SMED30024032

Overview
NameSMED30024032
Smed IDSMED30024032
Length (bp)393
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024032 (SMED30024032) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024032 (SMED30024032) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024032

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024032 SmedASXL_018855SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30024032 dd_Smed_v4_622_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024032 dd_Smed_v4_622_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024032 dd_Smed_v4_622_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30024032 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000327:147199..147591 +1947
Homology
BLAST of SMED30024032 vs. Ensembl Human
Match: SNRPG (small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:HGNC:11163])

HSP 1 Score: 76.6406 bits (187), Expect = 4.518e-19
Identity = 38/81 (46.91%), Postives = 55/81 (67.90%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V++  VE+    Q+ NIG +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. Ensembl Human
Match: SNRPG (small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:HGNC:11163])

HSP 1 Score: 76.2554 bits (186), Expect = 5.987e-19
Identity = 38/80 (47.50%), Postives = 54/80 (67.50%), Query Frame = -2
Query:   48 YMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 287
            +MDK+++               +KLNG R V+GI+RGFDPFMN+V++  VE+    Q+ NIG +VIRGNSI +LEA++RV
Sbjct:    4 FMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 68          
BLAST of SMED30024032 vs. Ensembl Human
Match: SNRPG (small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:HGNC:11163])

HSP 1 Score: 75.8702 bits (185), Expect = 8.537e-19
Identity = 35/58 (60.34%), Postives = 47/58 (81.03%), Query Frame = -2
Query:   48 VKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 221
            +KLNG R V+GI+RGFDPFMN+V++  VE+    Q+ NIG +VIRGNSI +LEA++RV
Sbjct:    7 LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 64          
BLAST of SMED30024032 vs. Ensembl Human
Match: SNRPG (small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:HGNC:11163])

HSP 1 Score: 75.8702 bits (185), Expect = 8.537e-19
Identity = 35/58 (60.34%), Postives = 47/58 (81.03%), Query Frame = -2
Query:   48 VKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 221
            +KLNG R V+GI+RGFDPFMN+V++  VE+    Q+ NIG +VIRGNSI +LEA++RV
Sbjct:    7 LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 64          
BLAST of SMED30024032 vs. Ensembl Human
Match: SNRPG (small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:HGNC:11163])

HSP 1 Score: 75.8702 bits (185), Expect = 8.537e-19
Identity = 35/58 (60.34%), Postives = 47/58 (81.03%), Query Frame = -2
Query:   48 VKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 221
            +KLNG R V+GI+RGFDPFMN+V++  VE+    Q+ NIG +VIRGNSI +LEA++RV
Sbjct:    7 LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 64          
BLAST of SMED30024032 vs. Ensembl Celegans
Match: snr-7 (Probable small nuclear ribonucleoprotein G [Source:UniProtKB/Swiss-Prot;Acc:Q9N4G9])

HSP 1 Score: 78.1814 bits (191), Expect = 4.853e-20
Identity = 40/81 (49.38%), Postives = 52/81 (64.20%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDK M                +KLNG+RRV GI+RGFDPFMN+V++ AVE  KD   VN+G  VIRGNS+ I+E  +R+
Sbjct:   11 KYMDKEMD---------------LKLNGNRRVSGILRGFDPFMNMVIDEAVEYQKDGGSVNLGMTVIRGNSVVIMEPKERI 76          
BLAST of SMED30024032 vs. Ensembl Fly
Match: SNRPG (gene:FBgn0261791 transcript:FBtr0112993)

HSP 1 Score: 82.8037 bits (203), Expect = 8.692e-22
Identity = 44/81 (54.32%), Postives = 56/81 (69.14%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDKRM               ++KLNG R V GI+RGFDPFMN+VL++ VE  KDN + NIG +VIRGNSI ++EA+DRV
Sbjct:   11 KYMDKRM---------------MLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGNSIVMVEALDRV 76          
BLAST of SMED30024032 vs. Ensembl Fly
Match: SNRPG (gene:FBgn0261791 transcript:FBtr0074377)

HSP 1 Score: 82.8037 bits (203), Expect = 8.692e-22
Identity = 44/81 (54.32%), Postives = 56/81 (69.14%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDKRM               ++KLNG R V GI+RGFDPFMN+VL++ VE  KDN + NIG +VIRGNSI ++EA+DRV
Sbjct:   11 KYMDKRM---------------MLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGNSIVMVEALDRV 76          
BLAST of SMED30024032 vs. Ensembl Fly
Match: LSm7 (gene:FBgn0261068 transcript:FBtr0343770)

