCPDDAEWRKP 532          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF62.492e-724.05TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF62.492e-724.05TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF51.363e-628.13TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF51.363e-628.13TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF51.363e-628.13TNF receptor associated factor 5 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trf-16.732e-935.58TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf43.094e-728.13gene:FBgn0026319 transcript:FBtr0334401[more]
Traf43.896e-728.13gene:FBgn0026319 transcript:FBtr0077429[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a1.290e-827.42tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a1.290e-827.42tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf2b4.087e-726.55Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b4.373e-726.55Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b4.373e-726.55Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sytl25.118e-926.87synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
egf1.055e-825.00epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf67.832e-824.05TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf15.286e-726.67TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf15.286e-726.67TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf15.286e-726.67TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf47.103e-731.20TNF receptor associated factor 4 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3MV19|TRF6A_XENLA2.351e-826.14TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
sp|Q28DL4|TRAF6_XENTR5.537e-825.00TNF receptor-associated factor 6 OS=Xenopus tropic... [more]
sp|Q6DJN2|TRF6B_XENLA1.324e-725.45TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|B6CJY5|TRAF6_MACMU2.994e-724.68TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
sp|B6CJY4|TRAF6_CERAT2.994e-724.68TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448XSQ01.093e-1233.05MATH domain-containing protein OS=Protopolystoma x... [more]
A0A158R8291.824e-1133.11Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068Y7B93.333e-1133.12TNF receptor associated factor 4 OS=Echinococcus m... [more]
A0A3P7L8423.374e-1130.25MATH domain-containing protein OS=Dibothriocephalu... [more]
A0A068WMW73.491e-1133.12TNF receptor associated factor 4 OS=Echinococcus g... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf61.337e-924.47TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.382e-924.47TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.382e-924.47TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf4a3.952e-827.42TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4b3.389e-731.31TNF receptor-associated factor 4-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002130.14.888e-1035.44pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.11.553e-825.41pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302761.676e-1030.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316927.455e-1030.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316901.555e-926.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361811.456e-832.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483942.380e-829.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
traf4a4.424e-926.88TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a4.490e-926.88TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a4.632e-926.88TNF receptor associated factor 4 [Source:NCBI gene... [more]
ENSORLT00000001369.25.721e-831.82TNF receptor-associated factor 5 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028762.12.111e-12398.82SMESG000028762.1[more]
SMESG000027123.13.556e-1129.11SMESG000027123.1[more]
SMESG000020135.12.432e-1033.86SMESG000020135.1[more]
SMESG000020135.12.496e-1033.86SMESG000020135.1[more]
SMESG000049767.18.848e-1029.13SMESG000049767.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024037 ID=SMED30024037|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=622bp
GTTGAATACTTATGAGAAATAACGTTTCACTTACAATGAATAATTACTTT
CGCAAAGAATTGTTTGATTCCGACAATAACTTCTATATTTGGACGATTTC
CGGCGTTAAAACTCTAATCTACAACGACTATAAAGAAATATTAAACACTA
AAGTGTTCAAGTTGTCGCCATATGGATACAAAATGGCTGCTCAAGCCAAA
TTGGATTCGGGATATTTAGGGATATATGTGATCCTTGTACCAGGAAAATA
TGACAAACTCTTGAATTGGCCTTTTGAGAATCCCATTCAGATTTCGTTAC
TAAACCAATCAAAGCCTAACGCTAATCATACGGTCACAATAGATCCGAAA
ACCATGAAAGATGAACCCTGTTGGCAAAAACCAATTTTGAATGTACATCA
AAAAGGTTGCGGATTAAAAACAGCATTTCCACTAAGCATATTCAAGAAAA
ACCAAAACGGATATCCGTCTGAATTCCTTAGAAATGATCAAATTTATTTA
AAATTTGAGTTGCTGAAAAACTAAACTTTTCTTTCAAGAAATATTTCGAT
ATGAGAAAACTATTATCAGTAATATTTATTAGAGAAAATTAATTTATTAA
AATATATTTATTGAAATAAAAT
back to top

protein sequence of SMED30024037-orf-1

>SMED30024037-orf-1 ID=SMED30024037-orf-1|Name=SMED30024037-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MRNNVSLTMNNYFRKELFDSDNNFYIWTISGVKTLIYNDYKEILNTKVFK
LSPYGYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQS
KPNANHTVTIDPKTMKDEPCWQKPILNVHQKGCGLKTAFPLSIFKKNQNG
YPSEFLRNDQIYLKFELLKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0007165signal transduction
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0016567protein ubiquitination
GO:0046330positive regulation of JNK cascade
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 6..169
e-value: 9.3E-26
score: 92.5
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 22..167
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 21..166
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 21..166
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 22..167
score: 10.317