Regulating synaptic membrane exocytosis protein 2

Overview
NameRegulating synaptic membrane exocytosis protein 2
Smed IDSMED30024025
Length (bp)4475
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulating synaptic membrane exocytosis protein 2 (SMED30024025) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulating synaptic membrane exocytosis protein 2 (SMED30024025) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulating synaptic membrane exocytosis protein 2 (SMED30024025) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulating synaptic membrane exocytosis protein 2 (SMED30024025) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024025

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024025SMESG000037636.1 SMESG000037628.1 SmedASXL_017652SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30024025SMESG000037636.1 SMESG000037628.1 dd_Smed_v4_15437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024025SMESG000037636.1 SMESG000037628.1 dd_Smed_v6_15437_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30024025SMESG000037636.1 SMESG000037628.1 OX_Smed_1.0.09895ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 191.045 bits (484), Expect = 1.579e-53
Identity = 92/171 (53.80%), Postives = 123/171 (71.93%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct:  105 SDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 274          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 204.912 bits (520), Expect = 2.437e-52
Identity = 116/288 (40.28%), Postives = 165/288 (57.29%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR S+G K  +++ +SRKS S S L       KK R++ QRS E       ++ E  N +      +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1324 GKKRRSSLGAKMVAIVGLSRKSRSASQLSQTEAGGKKLRSTVQRSTET-----GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1581          

HSP 2 Score: 163.696 bits (413), Expect = 9.757e-40
Identity = 131/439 (29.84%), Postives = 203/439 (46.24%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRN---------NPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P K        K++Q S SSSE++L ++ E TS DD E+E                                               SE VS+  + +Y WL +   +         +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EWN +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+++ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  467 RKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKSKK---GGKMRQISLSSSEEELASTPEYTSCDDVEIE-----------------------------------------------SESVSEKGDMDYNWLDHTSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 855          

HSP 3 Score: 75.0998 bits (183), Expect = 1.076e-12
Identity = 44/136 (32.35%), Postives = 67/136 (49.26%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKT 742
            PDLSHL+E ER+II  V+ RQK+++ +   +L+   ++           + +  + K  E      +Q      C +C  TKFAD  G +C  C  K C+RCG  V +  N    + W C  C+K+    EIL K+
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKKLHQQ---------FEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK---VMWVCNLCRKQQ---EILTKS 147          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS1 (regulating synaptic membrane exocytosis 1 [Source:HGNC Symbol;Acc:HGNC:17282])

HSP 1 Score: 184.496 bits (467), Expect = 3.157e-52
Identity = 91/170 (53.53%), Postives = 117/170 (68.82%), Query Frame = 2
Query: 3857 DNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            D+Q   F++GLGP QLVGRQ L  P++G++Q+   DKKG+L++EVIRAR LT K  SK  P PYVK+YL++    I K+KT ++ R+TLDPLYQQ L F     GKVLQ  VWG+Y RMD K FMG  +ILL++LD SS+V GWYKL+   +   P     TRR S SS+
Sbjct:   40 DSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIA-RKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLTPLTRRASQSSL 208          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 201.83 bits (512), Expect = 1.555e-51
Identity = 116/289 (40.14%), Postives = 165/289 (57.09%), Query Frame = 2
Query: 3521 CGRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
             G+KRR S+G K  +++ +SRKS S S L       KK R++ QRS E       ++ E  N +      +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1098 SGKKRRSSLGAKMVAIVGLSRKSRSASQLSQTEAGGKKLRSTVQRSTET-----GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1356          

HSP 2 Score: 157.147 bits (396), Expect = 9.505e-38
Identity = 133/455 (29.23%), Postives = 206/455 (45.27%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRN---------NPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTE------------------SLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSST-----IQIRLFYNPIEMEFVVHLVSATNL------IPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P K        K++Q S SSSE++L ++ E TS DD E+E                                               SE VS+  + +Y WL +   +         +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EWN +  +G T +EV  II ESK E  +EL+V R I    +  +ST                   S+      + G      +F+       +L   +T     +QI+L+++ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  245 RKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKSKK---GGKMRQISLSSSEEELASTPEYTSCDDVEIE-----------------------------------------------SESVSEKGDMDYNWLDHTSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSSQSLSRRTTPFVPRVQIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 649          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 183.726 bits (465), Expect = 2.032e-51
Identity = 84/149 (56.38%), Postives = 113/149 (75.84%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLY 4300
            +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+
Sbjct:  105 SDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLF 252          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: unc-10 (Rab-3-interacting molecule unc-10 [Source:UniProtKB/Swiss-Prot;Acc:Q22366])

HSP 1 Score: 154.451 bits (389), Expect = 2.499e-37
Identity = 81/176 (46.02%), Postives = 111/176 (63.07%), Query Frame = 2
Query: 3851 LNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSS-IVFGWYKLY--SSIASELPHPAVQTRRLSTSSIG 4369
            L D  +G FV+ LGPGQ+VGRQVL  P LGE+Q++ +  +  +D+E+I+A+ L  K   KV P PYVK+YLM+GK  I K KT  +  +T  PL+QQ L F+     K LQ TV G+Y RM++K FMG  +I L+DL+  S  + GWYKL+  SS+A   P      R+ S  S+G
Sbjct: 1390 LADGPLGTFVDNLGPGQVVGRQVLASPVLGEIQIALMAGRSGIDVEIIKAKNLVVKPGVKVCPAPYVKVYLMEGKQCIAKAKTNAA-TKTTSPLFQQHLIFNDSPKKKTLQVTVLGDYGRMERKVFMGISQIRLEDLELGSQPLIGWYKLFHSSSLAGTGP-----VRKDSDVSVG 1559          

HSP 2 Score: 113.62 bits (283), Expect = 6.844e-25
Identity = 54/112 (48.21%), Postives = 77/112 (68.75%), Query Frame = 2
Query: 1844 NPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQR 2179
            +PVTW+PS D K+LIGHMIL +     +N +     LGLK+ GG+ T  G+  A+IT+VKP S+ADT+G L  GDEV+EWN +S +  T ++V + I+ S+ + S+ELIV R
Sbjct:  627 HPVTWQPSADQKKLIGHMILHRTENSAANGD-----LGLKIVGGRRTDTGKLGAFITQVKPGSVADTIGRLRPGDEVVEWNGQSLQNATYEQVYDSIAASRYDTSVELIVSR 733          

HSP 3 Score: 84.3445 bits (207), Expect = 5.630e-16
Identity = 52/138 (37.68%), Postives = 73/138 (52.90%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSR 748
            PDLSHLS  ER II +V +RQK ++ +  +I + K  E++ E+    T  ER    K      +G+Q      +C +CQ TKFAD  G  CF C  ++C+RCG   +    SK    W C  C+KR    +IL KT +
Sbjct:    8 PDLSHLSAEEREIIENVFKRQKDEEAKETQISQ-KASEELSELDKQIT--ER----KETSKKLVGTQDD---AICQICQKTKFADGIGHKCFYCQLRSCARCGGRAQ----SKNKAIWACSLCQKRQ---QILAKTGK 128          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: unc-10 (Rab-3-interacting molecule unc-10 [Source:UniProtKB/Swiss-Prot;Acc:Q22366])

HSP 1 Score: 114.39 bits (285), Expect = 4.186e-25
Identity = 54/112 (48.21%), Postives = 77/112 (68.75%), Query Frame = 2
Query: 1844 NPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQR 2179
            +PVTW+PS D K+LIGHMIL +     +N +     LGLK+ GG+ T  G+  A+IT+VKP S+ADT+G L  GDEV+EWN +S +  T ++V + I+ S+ + S+ELIV R
Sbjct:  627 HPVTWQPSADQKKLIGHMILHRTENSAANGD-----LGLKIVGGRRTDTGKLGAFITQVKPGSVADTIGRLRPGDEVVEWNGQSLQNATYEQVYDSIAASRYDTSVELIVSR 733          

HSP 2 Score: 84.3445 bits (207), Expect = 5.919e-16
Identity = 52/138 (37.68%), Postives = 73/138 (52.90%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSR 748
            PDLSHLS  ER II +V +RQK ++ +  +I + K  E++ E+    T  ER    K      +G+Q      +C +CQ TKFAD  G  CF C  ++C+RCG   +    SK    W C  C+KR    +IL KT +
Sbjct:    8 PDLSHLSAEEREIIENVFKRQKDEEAKETQISQ-KASEELSELDKQIT--ER----KETSKKLVGTQDD---AICQICQKTKFADGIGHKCFYCQLRSCARCGGRAQ----SKNKAIWACSLCQKRQ---QILAKTGK 128          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 60.8474 bits (146), Expect = 8.669e-9
Identity = 28/75 (37.33%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1952 LGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQ 2176
            LG++V GGK  + G+  AY++++   +   T+G +  GDEV+EWN    RG T +EV  I+++S   G IE++++
Sbjct:  895 LGVRVVGGKRQMNGELSAYVSQLHSTANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIVNKS--HGEIEMVIR 967          

HSP 2 Score: 52.373 bits (124), Expect = 2.851e-6
Identity = 39/133 (29.32%), Postives = 62/133 (46.62%), Query Frame = 2
Query: 3938 GELQLSF-IDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSF---SSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELP 4324
            G +Q+S   D   RL  ++IRARGL  +  S+  P P+VK+YL+ G+ +  K++T      +  P + Q L +       +   L+ TV  +Y R      +G  +I L D    +    WY L  S    +P
Sbjct: 1025 GHIQVSLGYDGNSRLVAKIIRARGLKSRDQSRSAPNPFVKVYLLPGRKVSHKRRTRFV-DSSCAPEWNQVLEYQVAPHTLNTMFLEFTVC-DYQRDVDDLPLGNVQIPLADKSAINTGPRWYPLQGSYDQPIP 1155          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 60.8474 bits (146), Expect = 8.669e-9
Identity = 28/75 (37.33%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1952 LGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQ 2176
            LG++V GGK  + G+  AY++++   +   T+G +  GDEV+EWN    RG T +EV  I+++S   G IE++++
Sbjct:  895 LGVRVVGGKRQMNGELSAYVSQLHSTANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIVNKS--HGEIEMVIR 967          

HSP 2 Score: 52.373 bits (124), Expect = 2.851e-6
Identity = 39/133 (29.32%), Postives = 62/133 (46.62%), Query Frame = 2
Query: 3938 GELQLSF-IDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSF---SSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELP 4324
            G +Q+S   D   RL  ++IRARGL  +  S+  P P+VK+YL+ G+ +  K++T      +  P + Q L +       +   L+ TV  +Y R      +G  +I L D    +    WY L  S    +P
Sbjct: 1025 GHIQVSLGYDGNSRLVAKIIRARGLKSRDQSRSAPNPFVKVYLLPGRKVSHKRRTRFV-DSSCAPEWNQVLEYQVAPHTLNTMFLEFTVC-DYQRDVDDLPLGNVQIPLADKSAINTGPRWYPLQGSYDQPIP 1155          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 60.077 bits (144), Expect = 1.713e-8
Identity = 28/75 (37.33%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1952 LGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQ 2176
            LG++V GGK  + G+  AY++++   +   T+G +  GDEV+EWN    RG T +EV  I+++S   G IE++++
Sbjct: 2306 LGVRVVGGKRQMNGELSAYVSQLHSTANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIVNKS--HGEIEMVIR 2378          

HSP 2 Score: 51.6026 bits (122), Expect = 5.644e-6
Identity = 42/136 (30.88%), Postives = 65/136 (47.79%), Query Frame = 2
Query: 3938 GELQLSF-IDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSF---SSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFG--WYKLYSSIASELPH 4327
            G +Q+S   D   RL  ++IRARGL  +  S+  P P+VK+YL+ G+ +  K++T      +  P + Q L +       +   L+ TV  +Y R      +G  +I L   D S+I  G  WY L  S    +P 
Sbjct: 2436 GHIQVSLGYDGNSRLVAKIIRARGLKSRDQSRSAPNPFVKVYLLPGRKVSHKRRTRFV-DSSCAPEWNQVLEYQVAPHTLNTMFLEFTVC-DYQRDVDDLPLGNVQIPL--ADKSAINTGPRWYPLQGSYDQPIPQ 2567          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336720)

HSP 1 Score: 206.838 bits (525), Expect = 3.360e-53
Identity = 101/173 (58.38%), Postives = 130/173 (75.14%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLY--SSIASELPHPAVQTRRLSTSSI 4366
            ND  +  FV+GLGPGQLVGRQVLG PSLG++QLS   +KG L++EVIRARGL  KA SK+LP PYVK+YL+ GK  ++K KT  S RRTLDPLYQQQL F   Y+G +LQ TVWG+Y R++KK FMG  +I+LDDL+ S+IV GWYKL+  +S+ S   +  + +RR S +S+
Sbjct: 1779 NDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKT-SSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTSLVSCPTNIGLGSRRSSIASL 1950          

HSP 2 Score: 96.2857 bits (238), Expect = 2.154e-19
Identity = 68/182 (37.36%), Postives = 88/182 (48.35%), Query Frame = 2
Query: 1688 DPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAG----------------QRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNI 2185
            D S  ++ R G   S  KDSGI        +S   +  +++N    P     NPV W+ S D  RLIGHMILRK          G  ILGLKVNGG+    G                   A + KVK  S+AD  G +  GDE++EWN +     + DEV +II ES+L+  +ELIV R I
Sbjct:  760 DWSRWEAERQGSQDSATKDSGID-------TSSTFTSSEDSNRGDGP----KNPVNWQTSADNTRLIGHMILRKYYD-------GEDILGLKVNGGQPLATGGSVSGAGTGAAIGAGGPCGAIVEKVKRGSVADLEGRIRPGDEILEWNGRGLHNKSADEVYDIIDESRLDAQVELIVSRPI 923          

HSP 3 Score: 83.5741 bits (205), Expect = 1.267e-15
Identity = 50/142 (35.21%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  323 IDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSR 748
            +D  PDLSHL+  ER  I +VL RQK+++ + ++I+R KQ+E +        T+E  +  +S +    G +       CH+C  TKFAD  G  C  C+ + C+RCG  V +  N    + W C  C+K   K E+L KT +
Sbjct:    1 MDEMPDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVV--------TLEMQIRQRSEQQKKAGVE---LDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNK---VIWVCILCRK---KQELLSKTGQ 125          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336717)

HSP 1 Score: 206.838 bits (525), Expect = 3.360e-53
Identity = 101/173 (58.38%), Postives = 130/173 (75.14%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLY--SSIASELPHPAVQTRRLSTSSI 4366
            ND  +  FV+GLGPGQLVGRQVLG PSLG++QLS   +KG L++EVIRARGL  KA SK+LP PYVK+YL+ GK  ++K KT  S RRTLDPLYQQQL F   Y+G +LQ TVWG+Y R++KK FMG  +I+LDDL+ S+IV GWYKL+  +S+ S   +  + +RR S +S+
Sbjct: 1779 NDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKT-SSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTSLVSCPTNIGLGSRRSSIASL 1950          