HSP 1 Score: 42.743 bits (99), Expect = 6.193e-6
Identity = 23/69 (33.33%), Postives = 38/69 (55.07%), Query Frame = -2
Query:   48 IIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEV---------NIGTIVIRGNSISILEAVDRV 227
            I VK  G R   GI++G+D  +N+VL+N VE  +D+ E          ++G +V RG ++ ++   D V
Sbjct:   32 IRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLICPQDGV 100          
BLAST of SMED30024032 vs. Ensembl Fly
Match: LSm7 (gene:FBgn0261068 transcript:FBtr0080934)

HSP 1 Score: 42.743 bits (99), Expect = 6.193e-6
Identity = 23/69 (33.33%), Postives = 38/69 (55.07%), Query Frame = -2
Query:   48 IIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEV---------NIGTIVIRGNSISILEAVDRV 227
            I VK  G R   GI++G+D  +N+VL+N VE  +D+ E          ++G +V RG ++ ++   D V
Sbjct:   32 IRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLICPQDGV 100          
BLAST of SMED30024032 vs. Ensembl Fly
Match: LSm7 (gene:FBgn0261068 transcript:FBtr0308804)

HSP 1 Score: 42.743 bits (99), Expect = 6.193e-6
Identity = 23/69 (33.33%), Postives = 38/69 (55.07%), Query Frame = -2
Query:   48 IIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEV---------NIGTIVIRGNSISILEAVDRV 227
            I VK  G R   GI++G+D  +N+VL+N VE  +D+ E          ++G +V RG ++ ++   D V
Sbjct:   32 IRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLICPQDGV 100          
BLAST of SMED30024032 vs. Ensembl Zebrafish
Match: snrpg (small nuclear ribonucleoprotein polypeptide G [Source:ZFIN;Acc:ZDB-GENE-040912-105])

HSP 1 Score: 72.0182 bits (175), Expect = 1.844e-17
Identity = 36/81 (44.44%), Postives = 54/81 (66.67%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V+++ +E+    Q   IG +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVVDDTIEMAPGGQMNTIGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. Ensembl Zebrafish
Match: lsm7 (LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:ZFIN;Acc:ZDB-GENE-030131-8284])

HSP 1 Score: 45.4394 bits (106), Expect = 7.497e-7
Identity = 23/68 (33.82%), Postives = 37/68 (54.41%), Query Frame = -2
Query:   54 NYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEI--DKDNQ------EVNIGTIVIRGNSISILEAVD 233
             +I VK  G R   G+++GFDP +N+VL+  +E   D D+Q         +G +V RG S+ ++   D
Sbjct:   21 KHIRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQD 88          
BLAST of SMED30024032 vs. Ensembl Xenopus
Match: snrpg (small nuclear ribonucleoprotein polypeptide G [Source:NCBI gene;Acc:100125174])

HSP 1 Score: 72.4034 bits (176), Expect = 2.209e-17
Identity = 36/81 (44.44%), Postives = 52/81 (64.20%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V++   EI     +  IG +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVIDECTEISGGGHQNTIGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. Ensembl Xenopus
Match: lsm7 (LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:NCBI gene;Acc:100127774])

HSP 1 Score: 44.669 bits (104), Expect = 2.030e-6
Identity = 27/86 (31.40%), Postives = 42/86 (48.84%), Query Frame = -2
Query:   54 DKRMTRKYIFI*YKTY--NYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEI--DKDNQ------EVNIGTIVIRGNSISILEAVD 281
            DK   +K   +    Y    I VK  G R   G+++GFDP +N+VL+  +E   D D+Q         +G +V RG S+ ++   D
Sbjct:    3 DKEKKKKESILDLSKYIDKAIRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQD 88          
BLAST of SMED30024032 vs. Ensembl Xenopus
Match: lsm7 (LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:NCBI gene;Acc:100127774])

HSP 1 Score: 44.669 bits (104), Expect = 2.185e-6
Identity = 23/66 (34.85%), Postives = 36/66 (54.55%), Query Frame = -2
Query:   54 IIVKLNGHRRVKGIMRGFDPFMNIVLENAVEI--DKDNQ------EVNIGTIVIRGNSISILEAVD 227
            I VK  G R   G+++GFDP +N+VL+  +E   D D+Q         +G +V RG S+ ++   D
Sbjct:   23 IRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQD 88          
BLAST of SMED30024032 vs. Ensembl Xenopus
Match: nxph4 (neurexophilin 4 [Source:Xenbase;Acc:XB-GENE-993146])

