Tubulin polyglutamylase TTLL5

Overview
NameTubulin polyglutamylase TTLL5
Smed IDSMED30023991
Length (bp)3790
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin polyglutamylase TTLL5 (SMED30023991) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin polyglutamylase TTLL5 (SMED30023991) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin polyglutamylase TTLL5 (SMED30023991) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin polyglutamylase TTLL5 (SMED30023991) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023991

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30023991SMESG000040121.1 SmedASXL_014898SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30023991SMESG000061253.1 SMESG000040121.1 dd_Smed_v4_6390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023991SMESG000061253.1 SMESG000040121.1 dd_Smed_v4_6390_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Human
Match: TTLL5 (tubulin tyrosine ligase like 5 [Source:HGNC Symbol;Acc:HGNC:19963])

HSP 1 Score: 513.457 bits (1321), Expect = 1.041e-159
Identity = 247/483 (51.14%), Postives = 345/483 (71.43%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVL---NNPNQPYLNSKVRS---------SNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRD---LSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  +A+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP       P  P   S  R+         S   QS+   +  + ++  ++ ++      R +    L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHADAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRASTRPIYPTFESSRRNPFQKPQRPVSAQFQSSKAKQRCRPLSASDAEMKNLVGSAREKGPGKLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 509          

HSP 2 Score: 89.3521 bits (220), Expect = 3.654e-17
Identity = 66/162 (40.74%), Postives = 98/162 (60.49%), Query Frame = 3
Query: 2289 RIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEE-SHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAI-----IDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            +I+Q  G L+K+QAR+AFS YL  VQ RL+ +   +  S S + KE    EQ+ELV+RFLKRA+ N+  +   +  +PSR   L +R+  LA  LG+FI +Y++ET   A  K  +         ++ ++F  F+R ASE +LE  L+ YT+ NKSA +FL 
Sbjct:  677 QILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKED---EQMELVVRFLKRASNNLQHSLRMV--LPSRRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVFLG 833          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Human
Match: TTLL5 (tubulin tyrosine ligase like 5 [Source:HGNC Symbol;Acc:HGNC:19963])

HSP 1 Score: 511.916 bits (1317), Expect = 4.125e-159
Identity = 249/477 (52.20%), Postives = 341/477 (71.49%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQP-YLNSKVRSSNYSQ--------STTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  +A+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP      +P Y   +    N  Q        S +D     ++ N   S R    G     L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHADAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRASTRPIYPTFESSRRNPFQKPQRCRPLSASD----AEMKNLVGSAREKGPG----KLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 495          

HSP 2 Score: 89.3521 bits (220), Expect = 3.472e-17
Identity = 66/162 (40.74%), Postives = 98/162 (60.49%), Query Frame = 3
Query: 2289 RIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEE-SHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAI-----IDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            +I+Q  G L+K+QAR+AFS YL  VQ RL+ +   +  S S + KE    EQ+ELV+RFLKRA+ N+  +   +  +PSR   L +R+  LA  LG+FI +Y++ET   A  K  +         ++ ++F  F+R ASE +LE  L+ YT+ NKSA +FL 
Sbjct:  663 QILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKED---EQMELVVRFLKRASNNLQHSLRMV--LPSRRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVFLG 819          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Human
Match: TTLL5 (tubulin tyrosine ligase like 5 [Source:HGNC Symbol;Acc:HGNC:19963])

HSP 1 Score: 291.197 bits (744), Expect = 2.807e-89
Identity = 132/230 (57.39%), Postives = 176/230 (76.52%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNT 977
            C +    C  ++IP L+F  +A+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL R    K  NT
Sbjct:   29 CIMWTGGC--RRIPVLVFHADAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARKCNWKMGNT 256          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Human
Match: TTLL4 (tubulin tyrosine ligase like 4 [Source:HGNC Symbol;Acc:HGNC:28976])

HSP 1 Score: 259.225 bits (661), Expect = 5.394e-71
Identity = 146/349 (41.83%), Postives = 225/349 (64.47%), Query Frame = 3
Query:  363 KDSNIRKIG--ERYNLSYKIYKTDCKLLK-TILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF-SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIG 1397
            +D  + K+   +R  L +K+      ++K TI  SH   +    ++D+   W G H+K  + R++ EHQK+NHFP S+++ RKDRL++N+ +MQ   G K F F P S+++P + + L + + S  +  +I+KP A +RG GI + +   Q+P    L+  +Y+  PYLI+  KFD+R+YV VTSYDPL  YL+ +GL RFA+ KY  + K+L  + MHLTNYSVNKKN E+  N D ++   G+KW+L AL  YL  K V++  +  KI+D++VK++IS E  +++  +M+     +C EL+G+DI++DENL+PW+LEVN+SPSL   SPLD  IK  M+ D+ +L G
Sbjct:  427 RDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSH--FKISKRNDDWLGCW-GHHMKSPSFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDAKLLRKAWESSSRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANAD-EMACQGHKWALKALWNYLSQKGVNSDAIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAG 771          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Human
Match: TTLL4 (tubulin tyrosine ligase like 4 [Source:HGNC Symbol;Acc:HGNC:28976])