HSP 2 Score: 96.2857 bits (238), Expect = 2.154e-19
Identity = 68/182 (37.36%), Postives = 88/182 (48.35%), Query Frame = 2
Query: 1688 DPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAG----------------QRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNI 2185
            D S  ++ R G   S  KDSGI        +S   +  +++N    P     NPV W+ S D  RLIGHMILRK          G  ILGLKVNGG+    G                   A + KVK  S+AD  G +  GDE++EWN +     + DEV +II ES+L+  +ELIV R I
Sbjct:  760 DWSRWEAERQGSQDSATKDSGID-------TSSTFTSSEDSNRGDGP----KNPVNWQTSADNTRLIGHMILRKYYD-------GEDILGLKVNGGQPLATGGSVSGAGTGAAIGAGGPCGAIVEKVKRGSVADLEGRIRPGDEILEWNGRGLHNKSADEVYDIIDESRLDAQVELIVSRPI 923          

HSP 3 Score: 83.5741 bits (205), Expect = 1.267e-15
Identity = 50/142 (35.21%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  323 IDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSR 748
            +D  PDLSHL+  ER  I +VL RQK+++ + ++I+R KQ+E +        T+E  +  +S +    G +       CH+C  TKFAD  G  C  C+ + C+RCG  V +  N    + W C  C+K   K E+L KT +
Sbjct:    1 MDEMPDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVV--------TLEMQIRQRSEQQKKAGVE---LDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNK---VIWVCILCRK---KQELLSKTGQ 125          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336719)

HSP 1 Score: 207.223 bits (526), Expect = 3.438e-53
Identity = 101/173 (58.38%), Postives = 130/173 (75.14%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLY--SSIASELPHPAVQTRRLSTSSI 4366
            ND  +  FV+GLGPGQLVGRQVLG PSLG++QLS   +KG L++EVIRARGL  KA SK+LP PYVK+YL+ GK  ++K KT  S RRTLDPLYQQQL F   Y+G +LQ TVWG+Y R++KK FMG  +I+LDDL+ S+IV GWYKL+  +S+ S   +  + +RR S +S+
Sbjct: 2419 NDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKT-SSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTSLVSCPTNIGLGSRRSSIASL 2590          

HSP 2 Score: 96.2857 bits (238), Expect = 1.846e-19
Identity = 68/182 (37.36%), Postives = 88/182 (48.35%), Query Frame = 2
Query: 1688 DPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAG----------------QRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNI 2185
            D S  ++ R G   S  KDSGI        +S   +  +++N    P     NPV W+ S D  RLIGHMILRK          G  ILGLKVNGG+    G                   A + KVK  S+AD  G +  GDE++EWN +     + DEV +II ES+L+  +ELIV R I
Sbjct:  760 DWSRWEAERQGSQDSATKDSGID-------TSSTFTSSEDSNRGDGP----KNPVNWQTSADNTRLIGHMILRKYYD-------GEDILGLKVNGGQPLATGGSVSGAGTGAAIGAGGPCGAIVEKVKRGSVADLEGRIRPGDEILEWNGRGLHNKSADEVYDIIDESRLDAQVELIVSRPI 923          

HSP 3 Score: 83.9593 bits (206), Expect = 1.129e-15
Identity = 50/142 (35.21%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  323 IDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSR 748
            +D  PDLSHL+  ER  I +VL RQK+++ + ++I+R KQ+E +        T+E  +  +S +    G +       CH+C  TKFAD  G  C  C+ + C+RCG  V +  N    + W C  C+K   K E+L KT +
Sbjct:    1 MDEMPDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVV--------TLEMQIRQRSEQQKKAGVE---LDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNK---VIWVCILCRK---KQELLSKTGQ 125          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336715)

HSP 1 Score: 206.068 bits (523), Expect = 3.598e-53
Identity = 95/153 (62.09%), Postives = 119/153 (77.78%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIA 4312
            ND  +  FV+GLGPGQLVGRQVLG PSLG++QLS   +KG L++EVIRARGL  KA SK+LP PYVK+YL+ GK  ++K KT  S RRTLDPLYQQQL F   Y+G +LQ TVWG+Y R++KK FMG  +I+LDDL+ S+IV GWYKL+ + +
Sbjct: 1247 NDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKT-SSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTS 1398          

HSP 2 Score: 80.1073 bits (196), Expect = 1.626e-14
Identity = 50/142 (35.21%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  323 IDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSR 748
            +D  PDLSHL+  ER  I +VL RQK+++ + ++I+R KQ+E +        T+E  +  +S +    G +       CH+C  TKFAD  G  C  C+ + C+RCG  V +  N    + W C  C+K   K E+L KT +
Sbjct:    1 MDEMPDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVV--------TLEMQIRQRSEQQKKAGVE---LDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNK---VIWVCILCRK---KQELLSKTGQ 125          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336723)

HSP 1 Score: 206.068 bits (523), Expect = 3.657e-53
Identity = 95/153 (62.09%), Postives = 119/153 (77.78%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIA 4312
            ND  +  FV+GLGPGQLVGRQVLG PSLG++QLS   +KG L++EVIRARGL  KA SK+LP PYVK+YL+ GK  ++K KT  S RRTLDPLYQQQL F   Y+G +LQ TVWG+Y R++KK FMG  +I+LDDL+ S+IV GWYKL+ + +
Sbjct: 1206 NDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKT-SSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTS 1357          

HSP 2 Score: 80.1073 bits (196), Expect = 1.455e-14
Identity = 50/142 (35.21%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  323 IDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSR 748
            +D  PDLSHL+  ER  I +VL RQK+++ + ++I+R KQ+E +        T+E  +  +S +    G +       CH+C  TKFAD  G  C  C+ + C+RCG  V +  N    + W C  C+K   K E+L KT +
Sbjct:    1 MDEMPDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVV--------TLEMQIRQRSEQQKKAGVE---LDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNK---VIWVCILCRK---KQELLSKTGQ 125          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims2a (regulating synaptic membrane exocytosis 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1656])

HSP 1 Score: 210.305 bits (534), Expect = 9.697e-60
Identity = 121/288 (42.01%), Postives = 167/288 (57.99%), Query Frame = 2
Query: 3527 RKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDL-FQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +KRR SIG K ++V+ +SRKS S S L       KK R++ QRS E       ++ E  +R+      +     + ++ ++ +L F    L                          +D+Q   F++GLGP QLVGRQ L  P +G++Q+  ++KKG L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TLDPLYQQQLSF     GKVLQ  VWG+Y RMD KSFMG  +ILLDDLD S++V GW+KL+   +   P  A  TRR S +S+
Sbjct:   71 KKRRSSIGAKMAAVVGLSRKSRSASQLGQTEAGGKKLRSTIQRSTET-----GLAVEMRSRMTRQASRESTDGSMNSYSSEGNLIFPGVRLS-------------------------SDSQFSDFLDGLGPAQLVGRQTLATPPMGDIQIGMVEKKGALEVEVIRARGLVGKPGSKALPAPYVKVYLLENGACIAKKKTKVA-RKTLDPLYQQQLSFEESPGGKVLQIIVWGDYGRMDHKSFMGAAQILLDDLDLSNMVIGWFKLFPPSSLVDPTLAPLTRRASQTSL 327          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims2a (regulating synaptic membrane exocytosis 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1656])

HSP 1 Score: 197.593 bits (501), Expect = 4.595e-56
Identity = 94/171 (54.97%), Postives = 122/171 (71.35%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +D+Q   F++GLGP QLVGRQ L  P +G++Q+  ++KKG L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TLDPLYQQQLSF     GKVLQ  VWG+Y RMD KSFMG  +ILLDDLD S++V GW+KL+   +   P  A  TRR S +S+
Sbjct:  107 SDSQFSDFLDGLGPAQLVGRQTLATPPMGDIQIGMVEKKGALEVEVIRARGLVGKPGSKALPAPYVKVYLLENGACIAKKKTKVA-RKTLDPLYQQQLSFEESPGGKVLQIIVWGDYGRMDHKSFMGAAQILLDDLDLSNMVIGWFKLFPPSSLVDPTLAPLTRRASQTSL 276          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims1a (regulating synaptic membrane exocytosis 1a [Source:ZFIN;Acc:ZDB-GENE-090312-135])

HSP 1 Score: 196.052 bits (497), Expect = 1.062e-53
Identity = 120/294 (40.82%), Postives = 167/294 (56.80%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRI-SRKSNSTSNLE------KKARTS--FQRSEEVVPAHIKISTEHNRVNIMTYN---KCESAPVTNFGNDSDL-FQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR S+  +  +++ I SR+S STS L       KKA+ S   QRS+E       ++ E+ R N+M      +     + ++ ++ +L F    L                           D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++EVIRARGLTPK  SK LP PYVK+YL++      K+KT ++ R+TLDPLYQQ L F     GKVLQ  VWG+Y RMD K FMG  +I L++LD SS V GWYKL+   +   P  A  TRR S +S+
Sbjct:  171 GKKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKAKGSSQIQRSQET-----GMAVEYPR-NVMARQASRESTDGSMNSYSSEGNLIFSGMRLG-------------------------ADSQFSDFLDGLGPAQLVGRQTLATPAMGDVQIGLMDKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLENGACKAKKKTKIA-RKTLDPLYQQSLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQIFLEELDLSSTVIGWYKLFPPSSLVDPTLAPLTRRASQTSL 432          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims1b (regulating synaptic membrane exocytosis 1b [Source:ZFIN;Acc:ZDB-GENE-101223-4])

HSP 1 Score: 187.963 bits (476), Expect = 1.361e-53
Identity = 92/172 (53.49%), Postives = 119/172 (69.19%), Query Frame = 2
Query: 3857 DNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSIGK 4372
            + Q   F++GLGP QLVGRQ L  P++G++Q+  ++KKG+L++EVIRARGL  K  SK LP PYVK+YL+     + K+KT ++ R+TLDPLYQQ L F     GKVLQ  VWG+Y RMD KSFMG  +ILL++LD SS V GWYKL+   +   P  A  TRR S SS+ K
Sbjct:   39 ETQFSDFLDGLGPAQLVGRQTLATPAIGDIQIGMVNKKGQLEVEVIRARGLIQKPGSKSLPAPYVKVYLLHNGAYVAKKKTKIA-RKTLDPLYQQTLQFEESPQGKVLQVIVWGDYGRMDHKSFMGVAQILLEELDLSSNVIGWYKLFPPSSLVDPTLASLTRRASQSSLDK 209          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Match: rims1a (regulating synaptic membrane exocytosis 1a [Source:ZFIN;Acc:ZDB-GENE-090312-135])

HSP 1 Score: 196.438 bits (498), Expect = 3.743e-53
Identity = 120/294 (40.82%), Postives = 167/294 (56.80%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRI-SRKSNSTSNLE------KKARTS--FQRSEEVVPAHIKISTEHNRVNIMTYN---KCESAPVTNFGNDSDL-FQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR S+  +  +++ I SR+S STS L       KKA+ S   QRS+E       ++ E+ R N+M      +     + ++ ++ +L F    L                           D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++EVIRARGLTPK  SK LP PYVK+YL++      K+KT ++ R+TLDPLYQQ L F     GKVLQ  VWG+Y RMD K FMG  +I L++LD SS V GWYKL+   +   P  A  TRR S +S+
Sbjct:  232 GKKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKAKGSSQIQRSQET-----GMAVEYPR-NVMARQASRESTDGSMNSYSSEGNLIFSGMRLG-------------------------ADSQFSDFLDGLGPAQLVGRQTLATPAMGDVQIGLMDKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLENGACKAKKKTKIA-RKTLDPLYQQSLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQIFLEELDLSSTVIGWYKLFPPSSLVDPTLAPLTRRASQTSL 493          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 207.994 bits (528), Expect = 2.272e-53
Identity = 120/288 (41.67%), Postives = 166/288 (57.64%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS STS L       KK +++ QRS E       ++ E  N ++     +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  PS+G++Q+   DKKG+L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TL+PLYQQ L+F     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD SS+V GWYKL+   +   P  A  TRR S SS+
Sbjct: 1329 GKKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----GLAVEMRNWMSRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLGSDSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKVA-RKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSL 1586          

HSP 2 Score: 167.548 bits (423), Expect = 6.165e-41
Identity = 132/430 (30.70%), Postives = 206/430 (47.91%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P K        K++Q S SSSE++L ++ E TS DD E+E +S+SE+     N W++                         H  + S   S +              +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EW+ +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+Y+ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  464 RKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKTKK---GGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYN-WVE-------------------------HSSWHSSEASPMSL------------HPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 852          

HSP 3 Score: 72.0182 bits (175), Expect = 9.611e-12
Identity = 44/138 (31.88%), Postives = 70/138 (50.72%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK-RMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V++RQK+++ +   +L+   ++           + +  + K  E      +Q      C +C  TKFAD  G  C  C  K C+RCG  V +  N + +++ W C  C+K+    EIL K+ 
Sbjct:   25 PDLSHLTEDERKIIMAVMERQKKEEEKEQSVLKKLHQQ---------FEMYKEQVKKMGEEAQQQQEQKGEAPTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLRSNKEDKVVMWVCNLCRKQQ---EILTKSG 150          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 207.994 bits (528), Expect = 2.523e-53
Identity = 120/288 (41.67%), Postives = 166/288 (57.64%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS STS L       KK +++ QRS E       ++ E  N ++     +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  PS+G++Q+   DKKG+L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TL+PLYQQ L+F     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD SS+V GWYKL+   +   P  A  TRR S SS+
Sbjct: 1352 GKKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----GLAVEMRNWMSRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLGSDSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKVA-RKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSL 1609          

HSP 2 Score: 167.162 bits (422), Expect = 7.589e-41
Identity = 132/430 (30.70%), Postives = 206/430 (47.91%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P K        K++Q S SSSE++L ++ E TS DD E+E +S+SE+     N W++                         H  + S   S +              +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EW+ +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+Y+ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  464 RKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKTKK---GGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYN-WVE-------------------------HSSWHSSEASPMSL------------HPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 852          

HSP 3 Score: 71.633 bits (174), Expect = 9.890e-12
Identity = 44/138 (31.88%), Postives = 70/138 (50.72%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK-RMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V++RQK+++ +   +L+   ++           + +  + K  E      +Q      C +C  TKFAD  G  C  C  K C+RCG  V +  N + +++ W C  C+K+    EIL K+ 
Sbjct:   25 PDLSHLTEDERKIIMAVMERQKKEEEKEQSVLKKLHQQ---------FEMYKEQVKKMGEEAQQQQEQKGEAPTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLRSNKEDKVVMWVCNLCRKQQ---EILTKSG 150          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 207.994 bits (528), Expect = 2.772e-53
Identity = 120/288 (41.67%), Postives = 166/288 (57.64%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS STS L       KK +++ QRS E       ++ E  N ++     +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  PS+G++Q+   DKKG+L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TL+PLYQQ L+F     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD SS+V GWYKL+   +   P  A  TRR S SS+
Sbjct: 1492 GKKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----GLAVEMRNWMSRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLGSDSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKVA-RKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSL 1749          