HSP 1 Score: 43.5134 bits (101), Expect = 4.928e-6
Identity = 27/81 (33.33%), Postives = 50/81 (61.73%), Query Frame = -2
Query:   57 IFRYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEID-KDNQEVNIGTIVIRGNSISILEAV 296
            IFRY+  R +R  +++ Y+  N          R++G + GFD +MN+VL++A EI  K      +G I+++G++I++L++V
Sbjct:   21 IFRYLQNR-SRIQVWL-YEQVNM---------RIEGCIIGFDEYMNLVLDDAEEIHLKTKSRKQLGRIMLKGDNITLLQSV 90          
BLAST of SMED30024032 vs. Ensembl Mouse
Match: Snrpg (small nuclear ribonucleoprotein polypeptide G [Source:MGI Symbol;Acc:MGI:1915261])

HSP 1 Score: 76.6406 bits (187), Expect = 3.102e-19
Identity = 38/81 (46.91%), Postives = 55/81 (67.90%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V++  VE+    Q+ NIG +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. Ensembl Mouse
Match: Lsm7 (LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:MGI Symbol;Acc:MGI:1913344])

HSP 1 Score: 44.669 bits (104), Expect = 1.489e-6
Identity = 24/66 (36.36%), Postives = 36/66 (54.55%), Query Frame = -2
Query:   54 IIVKLNGHRRVKGIMRGFDPFMNIVLENAVEI--DKDNQ------EVNIGTIVIRGNSISILEAVD 227
            I VK  G R   GI++GFDP +N+VL+  +E   D D+Q         +G +V RG S+ ++   D
Sbjct:   23 IRVKFQGGREASGILKGFDPLLNLVLDGTMEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQD 88          
BLAST of SMED30024032 vs. Ensembl Mouse
Match: Snrpe (small nuclear ribonucleoprotein E [Source:MGI Symbol;Acc:MGI:98346])

HSP 1 Score: 43.8986 bits (102), Expect = 2.299e-6
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = -2
Query:   54 IFRYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEI-DKDNQEVNIGTIVIRGNSISILEAVD 296
            IFRY+  R +R  +++ Y+  N          R++G + GFD +MN+VL++A EI  K      +G I+++G++I++L++V 
Sbjct:   21 IFRYLQNR-SRIQVWL-YEQVNM---------RIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVS 91          
BLAST of SMED30024032 vs. UniProt/SwissProt
Match: sp|Q9VXE0|RUXG_DROME (Probable small nuclear ribonucleoprotein G OS=Drosophila melanogaster OX=7227 GN=SNRPG PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 8.713e-21
Identity = 44/81 (54.32%), Postives = 56/81 (69.14%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDKRM               ++KLNG R V GI+RGFDPFMN+VL++ VE  KDN + NIG +VIRGNSI ++EA+DRV
Sbjct:   11 KYMDKRM---------------MLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGNSIVMVEALDRV 76          
BLAST of SMED30024032 vs. UniProt/SwissProt
Match: sp|Q9N4G9|RUXG_CAEEL (Probable small nuclear ribonucleoprotein G OS=Caenorhabditis elegans OX=6239 GN=snr-7 PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.173e-19
Identity = 40/81 (49.38%), Postives = 52/81 (64.20%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDK M                +KLNG+RRV GI+RGFDPFMN+V++ AVE  KD   VN+G  VIRGNS+ I+E  +R+
Sbjct:   11 KYMDKEMD---------------LKLNGNRRVSGILRGFDPFMNMVIDEAVEYQKDGGSVNLGMTVIRGNSVVIMEPKERI 76          
BLAST of SMED30024032 vs. UniProt/SwissProt
Match: sp|P62309|RUXG_MOUSE (Small nuclear ribonucleoprotein G OS=Mus musculus OX=10090 GN=Snrpg PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.170e-18
Identity = 38/81 (46.91%), Postives = 55/81 (67.90%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V++  VE+    Q+ NIG +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. UniProt/SwissProt
Match: sp|P62308|RUXG_HUMAN (Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.170e-18
Identity = 38/81 (46.91%), Postives = 55/81 (67.90%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V++  VE+    Q+ NIG +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. UniProt/SwissProt
Match: sp|Q3ZBL0|RUXG_BOVIN (Small nuclear ribonucleoprotein G OS=Bos taurus OX=9913 GN=SNRPG PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.170e-18
Identity = 38/81 (46.91%), Postives = 55/81 (67.90%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V++  VE+    Q+ NIG +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. TrEMBL
Match: A0A132AEA1 (Small nuclear ribonucleoprotein G OS=Sarcoptes scabiei OX=52283 GN=QR98_0074000 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.162e-20
Identity = 41/81 (50.62%), Postives = 60/81 (74.07%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDKR++               +KLNG+R++ GI+RGFDPFMN+V++ AVEI+K NQ+V IG +V+RGNS+ +LEA+DR+
Sbjct:   11 KYMDKRLS---------------LKLNGNRQISGILRGFDPFMNLVIDEAVEINKRNQQVPIGMVVVRGNSVVLLEALDRI 76          
BLAST of SMED30024032 vs. TrEMBL
Match: A0A1Y3AYC3 (Small nuclear ribonucleoprotein G OS=Euroglyphus maynei OX=6958 GN=BLA29_002598 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.471e-19
Identity = 40/81 (49.38%), Postives = 60/81 (74.07%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDKR++               +KLNG+R+V GI+RGFDPFMN+V++ AVEI+K NQ++ IG +VIRGN++ +LE++DR+
Sbjct:   11 KYMDKRLS---------------LKLNGNRQVSGILRGFDPFMNLVIDEAVEINKRNQQIPIGMVVIRGNAVVLLESLDRI 76          
BLAST of SMED30024032 vs. TrEMBL
Match: A0A195FGJ9 (Small nuclear ribonucleoprotein G OS=Trachymyrmex septentrionalis OX=34720 GN=ALC56_05999 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.219e-18
Identity = 42/82 (51.22%), Postives = 57/82 (69.51%), Query Frame = -2
Query:   48 FRYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 293
            FRYMDKR++               +KLNG RRV GI+RGFDPFMN+V++ ++E  KD  + NIG +VIRGNS+ +LEA+DR+
Sbjct:   29 FRYMDKRLS---------------LKLNGGRRVVGILRGFDPFMNMVIDESIEECKDGTKNNIGMVVIRGNSVIMLEALDRI 95          
BLAST of SMED30024032 vs. TrEMBL
Match: B3MRC4 (Small nuclear ribonucleoprotein G OS=Drosophila ananassae OX=7217 GN=Dana\GF21254 PE=3 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 2.554e-18
Identity = 44/81 (54.32%), Postives = 56/81 (69.14%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDKRM               ++KLNG R V GI+RGFDPFMN+VL++ VE  KDN + NIG +VIRGNSI ++EA+DRV
Sbjct:   11 KYMDKRM---------------MLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGNSIVMVEALDRV 76          
BLAST of SMED30024032 vs. TrEMBL
Match: B3NVJ9 (Small nuclear ribonucleoprotein G OS=Drosophila erecta OX=7220 GN=Dere\GG18240 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.554e-18
Identity = 44/81 (54.32%), Postives = 56/81 (69.14%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDKRM               ++KLNG R V GI+RGFDPFMN+VL++ VE  KDN + NIG +VIRGNSI ++EA+DRV
Sbjct:   11 KYMDKRM---------------MLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGNSIVMVEALDRV 76          
BLAST of SMED30024032 vs. Ensembl Cavefish
Match: snrpg (small nuclear ribonucleoprotein polypeptide G [Source:NCBI gene;Acc:107196920])

HSP 1 Score: 74.3294 bits (181), Expect = 2.414e-18
Identity = 36/81 (44.44%), Postives = 55/81 (67.90%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V+++ +E+    Q+  IG +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVVDDCLEMSPGGQQNTIGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. Ensembl Cavefish
Match: snrpg (small nuclear ribonucleoprotein polypeptide G [Source:NCBI gene;Acc:107196920])

HSP 1 Score: 53.9138 bits (128), Expect = 1.994e-10
Identity = 25/66 (37.88%), Postives = 41/66 (62.12%), Query Frame = -2
Query:   93 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V+++ +E+    Q+  IG +V
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVVDDCLEMSPGGQQNTIGMVV 61          
BLAST of SMED30024032 vs. Ensembl Cavefish
Match: lsm7 (LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:NCBI gene;Acc:103032086])