HSP 2 Score: 166.777 bits (421), Expect = 9.858e-41
Identity = 132/430 (30.70%), Postives = 206/430 (47.91%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P K        K++Q S SSSE++L ++ E TS DD E+E +S+SE+     N W++                         H  + S   S +              +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EW+ +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+Y+ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  475 RKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKTKK---GGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYN-WVE-------------------------HSSWHSSEASPMSL------------HPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 863          

HSP 3 Score: 81.6481 bits (200), Expect = 1.132e-14
Identity = 49/140 (35.00%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVE--RNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK-RMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V++RQK+++ +   +L+ K+E+K Q         E  +  + K  E      +Q      C +C  TKFAD  G  C  C  K C+RCG  V +  N + +++ W C  C+K+    EIL K+ 
Sbjct:   25 PDLSHLTEDERKIIMAVMERQKKEEEKEQSVLKVKEEQKAQPAQKLHQQFEMYKEQVKKMGEEAQQQQEQKGEAPTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLRSNKEDKVVMWVCNLCRKQQ---EILTKSG 161          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 207.994 bits (528), Expect = 2.839e-53
Identity = 120/288 (41.67%), Postives = 166/288 (57.64%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS STS L       KK +++ QRS E       ++ E  N ++     +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  PS+G++Q+   DKKG+L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TL+PLYQQ L+F     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD SS+V GWYKL+   +   P  A  TRR S SS+
Sbjct: 1476 GKKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----GLAVEMRNWMSRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLGSDSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKVA-RKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSL 1733          

HSP 2 Score: 166.777 bits (421), Expect = 1.004e-40
Identity = 132/430 (30.70%), Postives = 206/430 (47.91%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P K        K++Q S SSSE++L ++ E TS DD E+E +S+SE+     N W++                         H  + S   S +              +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EW+ +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+Y+ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  475 RKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKTKK---GGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYN-WVE-------------------------HSSWHSSEASPMSL------------HPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 863          

HSP 3 Score: 81.6481 bits (200), Expect = 1.092e-14
Identity = 49/140 (35.00%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVE--RNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK-RMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V++RQK+++ +   +L+ K+E+K Q         E  +  + K  E      +Q      C +C  TKFAD  G  C  C  K C+RCG  V +  N + +++ W C  C+K+    EIL K+ 
Sbjct:   25 PDLSHLTEDERKIIMAVMERQKKEEEKEQSVLKVKEEQKAQPAQKLHQQFEMYKEQVKKMGEEAQQQQEQKGEAPTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLRSNKEDKVVMWVCNLCRKQQ---EILTKSG 161          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Match: amotl1 (angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-993664])

HSP 1 Score: 207.608 bits (527), Expect = 2.970e-53
Identity = 120/288 (41.67%), Postives = 166/288 (57.64%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS STS L       KK +++ QRS E       ++ E  N ++     +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  PS+G++Q+   DKKG+L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TL+PLYQQ L+F     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD SS+V GWYKL+   +   P  A  TRR S SS+
Sbjct: 1480 GKKRRSSIGAKMVAIVGLSRKSRSTSQLSQTEVGGKKLKSTIQRSTET-----GLAVEMRNWMSRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLGSDSQFSDFLDGLGPAQLVGRQTLATPSMGDIQVGMADKKGQLEVEVIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKVA-RKTLEPLYQQVLAFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSL 1737          

HSP 2 Score: 166.777 bits (421), Expect = 1.032e-40
Identity = 132/430 (30.70%), Postives = 206/430 (47.91%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P K        K++Q S SSSE++L ++ E TS DD E+E +S+SE+     N W++                         H  + S   S +              +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EW+ +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+Y+ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  475 RKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKTKK---GGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYN-WVE-------------------------HSSWHSSEASPMSL------------HPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWSGRILQGATFEEVYNIILESKPEAQVELLVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTVEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 863          

HSP 3 Score: 81.6481 bits (200), Expect = 1.130e-14
Identity = 49/140 (35.00%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVE--RNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK-RMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V++RQK+++ +   +L+ K+E+K Q         E  +  + K  E      +Q      C +C  TKFAD  G  C  C  K C+RCG  V +  N + +++ W C  C+K+    EIL K+ 
Sbjct:   25 PDLSHLTEDERKIIMAVMERQKKEEEKEQSVLKVKEEQKAQPAQKLHQQFEMYKEQVKKMGEEAQQQQEQKGEAPTCGICHKTKFADGCGHDCSYCQTKFCARCGGRVSLRSNKEDKVVMWVCNLCRKQQ---EILTKSG 161          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims2 (regulating synaptic membrane exocytosis 2 [Source:MGI Symbol;Acc:MGI:2152972])

HSP 1 Score: 189.504 bits (480), Expect = 3.406e-53
Identity = 91/171 (53.22%), Postives = 123/171 (71.93%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     G+VLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct:  105 SDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 274          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims2 (regulating synaptic membrane exocytosis 2 [Source:MGI Symbol;Acc:MGI:2152972])

HSP 1 Score: 204.142 bits (518), Expect = 1.626e-52
Identity = 116/289 (40.14%), Postives = 165/289 (57.09%), Query Frame = 2
Query: 3521 CGRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
             G+KRR SIG K  +++ +SRKS S S L       KK R++ QRS E       ++ E  N +      +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     G+VLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1028 SGKKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1286          

HSP 2 Score: 168.703 bits (426), Expect = 1.463e-41
Identity = 132/439 (30.07%), Postives = 202/439 (46.01%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRN---------NPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P + H      K++Q S SSSE++L ++ E TS DD ELE                                               SE VS+  +  Y WL     +         +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EWN +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+++ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  235 RKTKREKMETMLRNDSLSSDQSESVR---PPPPRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELE-----------------------------------------------SESVSEKGDMEYSWLEQASWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 623          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims2 (regulating synaptic membrane exocytosis 2 [Source:MGI Symbol;Acc:MGI:2152972])

HSP 1 Score: 204.527 bits (519), Expect = 2.099e-52
Identity = 116/288 (40.28%), Postives = 165/288 (57.29%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS S S L       KK R++ QRS E       ++ E  N +      +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     G+VLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1282 GKKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1539          

HSP 2 Score: 176.022 bits (445), Expect = 1.235e-43
Identity = 139/442 (31.45%), Postives = 218/442 (49.32%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQW-------LDPSNRKSSRLGQ-----NRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P + H      K++Q S SSSE++L ++ E TS DD ELE +S+SE+      +        L  SN +S R  +       S ++D   SE   ++   +  S   +T           +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EWN +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+++ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  467 RKTKREKMETMLRNDSLSSDQSESVR---PPPPRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQKGKRKTSEQGVLSDSNTRSERQKKRMYYGGHSLEEDLEWSEPQIKDSGVDTCS---STTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 902          

HSP 3 Score: 75.0998 bits (183), Expect = 8.259e-13
Identity = 44/137 (32.12%), Postives = 67/137 (48.91%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V+ RQK+++ +   +L+   ++           + +  + K  E      +Q      C +C  TKFAD  G +C  C  K C+RCG  V +  N    + W C  C+K+    EIL K+ 
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKKLHQQ---------FEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK---VMWVCNLCRKQQ---EILTKSG 148          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims2 (regulating synaptic membrane exocytosis 2 [Source:MGI Symbol;Acc:MGI:2152972])

HSP 1 Score: 204.142 bits (518), Expect = 2.393e-52
Identity = 116/288 (40.28%), Postives = 165/288 (57.29%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS S S L       KK R++ QRS E       ++ E  N +      +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     G+VLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1304 GKKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1561          

HSP 2 Score: 175.637 bits (444), Expect = 1.307e-43
Identity = 139/442 (31.45%), Postives = 218/442 (49.32%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQW-------LDPSNRKSSRLGQ-----NRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P + H      K++Q S SSSE++L ++ E TS DD ELE +S+SE+      +        L  SN +S R  +       S ++D   SE   ++   +  S   +T           +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EWN +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+++ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  467 RKTKREKMETMLRNDSLSSDQSESVR---PPPPRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQKGKRKTSEQGVLSDSNTRSERQKKRMYYGGHSLEEDLEWSEPQIKDSGVDTCS---STTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 902          

HSP 3 Score: 75.0998 bits (183), Expect = 8.081e-13
Identity = 46/139 (33.09%), Postives = 69/139 (49.64%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILR--NKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V+ RQK+++ +   +L+  ++Q E  +E       V++       +    G         C +C  TKFAD  G +C  C  K C+RCG  V +  N    + W C  C+K+    EIL K+ 
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKKLHQQFEMYKE------QVKKMGEESQQQQEQKGD-----APTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK---VMWVCNLCRKQQ---EILTKSG 148          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Match: Rims2 (regulating synaptic membrane exocytosis 2 [Source:MGI Symbol;Acc:MGI:2152972])

HSP 1 Score: 203.756 bits (517), Expect = 2.923e-52
Identity = 116/288 (40.28%), Postives = 165/288 (57.29%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS S S L       KK R++ QRS E       ++ E  N +      +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     G+VLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1262 GKKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1519          

HSP 2 Score: 175.252 bits (443), Expect = 1.727e-43
Identity = 139/442 (31.45%), Postives = 218/442 (49.32%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQW-------LDPSNRKSSRLGQ-----NRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P + H      K++Q S SSSE++L ++ E TS DD ELE +S+SE+      +        L  SN +S R  +       S ++D   SE   ++   +  S   +T           +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EWN +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+++ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  507 RKTKREKMETMLRNDSLSSDQSESVR---PPPPRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQKGKRKTSEQGVLSDSNTRSERQKKRMYYGGHSLEEDLEWSEPQIKDSGVDTCS---STTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 942          

HSP 3 Score: 76.2554 bits (186), Expect = 3.014e-13
Identity = 53/168 (31.55%), Postives = 73/168 (43.45%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVS--PSSTTVERNLMIKSPES---------IFLGSQQGNYGE--------------------VCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V+ RQK+++ +   +L+ K+E K Q     P S   E    +  P+            L  Q   Y E                     C +C  TKFAD  G +C  C  K C+RCG  V +  N    + W C  C+K+    EIL K+ 
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKIKEEHKAQPTQWFPFSGITELVNNVLQPQQKQPNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK---VMWVCNLCRKQQ---EILTKSG 188          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q9EQZ7|RIMS2_MOUSE (Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 2.044e-51
Identity = 116/288 (40.28%), Postives = 165/288 (57.29%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS S S L       KK R++ QRS E       ++ E  N +      +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     G+VLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1262 GKKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1519          

HSP 2 Score: 175.252 bits (443), Expect = 1.208e-42
Identity = 139/442 (31.45%), Postives = 218/442 (49.32%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQW-------LDPSNRKSSRLGQ-----NRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P + H      K++Q S SSSE++L ++ E TS DD ELE +S+SE+      +        L  SN +S R  +       S ++D   SE   ++   +  S   +T           +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EWN +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+++ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  507 RKTKREKMETMLRNDSLSSDQSESVR---PPPPRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQKGKRKTSEQGVLSDSNTRSERQKKRMYYGGHSLEEDLEWSEPQIKDSGVDTCS---STTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 942          

HSP 3 Score: 76.2554 bits (186), Expect = 2.108e-12
Identity = 53/168 (31.55%), Postives = 73/168 (43.45%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVS--PSSTTVERNLMIKSPES---------IFLGSQQGNYGE--------------------VCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V+ RQK+++ +   +L+ K+E K Q     P S   E    +  P+            L  Q   Y E                     C +C  TKFAD  G +C  C  K C+RCG  V +  N    + W C  C+K+    EIL K+ 
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKIKEEHKAQPTQWFPFSGITELVNNVLQPQQKQPNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK---VMWVCNLCRKQQ---EILTKSG 188          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q9JIS1|RIMS2_RAT (Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 3.208e-51
Identity = 117/288 (40.62%), Postives = 165/288 (57.29%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR SIG K  +++ +SRKS S S L       KK R++ QRS E       ++ E  N +      +     + ++ ++ +L                                +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1287 GKKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTET-----GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLI------------------------FPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1544          

HSP 2 Score: 166.007 bits (419), Expect = 8.396e-40
Identity = 133/446 (29.82%), Postives = 209/446 (46.86%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTE------------------SLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSST-----IQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P + H      K++Q S SSSE++L ++ E TS DD E+E +S+ E+     + WL+                         H  + S   S +              +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EWN +  +G T +EV  II ESK E  +EL+V R I    +  +ST                   S+      + G      +F+       +L   +T     +QI+L+++ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  467 RKTKREKMETMLRNDSLSSDQSESVR---PPPPRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVGEKGDMEYS-WLE-------------------------HASWHSSEASPMSL------------HPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDMPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSSQSLSRRTTPFVPRVQIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 871          

HSP 3 Score: 72.7886 bits (177), Expect = 2.448e-11
Identity = 46/139 (33.09%), Postives = 69/139 (49.64%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILR--NKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V+ RQK+++ +   +L+  ++Q E  +E       V++       +    G         C +C  TKFAD  G +C  C  K C+RCG  V +  N    + W C  C+K+    EIL K+ 
Sbjct:   27 PDLSHLTEEERKIIQAVMDRQKKEEEKEQSVLKKLHQQFEMYKE------QVKKMGEESQQQQEQKGD-----APTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK---VMWVCNLCRKQQ---EILTKSG 148          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q9UQ26|RIMS2_HUMAN (Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 2.144e-48
Identity = 92/171 (53.80%), Postives = 123/171 (71.93%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +D+Q   F++GLGP QLVGRQ L  P++G++Q+  +DKKG+L++E+IRARGL  K  SK LP PYVK+YL+D    I K+KT ++ R+TL+PLYQQ LSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+L+ S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1231 SDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVA-RKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1400          

HSP 2 Score: 169.088 bits (427), Expect = 1.021e-40
Identity = 138/442 (31.22%), Postives = 217/442 (49.10%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQW-------LDPSNRKSSRLGQ-----NRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K+ET+ RNDSLSSD SE+       P K        K++Q S SSSE++L ++ E TS DD E+E +S+SE+      +        L  SN +S R  +       S ++D   SE   ++   +  S   +T           +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKVK  S+ADTVGHL  GDEV+EWN +  +G T +EV  II ESK E  +EL+V R I    +  +ST +      ++    +     I    P+S           S  + I+L+++ +  + +V ++ A +L       P N      F+       KR +  +  T+ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  498 RKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKSKK---GGKMRQISLSSSEEELASTPEYTSCDDVEIESESVSEKGDSQKGKRKTSEQAVLSDSNTRSERQKEMMYFGGHSLEEDLEWSEPQIKDSGVDTCS---STTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTH 933          