HSP 1 Score: 43.5134 bits (101), Expect = 3.139e-6
Identity = 22/66 (33.33%), Postives = 36/66 (54.55%), Query Frame = -2
Query:   54 IIVKLNGHRRVKGIMRGFDPFMNIVLENAVEI--DKDNQ------EVNIGTIVIRGNSISILEAVD 227
            I VK  G R   G+++GFDP +N+VL+  +E   D D+Q         +G +V RG ++ ++   D
Sbjct:   23 IRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTAVVLICPQD 88          
BLAST of SMED30024032 vs. Ensembl Cavefish
Match: ENSAMXT00000047812.1 (small nuclear ribonucleoprotein E [Source:NCBI gene;Acc:103041055])

HSP 1 Score: 42.3578 bits (98), Expect = 7.713e-6
Identity = 26/82 (31.71%), Postives = 50/82 (60.98%), Query Frame = -2
Query:   54 IFRYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEID-KDNQEVNIGTIVIRGNSISILEAVD 296
            IFRY+  R +R  +++ Y+  N          R++G + GFD +MN+VL++A E+  K      +G I+++G++I++L++V 
Sbjct:   21 IFRYLQNR-SRISVWL-YEQVNM---------RIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKTLGRIMLKGDNITLLQSVS 91          
BLAST of SMED30024032 vs. Ensembl Cavefish
Match: ENSAMXT00000034753.1 (small nuclear ribonucleoprotein E [Source:NCBI gene;Acc:103041055])

HSP 1 Score: 42.3578 bits (98), Expect = 7.713e-6
Identity = 26/82 (31.71%), Postives = 50/82 (60.98%), Query Frame = -2
Query:   54 IFRYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEID-KDNQEVNIGTIVIRGNSISILEAVD 296
            IFRY+  R +R  +++ Y+  N          R++G + GFD +MN+VL++A E+  K      +G I+++G++I++L++V 
Sbjct:   21 IFRYLQNR-SRISVWL-YEQVNM---------RIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKTLGRIMLKGDNITLLQSVS 91          
BLAST of SMED30024032 vs. Ensembl Sea Lamprey
Match: snrpg (small nuclear ribonucleoprotein polypeptide G [Source:ZFIN;Acc:ZDB-GENE-040912-105])

HSP 1 Score: 69.707 bits (169), Expect = 2.386e-17
Identity = 34/81 (41.98%), Postives = 53/81 (65.43%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V GI+RGFDPFMN+V++   E+ +   + ++G +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGSRTVTGILRGFDPFMNLVMDECFELCQGGVQNDVGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. Ensembl Yeast
Match: SMX2 (Core Sm protein Sm G; part of heteroheptameric complex (with Smb1p, Smd1p, Smd2p, Smd3p, Sme1p, and Smx3p) that is part of the spliceosomal U1, U2, U4, and U5 snRNPs; homolog of human Sm G [Source:SGD;Acc:S000002965])

HSP 1 Score: 58.151 bits (139), Expect = 6.061e-13
Identity = 34/85 (40.00%), Postives = 54/85 (63.53%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEID----KDNQEVNIGTIVIRGNSISILEAVDRV 290
            +YMDK+               I++ +NG R+V GI+RG+D F+N+VL++A+EI+     +N ++ + T VIRGNSI  LEA+D +
Sbjct:    9 KYMDKK---------------ILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQT-VIRGNSIISLEALDAI 77          
BLAST of SMED30024032 vs. Ensembl Yeast
Match: LSM5 (Lsm (Like Sm) protein; part of heteroheptameric complexes (Lsm2p-7p and either Lsm1p or 8p): cytoplasmic Lsm1p complex involved in mRNA decay; nuclear Lsm8p complex part of U6 snRNP and possibly involved in processing tRNA, snoRNA, and rRNA [Source:SGD;Acc:S000000948])

HSP 1 Score: 40.4318 bits (93), Expect = 4.710e-6
Identity = 25/68 (36.76%), Postives = 43/68 (63.24%), Query Frame = -2
Query:   66 KTYNY-IIVKLNGHRRVKGIMRGFDPFMNIVLENAVE--IDKDNQEVNI------GTIVIRGNSISIL 242
            KT N  +++ L  +R  +G + GFD F+N++LE+AVE  ID +++  N       G +++ GN+I+IL
Sbjct:   14 KTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAIL 81          
BLAST of SMED30024032 vs. Ensembl Nematostella
Match: EDO48813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RII4])

HSP 1 Score: 75.485 bits (184), Expect = 2.954e-19
Identity = 38/82 (46.34%), Postives = 54/82 (65.85%), Query Frame = -2
Query:   45 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRVF 290
            +YMDK+++               +KLNG R V G++RG+DPFMN+VL++AVE    N++  IG +VIRGNSI  +EA+DRV 
Sbjct:   11 KYMDKKLS---------------LKLNGGRHVSGVLRGYDPFMNLVLDDAVENVSGNEKHAIGMVVIRGNSIVTMEALDRVL 77          
BLAST of SMED30024032 vs. Ensembl Nematostella
Match: EDO41002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M5])

HSP 1 Score: 43.1282 bits (100), Expect = 1.692e-6
Identity = 24/84 (28.57%), Postives = 45/84 (53.57%), Query Frame = -2
Query:   54 KRMTRKYIFI*YKTYNY-IIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKD--------NQEVNIGTIVIRGNSISILEAVD 278
            +R  +K IF   K  +  + VK  G R   G+++GFD  +N+VL+N +E  +D        ++   +G +V RG ++ ++  +D
Sbjct:    5 ERKEKKSIFDLSKFLDKGVRVKFQGGREASGVLKGFDALLNLVLDNTIEYLRDPDDPLKLSDETRQLGLVVCRGTAVVLVCPMD 88          
BLAST of SMED30024032 vs. Ensembl Medaka
Match: snrpg (small nuclear ribonucleoprotein polypeptide G [Source:NCBI gene;Acc:101154947])

HSP 1 Score: 74.3294 bits (181), Expect = 1.994e-18
Identity = 36/81 (44.44%), Postives = 55/81 (67.90%), Query Frame = -2
Query:   48 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRV 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V+++ +E+    Q+  IG +VIRGNSI +LEA++RV
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVMDDCLEMGPGGQQNTIGMVVIRGNSIIMLEALERV 76          
BLAST of SMED30024032 vs. Ensembl Medaka
Match: snrpg (small nuclear ribonucleoprotein polypeptide G [Source:NCBI gene;Acc:101154947])

HSP 1 Score: 51.9878 bits (123), Expect = 2.097e-9
Identity = 24/65 (36.92%), Postives = 40/65 (61.54%), Query Frame = -2
Query:   96 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTI 290
            ++MDK+++               +KLNG R V+GI+RGFDPFMN+V+++ +E+    Q+  IG +
Sbjct:   11 KFMDKKLS---------------LKLNGGRHVQGILRGFDPFMNLVMDDCLEMGPGGQQNTIGMV 60          
BLAST of SMED30024032 vs. Ensembl Medaka
Match: lsm7 (LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:NCBI gene;Acc:101175386])

HSP 1 Score: 44.669 bits (104), Expect = 1.238e-6
Identity = 23/66 (34.85%), Postives = 36/66 (54.55%), Query Frame = -2
Query:   54 IIVKLNGHRRVKGIMRGFDPFMNIVLENAVEI--DKDNQ------EVNIGTIVIRGNSISILEAVD 227
            I VK  G R   G+++GFDP +N+VL+  +E   D D+Q         +G +V RG S+ ++   D
Sbjct:   23 IRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQLKLTEDTRQLGLVVCRGTSVVLICPQD 88          
BLAST of SMED30024032 vs. Ensembl Medaka
Match: lsm7 (LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:NCBI gene;Acc:101175386])

HSP 1 Score: 44.669 bits (104), Expect = 1.678e-6
Identity = 23/66 (34.85%), Postives = 36/66 (54.55%), Query Frame = -2
Query:   54 IIVKLNGHRRVKGIMRGFDPFMNIVLENAVEI--DKDNQ------EVNIGTIVIRGNSISILEAVD 227
            I VK  G R   G+++GFDP +N+VL+  +E   D D+Q         +G +V RG S+ ++   D
Sbjct:   44 IRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQLKLTEDTRQLGLVVCRGTSVVLICPQD 109          
BLAST of SMED30024032 vs. Planmine SMEST
Match: SMESG000081731.1 (SMESG000081731.1)

HSP 1 Score: 123.25 bits (308), Expect = 7.616e-38
Identity = 65/82 (79.27%), Postives = 67/82 (81.71%), Query Frame = -2
Query:   45 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRVF 290
            +YMDKRMT               +KLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRVF
Sbjct:   11 KYMDKRMT---------------LKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRVF 77          
BLAST of SMED30024032 vs. Planmine SMEST
Match: SMESG000081727.1 (SMESG000081727.1)