HSP 3 Score: 70.0922 bits (170), Expect = 1.828e-10
Identity = 47/158 (29.75%), Postives = 70/158 (44.30%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDK--------------ILRN--KQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNY------GEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKT 742
            PDLSHL+E ER+II  V+ RQK+   E  K              ++ N  + ++K Q      T + +   +   +   +G +             C +C  TKFAD  G +C  C  K C+RCG  V +  N    + W C  C+K+    EIL K+
Sbjct:   27 PDLSHLTEEERKIILAVMDRQKKKVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNK---VMWVCNLCRKQQ---EILTKS 178          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q86UR5|RIMS1_HUMAN (Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 5.802e-48
Identity = 112/287 (39.02%), Postives = 158/287 (55.05%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNL------EKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR S+  K  ++  +SR+S STS L       KK +++ QRS E       ++ E  ++      +     + ++ ++ +L                                 D+Q   F++GLGP QLVGRQ L  P++G++Q+   DKKG+L++EVIRAR LT K  SK  P PYVK+YL++    I K+KT ++ R+TLDPLYQQ L F     GKVLQ  VWG+Y RMD K FMG  +ILL++LD SS+V GWYKL+   +   P     TRR S SS+
Sbjct: 1427 GKKRRSSLSAKVVAI--VSRRSRSTSQLSQTESGHKKLKSTIQRSTET-----GMAAEMRKMVRQPSRESTDGSINSYSSEGNLI------------------------FPGVRLGADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIA-RKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLTPLTRRASQSSL 1681          

HSP 2 Score: 171.785 bits (434), Expect = 1.819e-41
Identity = 150/471 (31.85%), Postives = 223/471 (47.35%), Query Frame = 2
Query: 1376 ANEFNAESIPYFKSRRNKTSA-------RRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSER---DIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQ-------IRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPI 2716
            A E  A+     +SR + +SA       R K+ET+ RNDSLSSD SE+      SP K H      K +Q S SSSE++  ++ E TS +D ELE +S+SE+   D Y    WLDP+                      H RE S   +S               ++PVTW+PSK+G RLIG +IL K T    ++    A+LGLKV GGK+T  G+  A+ITKVK  S+AD VGHL +GDEV+EWN K   G TN+EV  II ESK E  +E+IV R I    +   S+        ++    + +   I    P S        Q       ++L+Y+ +  + +V+++ AT+L       P N      F+       KR +  +   + P W+Q FV+  +     +   L  TV+    +  + +    E++I+L  A   +  + Y L   +D+    +  P+P 
Sbjct:  461 APELKAQEPLRKQSRLDPSSAVLMRKAKREKVETMLRNDSLSSDQSESVR---PSPPKPHRSKRGGKKRQMSVSSSEEEGVSTPEYTSCEDVELESESVSEKGDLDYY----WLDPAT--------------------WHSRETSP--IS---------------SHPVTWQPSKEGDRLIGRVILNKRTTMPKDS---GALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKKILEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQEEESEFLGEILIELETALLDDEPHWYKLQT-HDESSLPLPQPSPF 883          

HSP 3 Score: 66.2402 bits (160), Expect = 2.810e-9
Identity = 51/159 (32.08%), Postives = 78/159 (49.06%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIK----SP----------ESIF-LGSQQGNY-GE------VCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK-RMLKWCCRNCKKRDDKPEILIKT 742
            PDLSHL+E ER II  V+ RQK ++ + + +L+    +  +   P++    RN   +    SP          E +  +G +   Y GE       C +C  TKFAD  G  C  C  K C+RCG  V +  N++ +++ W C  C+K+    EIL K+
Sbjct:   23 PDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAK---PAACKTPRNAENQPHQPSPRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKVVMWVCNLCRKQQ---EILTKS 175          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Match: sp|Q9JIR4|RIMS1_RAT (Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 4.874e-47
Identity = 110/281 (39.15%), Postives = 155/281 (55.16%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNL------EKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRR 4348
            G+KRR S+  K  ++  +SR+S STS L       KK +++ QRS E       ++ E  ++      +     + ++ ++ +L                                 D+Q   F++GLGP QLVGRQ L  P++G++Q+   DKKG+L++EVIRAR LT K  SK  P PYVK+YL++    I K+KT ++ R+TLDPLYQQ L F     GKVLQ  VWG+Y RMD K FMG  +ILL++LD SS+V GWYKL+   +   P  A  TRR
Sbjct: 1350 GKKRRSSLSAKVVAI--VSRRSRSTSQLSQTESGHKKLKSTIQRSTET-----GMAAEMRKMVRQPSRESTDGSINSYSSEGNLI------------------------FPGVRVGPDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIA-RKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLAPLTRR 1598          

HSP 2 Score: 171.785 bits (434), Expect = 1.674e-41
Identity = 145/449 (32.29%), Postives = 215/449 (47.88%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSER---DIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQ-------IRLFYNPIEMEFVVHLVSATNLIP--------PNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPI 2716
            + + R K E++ RNDSLSSD SE+      SP K H      K +Q S SSSE++  ++ E TS +D ELE +S+SE+   D Y    WLDP+                      H RE S   +S               ++PVTW+PSK+G RLIG +IL K T      E G A+LGLKV GGK+T  G+  A+ITKVK  S+AD VGHL +GDEV+EWN K   G TN+EV  II ESK E  +E+IV R I    +   S+        ++    + +   I    P S        Q       ++L+Y+ +  + +V+++ AT+L P        P    Y  F+       KR +  +   + P W+Q FV+  +     +   L  TV+    + ++ +    E++I+L  A   +  + Y L   +D+    +  P+P 
Sbjct:  499 RKAKREKAESMLRNDSLSSDQSESVR---PSPPKPHRPKRGGKRRQMSVSSSEEEGVSTPEYTSCEDVELESESVSEKGDLDYY----WLDPAT--------------------WHSRETSP--IS---------------SHPVTWQPSKEGDRLIGRVILNKRT--TMPKESG-ALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRVDGRPRNPYVKMY--FLPDRSDKSKRRTKTVKKLLEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQDEESEFLGEILIELETALLDDEPHWYKLQT-HDESSLPLPQPSPF 897          

HSP 3 Score: 61.2326 bits (147), Expect = 9.870e-8
Identity = 51/183 (27.87%), Postives = 78/183 (42.62%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKS---PESIF-----------------------------------LGSQQGNY-GE------VCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK-RMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER II  V+ RQK ++ + + +L+    +  +   P++    RN   +    P +IF                                   +G +   Y GE       C +C  TKFAD  G  C  C  K C+RCG  V +  N++ +++ W C  C+K+    EIL K+ 
Sbjct:   23 PDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAK---PAACKTPRNAESQPHQPPLNIFRCVCVPRKPSSEEGGPERDWRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKVVMWVCNLCRKQQ---EILTKSG 199          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: A0A094ZTA6 (Regulating synaptic membrane exocytosis protein 1 (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_04613 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 7.289e-75
Identity = 150/282 (53.19%), Postives = 188/282 (66.67%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVP----------AHIKISTEHNRVNIMTYNKCESAPVTN--------FGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIAS 4315
            GRKRRP+IGQKFS+VL  S KS+STS L+KK+RTSFQRSEEV+P             + S  H R+++M    C+S+  +         +G +SD   +ES+                          N++ VG FVEGLGPGQLVGRQVLGMP LGE+QLSF D+KG L++EVIRARGL  K  +K LP PYVK++L++GK  +EK +T+  PRRTLDPLYQQQL FS  Y GK+LQ +VWGEY RMDKK F+G CEI+LDDLD  ++VFGWYKL+  IAS
Sbjct: 1065 GRKRRPNIGQKFSNVLGRSNKSSSTSTLDKKSRTSFQRSEEVLPFGGYGAIFEGQEQEGSFSHGRLSMM---HCQSSISSGKSDGRNSRYGTNSDTTDQESV----------------------YMGRNESHVGEFVEGLGPGQLVGRQVLGMPCLGEIQLSFYDRKGHLEVEVIRARGLQQKNTAKPLPAPYVKLHLLEGKQSVEKLRTMYPPRRTLDPLYQQQLCFSVPYHGKILQISVWGEYGRMDKKVFLGMCEIVLDDLDLKTVVFGWYKLFGMIAS 1321          

HSP 2 Score: 127.872 bits (320), Expect = 1.222e-25
Identity = 78/260 (30.00%), Postives = 137/260 (52.69%), Query Frame = 2
Query: 1940 GSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNS-TESLKCEIKN--NCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNL--------IPPNFTRYSCFVQFIVGSEKRESVIIS---DTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYY 2677
            G   LGLK+ GG+L  +G   A++T++KP S AD +GHL SGDE++EWN +  RGL+ D+V++II +S+ E  +EL+ QR +   N+P N+ T+     + N  +C  P +                 S++ ++LFY+ I+ + +V ++ A NL        +P N     C +   +    R + +++   +  +P W+Q F F + +D  L    L  T++  +   ++     E++IDLS AD  +  Y YP+  ++
Sbjct:  554 GEPGLGLKLAGGRLDKSGHLSAFVTQIKPGSPADIIGHLKSGDEILEWNGQPLRGLSADDVSQIIYQSRDELQVELLAQREL---NEPANTPTDDFVLMVPNRSDCLNPNEMDSVEHN--------IKSSLHLKLFYDEIKHQLIVTILEARNLPNTNKASRMPCNIYCRLCLLPEQIEHNSRCTKLVTCSGNNTNPVWNQAFRFTNFTDNDLNKLHLEITIWNCNEYSDEQYKIGEIVIDLSVADLLDVGYWYPIRSFH 802          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: G7YTV4 (Regulating synaptic membrane exocytosis protein 2 OS=Clonorchis sinensis OX=79923 GN=CLF_110761 PE=4 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 2.101e-74
Identity = 150/265 (56.60%), Postives = 184/265 (69.43%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXX-XXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIAS 4315
            GRK RPSIG KFS VL  S KS+STSNL+KKART FQRSEEV+PA          VN+ + +    AP  + G+ S  F+    +Q    S       +   S      S N++ VG FVEGLGPGQLVGRQVLGMP LGE+QLSF D+KG L+IEVIRARGL  +  +K LP PYVK++L++GK  +EK +T   PRRTLDPLYQQQL+FS  Y GK++Q +VWGEY RMDKK F+G CE++LDDLD +S+VFGWYKL+  IAS
Sbjct:  867 GRKNRPSIGNKFSVVLGRSHKSSSTSNLDKKARTRFQRSEEVLPA--------GSVNL-SVDGAFQAPGQDTGDPS--FRRGPFQQQRSVSSGNPDAGTDIESRASPNLSRNESHVGEFVEGLGPGQLVGRQVLGMPCLGEIQLSFFDRKGHLEIEVIRARGLQHRNTAKPLPAPYVKLHLLEGKQSVEKLRTTTPPRRTLDPLYQQQLTFSVPYHGKIMQVSVWGEYGRMDKKVFLGMCEVVLDDLDLNSVVFGWYKLFGMIAS 1120          

HSP 2 Score: 166.777 bits (421), Expect = 1.046e-37
Identity = 108/312 (34.62%), Postives = 169/312 (54.17%), Query Frame = 2
Query: 1841 NNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTS--STIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYS-----------------CFVQFIVGSEK-RESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPI 2716
              PVTW PS+DG+RLIGHM+LRK   D ++ + GS ILG+K++GG+ + +G+   +I++VK  S AD +G L  GDE+++WN  S R LT DEV++I++ SK +  +ELIVQR++  +  P  S E        +       +   +  E +S  G S    +Q++LF +  + + +V L++A +L     +R S                 C ++ I G E+ + S +I+ T +P W+Q F F D  +  L  +DL  T++  +   N+     EVIIDLS AD S   Y YPL  Y   I+   +  TP+
Sbjct:  314 TQPVTWNPSRDGRRLIGHMLLRKQA-DRNSADVGS-ILGIKLSGGRKSTSGRLATFISRVKSGSPADLIGQLRPGDEILDWNGHSLRDLTTDEVSQIVNGSKNDTQVELIVQRDL--EETPGFSEEDFGTTTSQSMQLAVPLYPKYRSEEGLSKSGYSWRPAVQLKLFMDSSKDQLIVSLLAARDLT----SRSSLIGTTTAAAAVAVCNSYCRIRLIPGGEEMKYSKMIAHTNNPRWNQIFKFVDYPEQELAQHDLELTLWNCEVNTNEQTLVGEVIIDLSVADLSGAAYWYPLQ-YGSLIEGSSEATTPV 616          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: A0A4S2M6M0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003332 PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 6.680e-74
Identity = 149/265 (56.23%), Postives = 184/265 (69.43%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXX-XXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIAS 4315
            GRK RPSIG KFS VL  S KS+STSNL+KKART FQRSEEV+PA          VN ++ +    A     G+ S  F+    +Q    S       +   S      S N++ VG FVEGLGPGQLVGRQVLGMP LGE+QLSF D+KG L+IEVIRARGL  +  +K LP PYVK++L++GK  +EK +T  +PRRTLDPLYQQQL+FS  Y+GK++Q +VWGEY RMDKK F+G CE++LDDLD +S+VFGWYKL+  IAS
Sbjct:  781 GRKNRPSIGNKFSVVLGRSHKSSSTSNLDKKARTRFQRSEEVLPA--------GSVN-LSVDGAFHASGQETGDPS--FRRGPFQQQRSVSSGNPDAGTDIESRASPNLSRNESHVGEFVEGLGPGQLVGRQVLGMPCLGEIQLSFFDRKGHLEIEVIRARGLQHRNTAKPLPAPYVKLHLLEGKQSVEKLRTTTAPRRTLDPLYQQQLTFSVPYNGKIMQVSVWGEYGRMDKKVFLGMCEVVLDDLDLNSVVFGWYKLFGMIAS 1034          