HSP 1 Score: 123.25 bits (308), Expect = 7.616e-38
Identity = 65/82 (79.27%), Postives = 67/82 (81.71%), Query Frame = -2
Query:   45 RYMDKRMTRKYIFI*YKTYNYIIVKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRVF 290
            +YMDKRMT               +KLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRVF
Sbjct:   11 KYMDKRMT---------------LKLNGHRRVKGIMRGFDPFMNIVLENAVEIDKDNQEVNIGTIVIRGNSISILEAVDRVF 77          
BLAST of SMED30024032 vs. Planmine SMEST
Match: SMESG000036643.1 (SMESG000036643.1)

HSP 1 Score: 46.9802 bits (110), Expect = 9.230e-8
Identity = 21/50 (42.00%), Postives = 38/50 (76.00%), Query Frame = -2
Query:   54 RVKGIMRGFDPFMNIVLENAVEID-KDNQEVNIGTIVIRGNSISILEAVD 200
            R++GI+ GFD +MN+VL++AVE   K   E  IG I+++G++I+++++ D
Sbjct:   42 RIEGIILGFDEYMNVVLDDAVERHMKSGSEKKIGRIMLKGDAITLIQSCD 91          
The following BLAST results are available for this feature:
BLAST of SMED30024032 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNRPG4.518e-1946.91small nuclear ribonucleoprotein polypeptide G [Sou... [more]
SNRPG5.987e-1947.50small nuclear ribonucleoprotein polypeptide G [Sou... [more]
SNRPG8.537e-1960.34small nuclear ribonucleoprotein polypeptide G [Sou... [more]
SNRPG8.537e-1960.34small nuclear ribonucleoprotein polypeptide G [Sou... [more]
SNRPG8.537e-1960.34small nuclear ribonucleoprotein polypeptide G [Sou... [more]
back to top
BLAST of SMED30024032 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snr-74.853e-2049.38Probable small nuclear ribonucleoprotein G [Sourc... [more]
back to top
BLAST of SMED30024032 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNRPG8.692e-2254.32gene:FBgn0261791 transcript:FBtr0112993[more]
SNRPG8.692e-2254.32gene:FBgn0261791 transcript:FBtr0074377[more]
LSm76.193e-633.33gene:FBgn0261068 transcript:FBtr0343770[more]
LSm76.193e-633.33gene:FBgn0261068 transcript:FBtr0080934[more]
LSm76.193e-633.33gene:FBgn0261068 transcript:FBtr0308804[more]
back to top
BLAST of SMED30024032 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snrpg1.844e-1744.44small nuclear ribonucleoprotein polypeptide G [Sou... [more]
lsm77.497e-733.82LSM7 homolog, U6 small nuclear RNA and mRNA degrad... [more]
back to top
BLAST of SMED30024032 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
snrpg2.209e-1744.44small nuclear ribonucleoprotein polypeptide G [Sou... [more]
lsm72.030e-631.40LSM7 homolog, U6 small nuclear RNA and mRNA degrad... [more]
lsm72.185e-634.85LSM7 homolog, U6 small nuclear RNA and mRNA degrad... [more]
nxph44.928e-633.33neurexophilin 4 [Source:Xenbase;Acc:XB-GENE-993146... [more]
back to top
BLAST of SMED30024032 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Snrpg3.102e-1946.91small nuclear ribonucleoprotein polypeptide G [Sou... [more]
Lsm71.489e-636.36LSM7 homolog, U6 small nuclear RNA and mRNA degrad... [more]
Snrpe2.299e-632.93small nuclear ribonucleoprotein E [Source:MGI Symb... [more]
back to top
BLAST of SMED30024032 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VXE0|RUXG_DROME8.713e-2154.32Probable small nuclear ribonucleoprotein G OS=Dros... [more]
sp|Q9N4G9|RUXG_CAEEL6.173e-1949.38Probable small nuclear ribonucleoprotein G OS=Caen... [more]
sp|P62309|RUXG_MOUSE2.170e-1846.91Small nuclear ribonucleoprotein G OS=Mus musculus ... [more]
sp|P62308|RUXG_HUMAN2.170e-1846.91Small nuclear ribonucleoprotein G OS=Homo sapiens ... [more]
sp|Q3ZBL0|RUXG_BOVIN2.170e-1846.91Small nuclear ribonucleoprotein G OS=Bos taurus OX... [more]
back to top
BLAST of SMED30024032 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A132AEA13.162e-2050.62Small nuclear ribonucleoprotein G OS=Sarcoptes sca... [more]
A0A1Y3AYC31.471e-1949.38Small nuclear ribonucleoprotein G OS=Euroglyphus m... [more]
A0A195FGJ92.219e-1851.22Small nuclear ribonucleoprotein G OS=Trachymyrmex ... [more]
B3MRC42.554e-1854.32Small nuclear ribonucleoprotein G OS=Drosophila an... [more]
B3NVJ92.554e-1854.32Small nuclear ribonucleoprotein G OS=Drosophila er... [more]
back to top
BLAST of SMED30024032 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrpg2.414e-1844.44small nuclear ribonucleoprotein polypeptide G [Sou... [more]
snrpg1.994e-1037.88small nuclear ribonucleoprotein polypeptide G [Sou... [more]
lsm73.139e-633.33LSM7 homolog, U6 small nuclear RNA and mRNA degrad... [more]
ENSAMXT00000047812.17.713e-631.71small nuclear ribonucleoprotein E [Source:NCBI gen... [more]
ENSAMXT00000034753.17.713e-631.71small nuclear ribonucleoprotein E [Source:NCBI gen... [more]
back to top
BLAST of SMED30024032 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snrpg2.386e-1741.98small nuclear ribonucleoprotein polypeptide G [Sou... [more]
back to top
BLAST of SMED30024032 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SMX26.061e-1340.00Core Sm protein Sm G; part of heteroheptameric com... [more]
LSM54.710e-636.76Lsm (Like Sm) protein; part of heteroheptameric co... [more]
back to top
BLAST of SMED30024032 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO488132.954e-1946.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410021.692e-628.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30024032 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
snrpg1.994e-1844.44small nuclear ribonucleoprotein polypeptide G [Sou... [more]
snrpg2.097e-936.92small nuclear ribonucleoprotein polypeptide G [Sou... [more]
lsm71.238e-634.85LSM7 homolog, U6 small nuclear RNA and mRNA degrad... [more]
lsm71.678e-634.85LSM7 homolog, U6 small nuclear RNA and mRNA degrad... [more]
back to top
BLAST of SMED30024032 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000081731.17.616e-3879.27SMESG000081731.1[more]
SMESG000081727.17.616e-3879.27SMESG000081727.1[more]
SMESG000036643.19.230e-842.00SMESG000036643.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024032 ID=SMED30024032|Name=SMED30024032|organism=Schmidtea mediterranea sexual|type=transcript|length=393bp
TAATACAAATGAATAACTTTATTATTTGTAATATTTACACATTAGAAAAC
ACGATCAACAGCTTCAAGAATACTAATGCTGTTCCCTCTAATTACAATAG
TGCCGATATTTACTTCCTGATTATCTTTGTCAATCTCAACAGCATTTTCC
AAAACTATATTCATAAATGGATCGAATCCTCGCATAATACCTTTAACACG
ACGGTGGCCATTTAGTTTTACTATAATATAGTTATAAGTTTTATATCAAA
TAAAAATATACTTACGAGTCATTCTCTTATCCATGTATCTAAAAATATTT
ATTAATAATGAAGATTGAAACTATAGCTTACTTTTTCAGTTCAGGAGGAT
GGGCTCGATTCATTTTTAAGATTTGAAATAGTTAAAATTAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001163LSM_dom_euk/arc
IPR010920LSM_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001163LSM domain, eukaryotic/archaea-typeSMARTSM00651Sm3coord: 1..42
e-value: 0.0076
score: 22.5
IPR001163LSM domain, eukaryotic/archaea-typePFAMPF01423LSMcoord: 2..40
e-value: 2.9E-13
score: 49.3
NoneNo IPR availableGENE3DG3DSA:2.30.30.100coord: 1..47
e-value: 1.2E-14
score: 55.6
NoneNo IPR availablePANTHERPTHR10553:SF2SMALL NUCLEAR RIBONUCLEOPROTEIN Gcoord: 1..46
NoneNo IPR availablePANTHERPTHR10553SMALL NUCLEAR RIBONUCLEOPROTEINcoord: 1..46
IPR010920LSM domain superfamilySUPERFAMILYSSF50182Sm-like ribonucleoproteinscoord: 2..45