HSP 2 Score: 128.642 bits (322), Expect = 4.999e-26
Identity = 70/186 (37.63%), Postives = 112/186 (60.22%), Query Frame = 2
Query: 1841 NNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTS--STIQIRLFYNPIEMEFVVHLVSATNL 2392
              PVTW PS+DG+RLIGHM+LRK   D ++ + GS ILG+K++GG+ + +G+   +I++VK  S AD +G L  GDE++EWN  S R LT DEV++I++ SK +  +ELIVQR++  +  P    E        +       +   +  E +S  G S    +Q++LF +  + + +V L++A +L
Sbjct:  290 TQPVTWNPSRDGRRLIGHMLLRKQA-DRNSADVGS-ILGVKLSGGRKSTSGRLATFISRVKSGSPADVIGQLRPGDEILEWNGHSLRDLTTDEVSQIVNGSKNDTQVELIVQRDL--EETPGFIEEDFDTTTSQSMQLAVPLYPKYRSEEGLSKSGYSWRPAVQLKLFMDSSKDQLIVSLLAARDL 471          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: A0A075AH13 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_13414 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 3.571e-73
Identity = 149/265 (56.23%), Postives = 183/265 (69.06%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXX-XXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIAS 4315
            GRK RPSIG KFS VL  S KS+STSNL+KKART FQRSEEV+PA          VN ++ +    AP    G+ S  F+    +Q    S       +   +      S N++ VG FVEGLGPGQLVGRQVLGMP LGE+QLSF D+KG L+IEVIRARGL  +  +K LP PYVK++L++GK  +EK +T   PRRTLDPLYQQQL+FS  Y GK++Q +VWGEY RMDKK F+G CE++LDDLD +S+VFGWYKL+  IAS
Sbjct: 1049 GRKNRPSIGNKFSVVLGRSHKSSSTSNLDKKARTRFQRSEEVLPA--------GPVN-LSVDGAFHAPGQETGDPS--FRRGPFQQQRSVSSGNPDVGTDIESRASPNLSRNESHVGEFVEGLGPGQLVGRQVLGMPCLGEIQLSFFDRKGHLEIEVIRARGLQHRNTAKPLPAPYVKLHLLEGKQSVEKLRTTTPPRRTLDPLYQQQLTFSVPYHGKIMQVSVWGEYGRMDKKVFLGMCEVVLDDLDLNSVVFGWYKLFGMIAS 1302          

HSP 2 Score: 123.635 bits (309), Expect = 2.575e-24
Identity = 57/115 (49.57%), Postives = 86/115 (74.78%), Query Frame = 2
Query: 1844 NPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNID 2188
             PVTW PS+DG+RLIGHM+LRK   D ++ + GS ILG+K++GG+ + +G+   +I++VK  S AD +G L  GDE+++WN  S R LT DEV++I++ESK +  +ELIVQR+++
Sbjct:  416 QPVTWNPSRDGRRLIGHMLLRK-QADRNSADVGS-ILGIKLSGGRKSTSGRLATFISRVKSGSSADVIGQLRPGDEILDWNGHSLRDLTTDEVSQIVNESKNDTQVELIVQRDLE 528          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Match: A0A5K3EKP2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.237e-72
Identity = 147/289 (50.87%), Postives = 188/289 (65.05%), Query Frame = 2
Query: 3527 RKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGN----------DSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSS 4363
            RKRR SIGQ+FS+VL IS+K+ +TS ++KK++ SFQRSEEV+PAHI+ + E   V+         A    FG            +  +Q      +   + +     +    +Q    + +  VG FVEGLGPGQLVGRQVLGMP LGE+QLSF D+KG L++EVIRARGL  K  SK LP PYVK++L++GK  +EK +T    RRTLDPL+QQQ SFS+ Y  K+LQ +VWGEY RMDKK F+G CEI+LDDLD  SIVFGWYKL+  IA+   H   Q RR S +S
Sbjct:  999 RKRRSSIGQRFSNVLGISKKNTATSAIDKKSKASFQRSEEVLPAHIQ-TNEKATVSGGYKAPGAVAEGAGFGGIAASSVQPGGGATGYQGSHHIAIQHHTSTSLLCSTAGRKDQLALEMGEVHVGEFVEGLGPGQLVGRQVLGMPCLGEIQLSFFDRKGHLEVEVIRARGLQQKNTSKPLPTPYVKLHLLEGKQSVEKMRTTAPARRTLDPLFQQQFSFSNSYREKILQVSVWGEYGRMDKKVFLGMCEIVLDDLDLRSIVFGWYKLFGMIAATAQHHK-QVRRHSGAS 1285          

HSP 2 Score: 111.309 bits (277), Expect = 1.226e-20
Identity = 90/293 (30.72%), Postives = 140/293 (47.78%), Query Frame = 2
Query: 1856 WKPSKDGKRLIGHMILRKCTQDLSNTECGSAIL---GLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQN-STESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYS--C--FVQFIVGSEKRE-----SVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKD 2695
            W  S DG  L G + LRK          G+ +L   GLK+  GK   +     +++ VK  S+AD +G L  GDE++EWN  S RGL   EV EI++ S+    I L VQR  D  N+  + +T S          +PE +    +   P+        +Q+ L ++  +   +V +++A +L PP F   S  C  F Q  +  E  E     + ++ +T  P W+ +F ++D     ++S +L   VF  D+  NK A   EV+I+L  AD S R Y YP+   ++  D D
Sbjct:  485 WSSSPDGTSLTGQVYLRKL-----RGSSGTGLLSSFGLKLVIGKRVPSDMVGTFVSSVKEGSVADVMGELQIGDEILEWNGHSLRGLHQKEVTEILALSRKTDEIWLTVQRIFDDFNEESDGATSSSLSRHGEETNFPEDEDDDYRD-TPVQE-DADPHLQLTLLFDE-KRTLIVSILAARDL-PPQFNTKSWLCNSFCQISILPETDEIKTRCTKVVYNTNDPVWNHNFAYQDFE---VESRELEVAVF--DYHQNKPALIGEVLINLQVADLSGRAYWYPIPPPWEAADLD 763          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:NCBI gene;Acc:103021485])

HSP 1 Score: 195.667 bits (496), Expect = 1.178e-55
Identity = 94/171 (54.97%), Postives = 122/171 (71.35%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +D+Q   F++GLGP QLVGRQ L  P +G++Q+  ++KKG L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TLDPLYQQQLSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD S++V GW+KL+   +   P  A  TRR S SS+
Sbjct:   90 SDSQFSDFLDGLGPAQLVGRQTLATPPMGDIQIGMVEKKGALEVEVIRARGLVGKPGSKALPAPYVKVYLLENGACIAKKKTKVA-RKTLDPLYQQQLSFEESPGGKVLQIIVWGDYGRMDHKSFMGAVQILLDELDLSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 259          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:NCBI gene;Acc:103021485])

HSP 1 Score: 212.231 bits (539), Expect = 5.603e-55
Identity = 123/288 (42.71%), Postives = 167/288 (57.99%), Query Frame = 2
Query: 3527 RKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDL-FQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +KRR SIG K ++V+ +SRKS S S L       KK R++ QRS E       ++ E  NR+      +     + +F ++ +L F    L                          +D+Q   F++GLGP QLVGRQ L  P +G++Q+  ++KKG L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TLDPLYQQQLSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1137 KKRRSSIGAKMAAVVGMSRKSRSASQLSQTEAGGKKLRSTIQRSTET-----GLAVEMRNRMTRQASRESTDGSMNSFNSEGNLIFPGVRLS-------------------------SDSQFSDFLDGLGPAQLVGRQTLATPPMGDIQIGMVEKKGALEVEVIRARGLVGKPGSKALPAPYVKVYLLENGACIAKKKTKVA-RKTLDPLYQQQLSFEESPGGKVLQIIVWGDYGRMDHKSFMGAVQILLDELDLSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1393          

HSP 2 Score: 164.081 bits (414), Expect = 4.061e-40
Identity = 132/438 (30.14%), Postives = 213/438 (48.63%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSE--------RDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + S R K+E++ RNDSLSSD SE+       P K        K++Q S SSSE++L T+ E TS +D E+E +S+SE        R        L    +K  R     S ++D+   E   ++   +  S   +T           +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKV+  S+ADTVGHL  GD+V+EWN ++ +G T  EV  II ESK E  +EL+V R I    +  +S  +      ++    + +   I    P+S           S  + ++L+Y+ +  + +V ++ A +L       P N      F+       KR +  +  ++ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  430 RKSKREKMESMLRNDSLSSDQSESVRPPPPKPHKSKR---GGKMRQVSLSSSEEELATTPEYTSCEDVEIESESVSEKGDSQREKRKTIEQAHILSEGQKKMVRF-WGHSMEEDAEWCEPQVKDSGVDTCS---STTLNEEHSHSEKHPVTWQPSKDGDRLIGRILLNKRMKDGSVPRDSGALLGLKVVGGKMTESGRLCAFITKVRKGSLADTVGHLRPGDQVLEWNGRNLQGATFKEVYNIILESKPEPQVELVVSRPIGDIPRIPDSAHTQLESSSSSFESQKMERPSISVTSPMSPGMLRDAPQYLSGQLSVKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKSKRRTKTVKKSLEPKWNQTFMYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALMDDEPHWYKLQTH 860          

HSP 3 Score: 79.337 bits (194), Expect = 2.590e-14
Identity = 48/144 (33.33%), Postives = 73/144 (50.69%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEE------KMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK-RMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II DV+ RQKR++ +   +L+   ++      ++++++  S T        +PE       Q      C +C  TKFAD  G  C  C  K C+RCG  V +  N +   + W C  C+K+    EIL K+ 
Sbjct:   19 PDLSHLTEEERKIIQDVMDRQKREEEKEQSMLKKLHQQFESYKDQVKKMADESQT--------TPE-------QKTDAPTCGICHKTKFADGCGHLCSYCQTKFCARCGGRVSLRSNKEDNTVMWVCNLCRKQQ---EILTKSG 144          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:NCBI gene;Acc:103021485])

HSP 1 Score: 212.231 bits (539), Expect = 5.860e-55
Identity = 123/288 (42.71%), Postives = 167/288 (57.99%), Query Frame = 2
Query: 3527 RKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDL-FQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +KRR SIG K ++V+ +SRKS S S L       KK R++ QRS E       ++ E  NR+      +     + +F ++ +L F    L                          +D+Q   F++GLGP QLVGRQ L  P +G++Q+  ++KKG L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TLDPLYQQQLSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1144 KKRRSSIGAKMAAVVGMSRKSRSASQLSQTEAGGKKLRSTIQRSTET-----GLAVEMRNRMTRQASRESTDGSMNSFNSEGNLIFPGVRLS-------------------------SDSQFSDFLDGLGPAQLVGRQTLATPPMGDIQIGMVEKKGALEVEVIRARGLVGKPGSKALPAPYVKVYLLENGACIAKKKTKVA-RKTLDPLYQQQLSFEESPGGKVLQIIVWGDYGRMDHKSFMGAVQILLDELDLSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1400          

HSP 2 Score: 163.696 bits (413), Expect = 4.224e-40
Identity = 132/438 (30.14%), Postives = 213/438 (48.63%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSE--------RDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + S R K+E++ RNDSLSSD SE+       P K        K++Q S SSSE++L T+ E TS +D E+E +S+SE        R        L    +K  R     S ++D+   E   ++   +  S   +T           +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKV+  S+ADTVGHL  GD+V+EWN ++ +G T  EV  II ESK E  +EL+V R I    +  +S  +      ++    + +   I    P+S           S  + ++L+Y+ +  + +V ++ A +L       P N      F+       KR +  +  ++ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  426 RKSKREKMESMLRNDSLSSDQSESVRPPPPKPHKSKR---GGKMRQVSLSSSEEELATTPEYTSCEDVEIESESVSEKGDSQREKRKTIEQAHILSEGQKKMVRF-WGHSMEEDAEWCEPQVKDSGVDTCS---STTLNEEHSHSEKHPVTWQPSKDGDRLIGRILLNKRMKDGSVPRDSGALLGLKVVGGKMTESGRLCAFITKVRKGSLADTVGHLRPGDQVLEWNGRNLQGATFKEVYNIILESKPEPQVELVVSRPIGDIPRIPDSAHTQLESSSSSFESQKMERPSISVTSPMSPGMLRDAPQYLSGQLSVKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKSKRRTKTVKKSLEPKWNQTFMYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALMDDEPHWYKLQTH 856          

HSP 3 Score: 79.337 bits (194), Expect = 2.572e-14
Identity = 48/143 (33.57%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEE------KMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II DV+ RQKR++ +   +L+   ++      ++++++  S T        +PE       Q      C +C  TKFAD  G  C  C  K C+RCG  V +  N    + W C  C+K+    EIL K+ 
Sbjct:   19 PDLSHLTEEERKIIQDVMDRQKREEEKEQSMLKKLHQQFESYKDQVKKMADESQT--------TPE-------QKTDAPTCGICHKTKFADGCGHLCSYCQTKFCARCGGRVSLRSNK---VMWVCNLCRKQQ---EILTKSG 140          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:NCBI gene;Acc:103021485])

HSP 1 Score: 211.846 bits (538), Expect = 6.259e-55
Identity = 123/288 (42.71%), Postives = 167/288 (57.99%), Query Frame = 2
Query: 3527 RKRRPSIGQKFSSVLRISRKSNSTSNLE------KKARTSFQRSEEVVPAHIKISTE-HNRVNIMTYNKCESAPVTNFGNDSDL-FQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +KRR SIG K ++V+ +SRKS S S L       KK R++ QRS E       ++ E  NR+      +     + +F ++ +L F    L                          +D+Q   F++GLGP QLVGRQ L  P +G++Q+  ++KKG L++EVIRARGL  K  SK LP PYVK+YL++    I K+KT ++ R+TLDPLYQQQLSF     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD S++V GW+KL+   +   P  A  TRR S SS+
Sbjct: 1148 KKRRSSIGAKMAAVVGMSRKSRSASQLSQTEAGGKKLRSTIQRSTET-----GLAVEMRNRMTRQASRESTDGSMNSFNSEGNLIFPGVRLS-------------------------SDSQFSDFLDGLGPAQLVGRQTLATPPMGDIQIGMVEKKGALEVEVIRARGLVGKPGSKALPAPYVKVYLLENGACIAKKKTKVA-RKTLDPLYQQQLSFEESPGGKVLQIIVWGDYGRMDHKSFMGAVQILLDELDLSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL 1404          

HSP 2 Score: 163.696 bits (413), Expect = 4.814e-40
Identity = 132/438 (30.14%), Postives = 213/438 (48.63%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSE--------RDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLG-------TSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + S R K+E++ RNDSLSSD SE+       P K        K++Q S SSSE++L T+ E TS +D E+E +S+SE        R        L    +K  R     S ++D+   E   ++   +  S   +T           +PVTW+PSKDG RLIG ++L K  +D S      A+LGLKV GGK+T +G+  A+ITKV+  S+ADTVGHL  GD+V+EWN ++ +G T  EV  II ESK E  +EL+V R I    +  +S  +      ++    + +   I    P+S           S  + ++L+Y+ +  + +V ++ A +L       P N      F+       KR +  +  ++ P W+Q F++  +     +   L  T++    +  + +    E++I+L  A   +  + Y L  +
Sbjct:  430 RKSKREKMESMLRNDSLSSDQSESVRPPPPKPHKSKR---GGKMRQVSLSSSEEELATTPEYTSCEDVEIESESVSEKGDSQREKRKTIEQAHILSEGQKKMVRF-WGHSMEEDAEWCEPQVKDSGVDTCS---STTLNEEHSHSEKHPVTWQPSKDGDRLIGRILLNKRMKDGSVPRDSGALLGLKVVGGKMTESGRLCAFITKVRKGSLADTVGHLRPGDQVLEWNGRNLQGATFKEVYNIILESKPEPQVELVVSRPIGDIPRIPDSAHTQLESSSSSFESQKMERPSISVTSPMSPGMLRDAPQYLSGQLSVKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKSKRRTKTVKKSLEPKWNQTFMYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALMDDEPHWYKLQTH 860          

HSP 3 Score: 79.337 bits (194), Expect = 2.897e-14
Identity = 48/144 (33.33%), Postives = 73/144 (50.69%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEE------KMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK-RMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II DV+ RQKR++ +   +L+   ++      ++++++  S T        +PE       Q      C +C  TKFAD  G  C  C  K C+RCG  V +  N +   + W C  C+K+    EIL K+ 
Sbjct:   19 PDLSHLTEEERKIIQDVMDRQKREEEKEQSMLKKLHQQFESYKDQVKKMADESQT--------TPE-------QKTDAPTCGICHKTKFADGCGHLCSYCQTKFCARCGGRVSLRSNKEDNTVMWVCNLCRKQQ---EILTKSG 144          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Match: rims1a (regulating synaptic membrane exocytosis 1 [Source:NCBI gene;Acc:103030767])

HSP 1 Score: 202.216 bits (513), Expect = 6.995e-52
Identity = 119/291 (40.89%), Postives = 162/291 (55.67%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRI-SRKSNSTSNLEK--------KARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDL-FQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            G+KRR S+  +  +++ I SR+S STS L +        K  +  QRS+E     + +    N +      +     + ++ ++ +L F    L                           DNQ   F++GLGP QLVGRQ L  PS+G++Q+  I+KKG+L++EVIRARGLTPK  SK LP PYVK+YL+D      K+KT ++ R+TLDPLYQQ L F     GKVLQ  VWG+Y RMD K FMG  +ILL++LD SS V GWYKL+   +   P  A  TRR S SS+
Sbjct: 1283 GKKRRSSLSARVVAIVGIPSRRSRSTSQLSQTEAANKKTKGSSQIQRSQET---GMAVEYPRNAMARQASRESTDGSMNSYSSEGNLIFSGMRLG-------------------------ADNQFSDFLDGLGPAQLVGRQTLATPSMGDVQIGLINKKGQLEVEVIRARGLTPKPGSKSLPAPYVKVYLLDNGQCKAKKKTKIA-RKTLDPLYQQTLLFEESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSTVIGWYKLFPPSSLVDPTLAPLTRRASQSSL 1544          

HSP 2 Score: 153.68 bits (387), Expect = 5.759e-37
Identity = 133/438 (30.37%), Postives = 207/438 (47.26%), Query Frame = 2
Query: 1427 KTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRK--LKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSER---DIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNI-DGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQ-------IRLFYNPIEMEFVVHLVSATNLIP--------PNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLY 2674
            + + R K E++ RNDSLSSD SE+     + P     Y   R    +Q S SSSE++  ++ E TS +D  +EI+S+SER   + YP    LDP+                                         W      ++PVTW+PSK+G  LIG + L K T      E G A+LGLKV GGK+T  G+  A+ITKVK  S+AD VGHL +GDEV++WN KS  GLT  EV  II +S++E  +EL+V R I D    P+ S   L+    ++    + +   I    P S  G     Q       ++++Y+ +  + +V+++ A  L P        P    Y  F+       KR +  +  ++ P W+Q FV+  +     + + L  TV+    I ++ +    E++I+L  A   ++ + Y +  +
Sbjct:  486 RKAKREKAESMLRNDSLSSDQSES-----LRPPPPRPYKSKRGSNKRQMSVSSSEEEGGSTPEYTSCED--VEIESVSERGDWECYP----LDPTV----------------------------------------W------HHPVTWQPSKEGDHLIGRITLSKRT--AMPKEAG-ALLGLKVVGGKITETGRLGAFITKVKKGSLADVVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILDSQMEPQVELVVSRPIGDIPRIPETSHPPLESTGSSSFESQKMERPSISVLSPSSPSGLRDAPQLLPGQLSVKMWYDKVGHQLIVNVLQAKELPPRLDGRPRNPYVKMY--FLPDRSDKSKRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPKIQDEESDFLGEILIELETALLDDKPHWYKMQTH 861          

HSP 3 Score: 78.9518 bits (193), Expect = 4.466e-14
Identity = 53/163 (32.52%), Postives = 76/163 (46.63%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPES--IFLGSQQGNYGE----------------------VCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSK--RMLKWCCRNCKKRDDKPEILIKTS 745
            PDLSHL+E ER+II  V+ RQK ++ +   +LR  +E+ +Q     + TV      K P+   I +  Q  +Y E                       C +C  TKFAD  G  C  C  K C+RCG  V +  N+K  + + W C  C+K+ D   IL K+ 
Sbjct:   24 PDLSHLTEEERQIIMAVMVRQKEEEAKEQAMLR--EEKPIQ-----AKTVNLVGNKKPPQQNDISMHQQVASYKEQVRRIAQEPQQRQQGQHKDDAPTCGICHKTKFADGCGNLCSYCQTKFCARCGGRVSLRSNNKEDKRVMWVCNQCRKQQD---ILTKSG 176          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001274.1 (pep scaffold:Pmarinus_7.0:GL477827:23271:30299:-1 gene:ENSPMAG00000001145.1 transcript:ENSPMAT00000001274.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.43 bits (485), Expect = 2.336e-55
Identity = 91/162 (56.17%), Postives = 121/162 (74.69%), Query Frame = 2
Query: 3863 QVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRR 4348
            Q+  F++GLGP QLVGRQ L  P++GE+Q+S IDKKG+L++EVIRA+GL  KA++K LP PYVK+YL++    I K+KT ++ R+TLDPLYQQ L F+    GKVLQ  VWG+Y RMD KSFMG  +ILL++LD S++V GWYKL+ + +   P  A  TRR
Sbjct:   59 QISDFLDGLGPAQLVGRQTLATPAMGEIQISMIDKKGQLEVEVIRAKGLVAKASAKTLPAPYVKVYLLESGICIGKKKTKIA-RKTLDPLYQQPLLFTDGPQGKVLQVIVWGDYGRMDHKSFMGVAQILLEELDLSNMVIGWYKLFPTSSLVDPTIAPLTRR 219          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001439.1 (pep scaffold:Pmarinus_7.0:GL476337:947677:1015027:-1 gene:ENSPMAG00000001272.1 transcript:ENSPMAT00000001439.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.2 bits (487), Expect = 1.904e-49
Identity = 106/269 (39.41%), Postives = 155/269 (57.62%), Query Frame = 2
Query: 3524 GRKRRPSIGQKFSSVLRISRKSNS----TSNLEKKARTSFQRSEEVVPAHI---KISTEHNRVNIMTYNKCESA---PVTNFGNDSDLFQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLY 4300
            G+KRRP++G K  +++ +  +S S    T +  +K R++ +RS E   A     +++ + +  + +T    E +   P   FG  +                                     Q+  F++GLGP QLVGRQ L  P +GE+Q+S +DKKG+L++EVIRA+GL  K +SK LP PYVK+YL++   +I K+KT ++ R+TLDPLYQQ L F    SGKVLQ  VWG+Y RMD KSFMG   I+L++LD S++V GWYKL+
Sbjct: 1353 GKKRRPNLGSKMVAMVGLRSRSASQITQTDSSGRKLRSTVKRSTETGMATTLRSQLTRQESTDDSITSGMSEGSLMFPGLMFGGGA-------------------------------------QITDFLDGLGPAQLVGRQTLATPPMGEIQISMVDKKGQLEVEVIRAKGLFAKPSSKTLPAPYVKVYLLENGAVIAKKKTKIA-RKTLDPLYQQPLVFEQSPSGKVLQVIVWGDYGRMDHKSFMGAARIVLEELDLSNMVIGWYKLF 1583          

HSP 2 Score: 100.138 bits (248), Expect = 2.736e-21
Identity = 114/452 (25.22%), Postives = 187/452 (41.37%), Query Frame = 2
Query: 1439 RRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNN--------PVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLK-VNGGKLTVAGQRRAYIT----KVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPIS------NLGTSSTIQIRLFYNPIEMEFVVHLVSATNLI------PPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAP-TAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPI 2716
            R K E++ RNDSLSSD SE+  R      K H      + +  S SSSE++L ++ EC+S +D E+E                                               SE  ++  N +Y WL +   +N        PVTW+PS +G RLIG ++L K   + +  +   A+LGLK +   K T      A+ T    K K + I + +      DEV+EWN +S +G T  EV  II ESK E  +EL+V R I    +  + T   +    ++    + + + I    P S             + I+L+Y+ +  + VV  + AT+L       P N      F+       KR +  +  ++ P W+Q F +  +     + + L  T++       + +    E++I+L  A   +  + Y L   +D     +  P+P 
Sbjct:  422 RGKPESVLRNDSLSSDQSESM-RPPPPQPKPHRVRKGGRRRHKSVSSSEEELASTPECSSCEDAEVE-----------------------------------------------SEGFAERGNLDYYWLEHSSWHNDGSSTPAQPVTWQPSNEGDRLIGKIVLNKTLTESAMPKDSGALLGLKRILFWKKTNMVFMLAFCTTLHIKGKLQCILNRIHEW---DEVLEWNGQSLQGATFQEVYNIILESKPEPLVELLVSRPIGDLPRIPDGTHGHQESSSSSFESQKLERRSISLNTPTSPGLRDVPQTMPGRLSIKLWYDKVGFQLVVTTLGATDLPLRDDGQPRNPYIKIYFLPDRSDKSKRRTTTVGRSLEPQWNQTFAYCPVQRREFREHMLELTLWDQQRSPGEESVFLGEILIELETALLDDNPHWYKLQ-SHDPSSLPLPQPSPF 821          

HSP 3 Score: 54.6842 bits (130), Expect = 1.865e-7
Identity = 24/76 (31.58%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  524 LGS-QQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNS-KRMLKWCCRNCKKRDDKPEILIKTS 745
            LG+ +Q +    C +C  TKFA+  G  C  C  + C+RCGF   +   +   ++ W C  C+K+ D   +L+K+ 
Sbjct:   24 LGTIEQKDEAPTCGICHKTKFAEGCGNVCSYCQTRFCARCGFRFALRPGTIPNIVMWLCTRCRKQQD---LLVKSG 96          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002750.1 (pep scaffold:Pmarinus_7.0:GL476598:410398:413378:1 gene:ENSPMAG00000002507.1 transcript:ENSPMAT00000002750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 1.698e-48
Identity = 81/170 (47.65%), Postives = 113/170 (66.47%), Query Frame = 2
Query: 3857 DNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            D+Q   F++GLGP ++VGRQ L     G++Q+  +D+ G L++E++RARGL+ K  SK  P PYVK+YL++    + K+KT ++ RR+LDP+YQQ   F     GKVLQ  VWG+Y RMD K FMG  ++LL+DLD SS V GWYKL+ + +   P  A   RR S SS+
Sbjct:   16 DSQFSDFLDGLGPNEMVGRQTLATHCSGDIQVGMVDRTGHLEVEIVRARGLSAKRGSKSPPAPYVKLYLLESGTCLAKKKTKVA-RRSLDPVYQQHFIFEENPHGKVLQIIVWGDYGRMDNKCFMGAAQVLLEDLDLSSAVIGWYKLFPTFSLVDPTLAQVARRPSQSSL 184          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005024.1 (pep scaffold:Pmarinus_7.0:GL478469:55581:62474:-1 gene:ENSPMAG00000004561.1 transcript:ENSPMAT00000005024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 2.880e-25
Identity = 56/114 (49.12%), Postives = 78/114 (68.42%), Query Frame = 2
Query: 1844 NPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNI 2185
            +PVTW+PS++G RLIG ++L K  +D S      A+LGLKV GGK+T  G+  A+ITKVK  S+AD +G L +GDEV+EWN +  RG + +EV  II +SK    +EL+V R +
Sbjct:  402 HPVTWQPSREGDRLIGRIVLNKRLKDGSVPRDSGAVLGLKVVGGKMTEPGKLCAFITKVKRGSLADIMGRLQAGDEVLEWNGRLLRGASFEEVYNIILQSKPSPQVELLVARPL 515          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004426.1 (pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941:1 gene:ENSPMAG00000004026.1 transcript:ENSPMAT00000004426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 6.704e-10
Identity = 43/137 (31.39%), Postives = 66/137 (48.18%), Query Frame = 2
Query: 3929 PSLGE--LQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNII--------EKQKTLLSPRRTLDPLYQQQLSFSS----EYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKL 4297
            P  GE  LQ+SF    G L I V++ARGL P+ N+     P+VK+YL+ G+  +        E ++      +TL+P + Q + + +    E   K L+ +VW +Y R     F+G   I L D+        WY L
Sbjct:  158 PITGEIQLQMSFDRHSGNLIIHVLQARGLAPRDNNG-FSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVW-DYDRFSSNDFLGEVRIELSDVSHLDGAQRWYPL 292          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Match: EDO42812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0C7])

HSP 1 Score: 162.155 bits (409), Expect = 8.502e-46
Identity = 87/151 (57.62%), Postives = 115/151 (76.16%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSS 4306
            N+  +G F+EGLGP Q+VGRQVL  PS+G++QL    +KG L++EVIRA+GL PK  +K+LP PYVK+Y+M+GK  I K+KT  + RRTL+PLYQQ L F  + +GK LQ  VWG+Y RMD+K FMG  +ILLDDLD S++  GWYKL+S+
Sbjct:    7 NEGHLGDFIEGLGPSQMVGRQVLASPSMGDIQLGLCYRKGALEVEVIRAKGLLPKPGTKILPAPYVKVYVMEGKKCIAKKKTRTT-RRTLEPLYQQMLDFRVDINGKTLQIIVWGDYGRMDRKVFMGVVQILLDDLDLSNLCMGWYKLFST 156          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Match: EDO42811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0C6])

HSP 1 Score: 65.4698 bits (158), Expect = 1.042e-12
Identity = 39/108 (36.11%), Postives = 58/108 (53.70%), Query Frame = 2
Query:  335 PDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEI 658
            PDLSHL+E ER II +V+ RQK  + +  ++    Q+  ++EV+     +E+   +   E +    +Q N   VC +C  TKF +  GK C  C  K C+RCG  V I
Sbjct:   13 PDLSHLTEEERHIILEVMNRQKSLEAQTQEM----QKSMLKEVASFQNQLEKKTDM---EVVNPQVKQEN---VCEICNKTKFTEGTGKECKYCKLKCCARCGMEVTI 110          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Match: EDO45977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA6])

HSP 1 Score: 61.6178 bits (148), Expect = 2.932e-9
Identity = 40/124 (32.26%), Postives = 70/124 (56.45%), Query Frame = 2
Query: 3938 GELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFS----SEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKL 4297
            G+++LS   ++G L + V+ A+ L+ + NS     PYVK+YL+   +   K KT ++ +++ +P Y + L +S    ++   + LQ TVW ++ R+ +  FMG   I L D+D S  +  WY L
Sbjct: 1185 GQIKLSIRHERGALRVMVMHAKDLSSR-NSSTAGDPYVKLYLLPDPSKTTKLKTKIA-KKSQNPTYNETLVYSNLSAADLKTRHLQVTVW-DHDRVGENDFMGGVVINLADMDSSINITNWYPL 1305          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:NCBI gene;Acc:101161919])

HSP 1 Score: 194.897 bits (494), Expect = 2.926e-55
Identity = 94/171 (54.97%), Postives = 120/171 (70.18%), Query Frame = 2
Query: 3854 NDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            +D Q   F++GLGP QLVGRQ L  PS+G++Q+  +DKKG L++E+IRAR L  K  SK LP PYVK+YL++    I K+KT ++ R+TLDPLYQQQL F     GKVLQ  VWG+Y RMD KSFMG  +ILLD+LD S++V GWYKL+   +   P  A  TRR S SS+
Sbjct:  103 SDAQFSDFLDGLGPAQLVGRQTLATPSMGDIQIGMVDKKGALEVEIIRARSLVGKPGSKALPAPYVKVYLLENGVCIAKKKTKVA-RKTLDPLYQQQLPFEESPGGKVLQVIVWGDYGRMDHKSFMGAVQILLDELDLSNMVIGWYKLFPPSSLVDPTLAPLTRRASQSSL 272          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: ENSORLT00000046772.1 (pep primary_assembly:ASM223467v1:15:8619843:8632377:-1 gene:ENSORLG00000024560.1 transcript:ENSORLT00000046772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 7.313e-55
Identity = 92/170 (54.12%), Postives = 122/170 (71.76%), Query Frame = 2
Query: 3857 DNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            D+Q   F++GLGPGQLVGRQ L  P++G++Q+  +DKKG+L++EVIRARGLTPK+ SK LP PYVK+YL+D      K+KT ++ R+TL+PLYQQ L F     GKVLQ  VWG+Y R+D K FMG  +ILL++LD SS V GWYKL+ + +   P  A  TR  S +S+
Sbjct:   67 DSQFSDFLDGLGPGQLVGRQTLATPAMGDVQIGLMDKKGQLEVEVIRARGLTPKSGSKSLPAPYVKVYLLDNGTCKAKKKTKIA-RKTLEPLYQQHLLFDESPQGKVLQVIVWGDYGRLDHKCFMGVAQILLEELDLSSTVIGWYKLFPTSSLVDPTLAPLTRLASQTSL 235          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: ENSORLT00000033249.1 (pep primary_assembly:ASM223467v1:15:8619843:8634743:-1 gene:ENSORLG00000024560.1 transcript:ENSORLT00000033249.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 1.266e-54
Identity = 92/170 (54.12%), Postives = 122/170 (71.76%), Query Frame = 2
Query: 3857 DNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            D+Q   F++GLGPGQLVGRQ L  P++G++Q+  +DKKG+L++EVIRARGLTPK+ SK LP PYVK+YL+D      K+KT ++ R+TL+PLYQQ L F     GKVLQ  VWG+Y R+D K FMG  +ILL++LD SS V GWYKL+ + +   P  A  TR  S +S+
Sbjct:   84 DSQFSDFLDGLGPGQLVGRQTLATPAMGDVQIGLMDKKGQLEVEVIRARGLTPKSGSKSLPAPYVKVYLLDNGTCKAKKKTKIA-RKTLEPLYQQHLLFDESPQGKVLQVIVWGDYGRLDHKCFMGVAQILLEELDLSSTVIGWYKLFPTSSLVDPTLAPLTRLASQTSL 252          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: ENSORLT00000031732.1 (pep primary_assembly:ASM223467v1:15:8619843:8635222:-1 gene:ENSORLG00000024560.1 transcript:ENSORLT00000031732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 2.980e-54
Identity = 92/170 (54.12%), Postives = 122/170 (71.76%), Query Frame = 2
Query: 3857 DNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLSTSSI 4366
            D+Q   F++GLGPGQLVGRQ L  P++G++Q+  +DKKG+L++EVIRARGLTPK+ SK LP PYVK+YL+D      K+KT ++ R+TL+PLYQQ L F     GKVLQ  VWG+Y R+D K FMG  +ILL++LD SS V GWYKL+ + +   P  A  TR  S +S+
Sbjct:  115 DSQFSDFLDGLGPGQLVGRQTLATPAMGDVQIGLMDKKGQLEVEVIRARGLTPKSGSKSLPAPYVKVYLLDNGTCKAKKKTKIA-RKTLEPLYQQHLLFDESPQGKVLQVIVWGDYGRLDHKCFMGVAQILLEELDLSSTVIGWYKLFPTSSLVDPTLAPLTRLASQTSL 283          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Match: ENSORLT00000047013.1 (pep primary_assembly:ASM223467v1:15:8618697:8642502:-1 gene:ENSORLG00000024560.1 transcript:ENSORLT00000047013.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 4.255e-54
Identity = 114/282 (40.43%), Postives = 161/282 (57.09%), Query Frame = 2
Query: 3527 RKRRPSIGQKFSSVLRISRKSNSTSNLEKKA--------RTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDL-FQEESLKQVXXXXXXXXXXXXXXXXXXXXXXLNDNQVGVFVEGLGPGQLVGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVKIYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEYSRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTR 4345
            +KRR S+ Q+  ++L  SR+S STS L + A         +S QRS E   A ++     + +N     +     + ++ ++ +L F    L                           D+Q   F++GLGPGQLVGRQ L  P++G++Q+  +DKKG+L++EVIRARGLTPK+ SK LP PYVK+YL+D      K+KT ++ R+TL+PLYQQ L F     GKVLQ  VWG+Y R+D K FMG  +ILL++LD SS V GWYKL+ + +   P  A  TR
Sbjct:   47 KKRRSSLSQRVVAILP-SRRSRSTSQLSQTAGKKASKTGSSSIQRSVETGMA-VEYPRGGSAMNRQASRESTDGSMNSYSSEGNLIFSGMRLGA-------------------------DSQFSDFLDGLGPGQLVGRQTLATPAMGDVQIGLMDKKGQLEVEVIRARGLTPKSGSKSLPAPYVKVYLLDNGTCKAKKKTKIA-RKTLEPLYQQHLLFDESPQGKVLQVIVWGDYGRLDHKCFMGVAQILLEELDLSSTVIGWYKLFPTSSLVDPTLAPLTR 300          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000037636.1 (SMESG000037636.1)

HSP 1 Score: 2244.16 bits (5814), Expect = 0.000e+0
Identity = 1159/1160 (99.91%), Postives = 1159/1160 (99.91%), Query Frame = 2
Query:  305 MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGXXXXXXXXXXXXXRNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPXXXXXXXXXXXIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRXXXXXXXXXXXTYNKELSAXXXXXXXXXXXXKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYXXXXXXXXXXXXXXXXXHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 3784
            MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNS ESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV
Sbjct:    1 MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSAESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 1160          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000037636.1 (SMESG000037636.1)

HSP 1 Score: 2243.77 bits (5813), Expect = 0.000e+0
Identity = 1159/1160 (99.91%), Postives = 1159/1160 (99.91%), Query Frame = 2
Query:  305 MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGXXXXXXXXXXXXXRNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPXXXXXXXXXXXIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRXXXXXXXXXXXTYNKELSAXXXXXXXXXXXXKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYXXXXXXXXXXXXXXXXXHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 3784
            MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNS ESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV
Sbjct:    1 MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSAESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 1160          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000037636.1 (SMESG000037636.1)

HSP 1 Score: 2243.77 bits (5813), Expect = 0.000e+0
Identity = 1159/1160 (99.91%), Postives = 1159/1160 (99.91%), Query Frame = 2
Query:  305 MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGXXXXXXXXXXXXXRNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPXXXXXXXXXXXIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRXXXXXXXXXXXTYNKELSAXXXXXXXXXXXXKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYXXXXXXXXXXXXXXXXXHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 3784
            MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNS ESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV
Sbjct:    1 MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSAESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 1160          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000037636.1 (SMESG000037636.1)

HSP 1 Score: 2240.69 bits (5805), Expect = 0.000e+0
Identity = 1159/1160 (99.91%), Postives = 1159/1160 (99.91%), Query Frame = 2
Query:  305 MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGXXXXXXXXXXXXXRNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPXXXXXXXXXXXIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRXXXXXXXXXXXTYNKELSAXXXXXXXXXXXXKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYXXXXXXXXXXXXXXXXXHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 3784
            MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNS ESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV
Sbjct:    1 MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKMQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSAESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 1160          
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Match: SMESG000037636.1 (SMESG000037636.1)

HSP 1 Score: 2142.08 bits (5549), Expect = 0.000e+0
Identity = 1110/1111 (99.91%), Postives = 1110/1111 (99.91%), Query Frame = 2
Query:  452 MQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGXXXXXXXXXXXXXRNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPXXXXXXXXXXXIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRXXXXXXXXXXXTYNKELSAXXXXXXXXXXXXKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYXXXXXXXXXXXXXXXXXHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 3784
            MQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNS ESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV
Sbjct:    1 MQEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKSCFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTTRSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKLSNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIYSQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAINRNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNILVNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAASRKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLSERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQNTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAILGLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRGLTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSAESLKCEIKNNCGYPEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPNFTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLVSTVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDTPTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDYEGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSRKSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESDRVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSYQQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDLELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSNLEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSDLFQEESLKQV 1111          
The following BLAST results are available for this feature:
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIMS21.579e-5353.80regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS22.437e-5240.28regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS13.157e-5253.53regulating synaptic membrane exocytosis 1 [Source:... [more]
RIMS21.555e-5140.14regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS22.032e-5156.38regulating synaptic membrane exocytosis 2 [Source:... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-102.499e-3746.02Rab-3-interacting molecule unc-10 [Source:UniProt... [more]
unc-104.186e-2548.21Rab-3-interacting molecule unc-10 [Source:UniProt... [more]
cla-18.669e-937.33CLArinet, functional homolog of cytomatrix at the ... [more]
cla-18.669e-937.33CLArinet, functional homolog of cytomatrix at the ... [more]
cla-11.713e-837.33CLArinet, functional homolog of cytomatrix at the ... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rim3.360e-5358.38gene:FBgn0053547 transcript:FBtr0336720[more]
Rim3.360e-5358.38gene:FBgn0053547 transcript:FBtr0336717[more]
Rim3.438e-5358.38gene:FBgn0053547 transcript:FBtr0336719[more]
Rim3.598e-5362.09gene:FBgn0053547 transcript:FBtr0336715[more]
Rim3.657e-5362.09gene:FBgn0053547 transcript:FBtr0336723[more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rims2a9.697e-6042.01regulating synaptic membrane exocytosis 2a [Source... [more]
rims2a4.595e-5654.97regulating synaptic membrane exocytosis 2a [Source... [more]
rims1a1.062e-5340.82regulating synaptic membrane exocytosis 1a [Source... [more]
rims1b1.361e-5353.49regulating synaptic membrane exocytosis 1b [Source... [more]
rims1a3.743e-5340.82regulating synaptic membrane exocytosis 1a [Source... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
amotl12.272e-5341.67angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
amotl12.523e-5341.67angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
amotl12.772e-5341.67angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
amotl12.839e-5341.67angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
amotl12.970e-5341.67angiomotin like 1 [Source:Xenbase;Acc:XB-GENE-9936... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rims23.406e-5353.22regulating synaptic membrane exocytosis 2 [Source:... [more]
Rims21.626e-5240.14regulating synaptic membrane exocytosis 2 [Source:... [more]
Rims22.099e-5240.28regulating synaptic membrane exocytosis 2 [Source:... [more]
Rims22.393e-5240.28regulating synaptic membrane exocytosis 2 [Source:... [more]
Rims22.923e-5240.28regulating synaptic membrane exocytosis 2 [Source:... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9EQZ7|RIMS2_MOUSE2.044e-5140.28Regulating synaptic membrane exocytosis protein 2 ... [more]
sp|Q9JIS1|RIMS2_RAT3.208e-5140.63Regulating synaptic membrane exocytosis protein 2 ... [more]
sp|Q9UQ26|RIMS2_HUMAN2.144e-4853.80Regulating synaptic membrane exocytosis protein 2 ... [more]
sp|Q86UR5|RIMS1_HUMAN5.802e-4839.02Regulating synaptic membrane exocytosis protein 1 ... [more]
sp|Q9JIR4|RIMS1_RAT4.874e-4739.15Regulating synaptic membrane exocytosis protein 1 ... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZTA67.289e-7553.19Regulating synaptic membrane exocytosis protein 1 ... [more]
G7YTV42.101e-7456.60Regulating synaptic membrane exocytosis protein 2 ... [more]
A0A4S2M6M06.680e-7456.23Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075AH133.571e-7356.23Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A5K3EKP21.237e-7250.87Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIMS21.178e-5554.97regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS25.603e-5542.71regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS25.860e-5542.71regulating synaptic membrane exocytosis 2 [Source:... [more]
RIMS26.259e-5542.71regulating synaptic membrane exocytosis 2 [Source:... [more]
rims1a6.995e-5240.89regulating synaptic membrane exocytosis 1 [Source:... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001274.12.336e-5556.17pep scaffold:Pmarinus_7.0:GL477827:23271:30299:-1 ... [more]
ENSPMAT00000001439.11.904e-4939.41pep scaffold:Pmarinus_7.0:GL476337:947677:1015027:... [more]
ENSPMAT00000002750.11.698e-4847.65pep scaffold:Pmarinus_7.0:GL476598:410398:413378:1... [more]
ENSPMAT00000005024.12.880e-2549.12pep scaffold:Pmarinus_7.0:GL478469:55581:62474:-1 ... [more]
ENSPMAT00000004426.16.704e-1031.39pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO428128.502e-4657.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428111.042e-1236.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459772.932e-932.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIMS22.926e-5554.97regulating synaptic membrane exocytosis 2 [Source:... [more]
ENSORLT00000046772.17.313e-5554.12pep primary_assembly:ASM223467v1:15:8619843:863237... [more]
ENSORLT00000033249.11.266e-5454.12pep primary_assembly:ASM223467v1:15:8619843:863474... [more]
ENSORLT00000031732.12.980e-5454.12pep primary_assembly:ASM223467v1:15:8619843:863522... [more]
ENSORLT00000047013.14.255e-5440.43pep primary_assembly:ASM223467v1:15:8618697:864250... [more]
back to top
BLAST of Regulating synaptic membrane exocytosis protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037636.10.000e+099.91SMESG000037636.1[more]
SMESG000037636.10.000e+099.91SMESG000037636.1[more]
SMESG000037636.10.000e+099.91SMESG000037636.1[more]
SMESG000037636.10.000e+099.91SMESG000037636.1[more]
SMESG000037636.10.000e+099.91SMESG000037636.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024025 ID=SMED30024025|Name=Regulating synaptic membrane exocytosis protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=4475bp
ATATGCCGAAAATTTTTTTTCCTCATTTTATTTCCTATCCTTGAACTGCC
AGTAACAATTCAGGTTTCTCTTTCCTATTATTTCTTTCTATCAATGTATT
TCGTTTATGTATGTGAATAGGAAAATGTTTGATAGTGGCTGTTTGTGACG
TAGATATTAGAATTTCATCACCAAAACACTTACTCTCTTTCGTAGCTGTA
TTTAGAACTTCTTGTCTATTAACATTCTACGAGATTTCTTGTCTGATTAA
CTGATGGTCGACGGTTCTTCATGATTATTACAAAGATATGAACTTCAGTT
TAATATGGCAGCAGAAGTTGGTATTGATTCCGATCCAGATCTTTCACATT
TGAGTGAATCTGAACGTAGGATTATCTTCGATGTTCTTCAGAGACAAAAG
CGAGATGATATTGAAAATGATAAAATCCTTCGAAATAAGCAAGAAGAGAA
AATGCAAGAGGTCTCTCCAAGTTCAACAACAGTAGAGCGAAATCTTATGA
TTAAGTCTCCAGAATCTATTTTTCTGGGGAGCCAACAAGGAAATTATGGA
GAAGTCTGTCATGTTTGTCAGGTAACAAAATTTGCCGATTCTGCAGGTAA
AAGTTGTTTTCTATGTTCCAATAAAGCCTGCTCAAGATGTGGATTTAGTG
TGGAGATTTTACAAAATTCCAAACGAATGCTAAAATGGTGTTGTAGAAAT
TGTAAGAAAAGAGATGATAAGCCAGAAATTCTGATTAAGACATCAAGAAC
GACACGTTCTAGTAATATCGACTTGACAGATCTTGACATTGGGATACCTT
CTCCTTCAATACCGTCAAAGCCAGAATCGGAAAGAAACAAAATGAAAGCC
AACGATTATGATTTAACTCGAATAGATAGGAAAATATCTTGTCCTGTTAA
ATTATCAAATTTTGATGATCTCTTAGATCCTAAATTAGAAGGTAAATTCT
TTCCGGAAGAGGATGAAGAGGAAGAGGAAGAAGAAGAAATACAGCAGCAA
ATGAAAAAGGATAAAGTGTATGAATATTCAGAAATTTCAGACAAACTCAT
CTATTCACAAGCTCAATTCTATTGTGGCGATGTCACTCCACTCCCTGAAA
AACAAGTTAAGTCTCACTTCAAATATACCAATACCCCAATGGAAATGTCA
CGGTCTCCAGTATTAGTAGATTGTGGATTTATGTACAATGACGGAGCTAT
AAATCGAAATGATTTTCCGGTTTACTCTCAAAATAATTGTCAGTCTTTCA
ATCGTATTCCCCGGGAAAATAACTCAAAAAATTTAATAATAAATGATCAC
TGTCGCTTCAACATGCAGCATGAACTGGCGGTTTCTCCCACAACAAATAT
TCTTGTAAATTCAAAGGAAATCTCAGCAAATGAATTTAATGCTGAATCTA
TTCCATATTTTAAGTCTAGACGAAATAAAACTTCGGCAAGAAGAAAACTC
GAAACTCTTTATCGAAACGATTCTTTGAGTTCCGATCCATCTGAAGCAGC
TTCTAGAAAAATCGTTTCTCCAACCAAACTTCACAGTTATTATCCAAATA
GAAAACTTAAACAAAACTCGTTTAGTAGTTCTGAAGATGATTTACCTACG
TCGATAGAATGTACAAGTGGTGACGACAAAGAGCTAGAAATTGACAGTTT
ATCTGAAAGAGATATTTACCCCACCAATCAATGGCTTGATCCTAGCAATA
GAAAATCCAGCCGTCTTGGACAAAACCGATCATTTGATAAAGACTCAGGA
ATATCCGAAGGCCATCACCGAGAATACAGTTCCGAAATGGTTTCGCAACT
GCAAAATACGAATTACAAATGGCTGCCTTATGAGGACCGAAATAATCCTG
TGACATGGAAACCTTCTAAGGACGGAAAACGGTTAATAGGTCACATGATA
CTCCGAAAATGTACTCAAGACTTATCAAATACTGAATGTGGATCTGCAAT
ACTAGGGTTGAAAGTAAATGGGGGAAAACTAACAGTTGCTGGTCAACGAA
GAGCGTATATAACAAAAGTAAAGCCTGAAAGTATTGCGGATACAGTTGGA
CATTTGTTATCAGGAGATGAAGTGATTGAATGGAATAATAAATCTTTCAG
GGGTTTAACAAATGACGAAGTGAATGAAATTATATCAGAATCAAAGCTCG
AAGGAAGCATTGAATTGATAGTTCAGAGGAATATTGATGGACAAAATAAA
CCTCAAAATTCCACGGAGTCTTTGAAATGCGAAATCAAAAATAATTGTGG
ATATCCAGAAAAAAAGCACAAATTTATTCAACAACCAGAACCGATATCAA
ACCTTGGAACTTCATCAACAATTCAGATAAGGTTGTTTTATAATCCGATT
GAGATGGAATTCGTCGTTCATTTGGTCAGTGCCACAAATTTGATACCCCC
CAATTTCACTCGTTATTCATGTTTTGTTCAATTTATTGTAGGATCTGAAA
AAAGAGAATCTGTAATAATATCTGATACGATTTCTCCTTTTTGGGATCAA
GATTTTGTATTTAAAGATATATCAGATCCGTATTTGAAGTCAAATGATTT
AGTTTCAACAGTTTTTTATTACGATCACATTTATAACAAATATGCTCCTA
CAGCTGAAGTAATAATTGATCTCAGCAGGGCTGATTTCTCTAACCGCCTG
TACAGCTACCCGTTGACATTGTACTACGATCAAATTGATAAGGATATAGA
CACACCAACACCGATTTATCGATCCTCAGCTGATTCGAGCATACATTCCT
CTTCAACTTATAATAAAGAATTATCAGCCATCAGTCCTCCTCCTATTCCA
GAGAGACGAAGTCCTAAAACTAAAGGCTTGGAAAATAACTTAGTACCTGA
TTATGAAGGCCTGAATAATCTACATATTTTCTGTGATTCCCCAATTCCGC
CATCAGAATATCGGAGCTGTTACTCTCGATATGATTCACCGACTCAAATA
GAGTCTCGAAAGGTTTTCAGTCCAAATTTTACAGAGAGCAACGTTTCCAG
TAGAAAGTCATCTGTTCAGATGTATCGAACACCGATGAACAATTGCTACG
AATACAGCTCTTCAAAACCTTACCGAAGAAGTTCTCAAGGCCGTCAGCAT
GTCTGCTATTCTCAGCGATCATCAAGCCAACGTCGTGACTCTGTAGAAAG
TGATAGGGTTCATCGTGTCATGCCTCGATGTTGTCCAAATGAATTCACAC
CTAGTGACGTAGGACCAGAATATATCCTTCCGATTGAATCCCCTAGCAAT
GAGTATCGGAGCTGCTCTGCAGTCAGATTTCACAAAAAACGCCAAGGCAG
TTATCAGCAGTCTGATAATTCAGATGAATTAGTTGCAAGTAAAAACGTAT
CAAATGAAACTTCAGAGCTACATTCTAATTCTGAACACTTTAAAAAAGAC
CATGAAGATAATTACAAACGGAAAGAATCGTTAACATCAAATGTATCAGA
TTTGGAATTGTTGCAAACAATACAATCAAGTGACGAAGGACCTCAAAGAC
TACCAGAAAGTCACCCTGATTGCGGCCGAAAACGCCGGCCAAGTATCGGC
CAAAAATTTAGCAGTGTTTTAAGAATTTCCAGAAAAAGCAATAGCACTTC
AAATCTGGAAAAAAAAGCGAGAACATCTTTTCAGAGAAGTGAAGAAGTTG
TTCCAGCTCATATTAAAATTTCGACAGAACATAACAGAGTTAATATTATG
ACGTATAACAAATGTGAAAGTGCCCCTGTAACTAACTTTGGAAATGATTC
TGATTTATTTCAAGAAGAGTCATTAAAACAAGTTAATAGAAAATCTAGAT
CTAAGTCTACAACAAAATCAAAAACATCCAATAACCAAAAACCATCAAGT
CTGAATGACAATCAAGTTGGTGTTTTTGTTGAAGGTTTAGGTCCAGGACA
GCTTGTTGGAAGACAGGTTTTAGGAATGCCTTCATTAGGAGAATTACAAC
TAAGTTTTATTGACAAAAAAGGTCGACTCGATATCGAAGTTATTCGAGCT
AGAGGACTTACTCCTAAAGCAAACTCAAAGGTTTTACCACAACCATATGT
TAAGATATATTTAATGGATGGTAAAAATATAATTGAAAAACAAAAGACTC
TCCTTTCACCACGTCGTACTCTCGATCCACTTTATCAGCAACAATTGTCA
TTTTCCTCAGAATACTCAGGCAAAGTTCTGCAGGCCACCGTTTGGGGAGA
ATACAGCAGAATGGACAAAAAATCCTTTATGGGTCGCTGTGAAATACTTC
TTGATGACCTCGATTTTTCATCTATTGTGTTTGGCTGGTACAAACTATAT
AGTTCAATTGCTTCAGAATTGCCACATCCTGCAGTGCAAACCAGGCGCCT
ATCGACATCCTCTATAGGGAAATAGTAATCGAATCTCAATCAATTGTTTT
CATTGAATAAATCACTAAGAGTCACATTGTTACTATCCATCAGATCATTT
ATCAGATATAATTATAGATTTTATT
back to top

protein sequence of SMED30024025-orf-1

>SMED30024025-orf-1 ID=SMED30024025-orf-1|Name=SMED30024025-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1357bp
MAAEVGIDSDPDLSHLSESERRIIFDVLQRQKRDDIENDKILRNKQEEKM
QEVSPSSTTVERNLMIKSPESIFLGSQQGNYGEVCHVCQVTKFADSAGKS
CFLCSNKACSRCGFSVEILQNSKRMLKWCCRNCKKRDDKPEILIKTSRTT
RSSNIDLTDLDIGIPSPSIPSKPESERNKMKANDYDLTRIDRKISCPVKL
SNFDDLLDPKLEGKFFPEEDEEEEEEEEIQQQMKKDKVYEYSEISDKLIY
SQAQFYCGDVTPLPEKQVKSHFKYTNTPMEMSRSPVLVDCGFMYNDGAIN
RNDFPVYSQNNCQSFNRIPRENNSKNLIINDHCRFNMQHELAVSPTTNIL
VNSKEISANEFNAESIPYFKSRRNKTSARRKLETLYRNDSLSSDPSEAAS
RKIVSPTKLHSYYPNRKLKQNSFSSSEDDLPTSIECTSGDDKELEIDSLS
ERDIYPTNQWLDPSNRKSSRLGQNRSFDKDSGISEGHHREYSSEMVSQLQ
NTNYKWLPYEDRNNPVTWKPSKDGKRLIGHMILRKCTQDLSNTECGSAIL
GLKVNGGKLTVAGQRRAYITKVKPESIADTVGHLLSGDEVIEWNNKSFRG
LTNDEVNEIISESKLEGSIELIVQRNIDGQNKPQNSTESLKCEIKNNCGY
PEKKHKFIQQPEPISNLGTSSTIQIRLFYNPIEMEFVVHLVSATNLIPPN
FTRYSCFVQFIVGSEKRESVIISDTISPFWDQDFVFKDISDPYLKSNDLV
STVFYYDHIYNKYAPTAEVIIDLSRADFSNRLYSYPLTLYYDQIDKDIDT
PTPIYRSSADSSIHSSSTYNKELSAISPPPIPERRSPKTKGLENNLVPDY
EGLNNLHIFCDSPIPPSEYRSCYSRYDSPTQIESRKVFSPNFTESNVSSR
KSSVQMYRTPMNNCYEYSSSKPYRRSSQGRQHVCYSQRSSSQRRDSVESD
RVHRVMPRCCPNEFTPSDVGPEYILPIESPSNEYRSCSAVRFHKKRQGSY
QQSDNSDELVASKNVSNETSELHSNSEHFKKDHEDNYKRKESLTSNVSDL
ELLQTIQSSDEGPQRLPESHPDCGRKRRPSIGQKFSSVLRISRKSNSTSN
LEKKARTSFQRSEEVVPAHIKISTEHNRVNIMTYNKCESAPVTNFGNDSD
LFQEESLKQVNRKSRSKSTTKSKTSNNQKPSSLNDNQVGVFVEGLGPGQL
VGRQVLGMPSLGELQLSFIDKKGRLDIEVIRARGLTPKANSKVLPQPYVK
IYLMDGKNIIEKQKTLLSPRRTLDPLYQQQLSFSSEYSGKVLQATVWGEY
SRMDKKSFMGRCEILLDDLDFSSIVFGWYKLYSSIASELPHPAVQTRRLS
TSSIGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0017137Rab GTPase binding
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR036034PDZ_sf
IPR039032Rim-like
IPR000008C2_dom
IPR001478PDZ
IPR013083Znf_RING/FYVE/PHD
IPR011011Znf_FYVE_PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 685..785
e-value: 0.0099
score: 25.1
IPR000008C2 domainPFAMPF00168C2coord: 686..776
e-value: 3.4E-6
score: 27.3
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 548..627
e-value: 3.5E-11
score: 53.1
IPR001478PDZ domainPFAMPF00595PDZcoord: 548..621
e-value: 2.5E-7
score: 31.0
IPR001478PDZ domainPROSITEPS50106PDZcoord: 537..625
score: 12.808
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 665..790
e-value: 1.3E-11
score: 46.3
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 2..154
e-value: 4.6E-18
score: 67.0
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 508..628
e-value: 3.6E-27
score: 97.1
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 535..631
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 819..841
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 455..479
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 420..442
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1046..1064
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1013..1082
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1065..1079
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 455..495
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1156..1177
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1023..1045
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 918..952
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 918..942
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 550..624
e-value: 3.03561E-12
score: 61.4286
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 666..789
IPR039032Rim-likePANTHERPTHR12157RAB3 INTERACTING MOLECULE RIM -RELATEDcoord: 11..1170
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 14..135