HSP 1 Score: 259.61 bits (662), Expect = 2.850e-70
Identity = 146/349 (41.83%), Postives = 225/349 (64.47%), Query Frame = 3
Query:  363 KDSNIRKIG--ERYNLSYKIYKTDCKLLK-TILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF-SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIG 1397
            +D  + K+   +R  L +K+      ++K TI  SH   +    ++D+   W G H+K  + R++ EHQK+NHFP S+++ RKDRL++N+ +MQ   G K F F P S+++P + + L + + S  +  +I+KP A +RG GI + +   Q+P    L+  +Y+  PYLI+  KFD+R+YV VTSYDPL  YL+ +GL RFA+ KY  + K+L  + MHLTNYSVNKKN E+  N D ++   G+KW+L AL  YL  K V++  +  KI+D++VK++IS E  +++  +M+     +C EL+G+DI++DENL+PW+LEVN+SPSL   SPLD  IK  M+ D+ +L G
Sbjct:  592 RDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSH--FKISKRNDDWLGCW-GHHMKSPSFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDAKLLRKAWESSSRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANAD-EMACQGHKWALKALWNYLSQKGVNSDAIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAG 936          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 315.079 bits (806), Expect = 4.428e-93
Identity = 184/513 (35.87%), Postives = 306/513 (59.65%), Query Frame = 3
Query:  249 IVGTNKEKSNSDICTVIGTNCFGKKIPYLIFSVEAV--LRKDSNIRK----IGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF---SKE----------KNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKT-QCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDL-------STSSTPFRSDQL-RMIRRVREEYKRKGGWIRIFPTSESLETYFPLF 1703
            +V  NK+  NSD               Y++FS +A+  +  D+ + +    +GER  L++K+ ++D +L++T+ +SHGF++C S +   N++W G  VK   +R +   Q++N FPRS ELT+KDRL++NI++ + + G + FDF+P  Y+ P E +++   F   +KE             +I+KP    +G+GIF +N    IP +  L+ S+Y+ +PYL+N  KFD+R+YV VTS+ PLVAY+Y EGL R A+  Y  +  +  + + +HLTNYS+NK +  F+ N+    ED G+KW+LGALLRY++++  D   LM++IED+IVKSL+S++  ++  SR    +    FEL+G+D+++D+ L+PWLLEVNLSPSL+CD+PLD  +K+ +++D+ +L  +   D  + +   P L   + S     S TD+     +  +  +++R   GL+R  L       STS  P    +  +++R+   E  R+G +IR+FP + +   Y P+ 
Sbjct:   28 LVSRNKKSRNSD---------------YMLFSSDALVHIAHDAKVSEKYTWLGERLRLTFKMMRSDSRLIRTMCHSHGFMQCSSKNPSVNVIWMGAPVKSVRMRELMPWQRLNQFPRSTELTKKDRLYENIERSKSIFG-ESFDFIPEFYVTPRENRKMENAFVRVAKEIAAAGGELCFPGEFIVKPTNSRQGKGIFFANSMADIPAEGPLLVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVENEGKDAKLLMLRIEDLIVKSLLSIQNSVATASRTNLRFACTNFELFGFDVLVDQALKPWLLEVNLSPSLACDAPLDSLLKTRLIADLLNLACVPLLDRKIIDSVTPALRKSMNSQESESSETDDLELDPMCAK--TLKRRPVGLKRSVLNKKIVSGSTSLIPNNEKKFDQIVRKAELEDGRRGDFIRVFPRNGTWGMYSPVM 522          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 314.694 bits (805), Expect = 1.866e-92
Identity = 184/513 (35.87%), Postives = 306/513 (59.65%), Query Frame = 3
Query:  249 IVGTNKEKSNSDICTVIGTNCFGKKIPYLIFSVEAV--LRKDSNIRK----IGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF---SKE----------KNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKT-QCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDL-------STSSTPFRSDQL-RMIRRVREEYKRKGGWIRIFPTSESLETYFPLF 1703
            +V  NK+  NSD               Y++FS +A+  +  D+ + +    +GER  L++K+ ++D +L++T+ +SHGF++C S +   N++W G  VK   +R +   Q++N FPRS ELT+KDRL++NI++ + + G + FDF+P  Y+ P E +++   F   +KE             +I+KP    +G+GIF +N    IP +  L+ S+Y+ +PYL+N  KFD+R+YV VTS+ PLVAY+Y EGL R A+  Y  +  +  + + +HLTNYS+NK +  F+ N+    ED G+KW+LGALLRY++++  D   LM++IED+IVKSL+S++  ++  SR    +    FEL+G+D+++D+ L+PWLLEVNLSPSL+CD+PLD  +K+ +++D+ +L  +   D  + +   P L   + S     S TD+     +  +  +++R   GL+R  L       STS  P    +  +++R+   E  R+G +IR+FP + +   Y P+ 
Sbjct:   81 LVSRNKKSRNSD---------------YMLFSSDALVHIAHDAKVSEKYTWLGERLRLTFKMMRSDSRLIRTMCHSHGFMQCSSKNPSVNVIWMGAPVKSVRMRELMPWQRLNQFPRSTELTKKDRLYENIERSKSIFG-ESFDFIPEFYVTPRENRKMENAFVRVAKEIAAAGGELCFPGEFIVKPTNSRQGKGIFFANSMADIPAEGPLLVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVENEGKDAKLLMLRIEDLIVKSLLSIQNSVATASRTNLRFACTNFELFGFDVLVDQALKPWLLEVNLSPSLACDAPLDSLLKTRLIADLLNLACVPLLDRKIIDSVTPALRKSMNSQESESSETDDLELDPMCAK--TLKRRPVGLKRSVLNKKIVSGSTSLIPNNEKKFDQIVRKAELEDGRRGDFIRVFPRNGTWGMYSPVM 575          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 211.075 bits (536), Expect = 6.175e-58
Identity = 116/297 (39.06%), Postives = 176/297 (59.26%), Query Frame = 3
Query:  513 GGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYII-KPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGI 1400
            G H+K    R +  HQKVNHFP ++ + RKDRL+ +I+K QQ +    FD +P +Y++P++ QEL +    + + ++I KP A +RG GI ++  P   P    L+A  YI  P  IN  KFD+R+Y  V +++PL  Y+Y++GL RFA+V Y ++   +  + MHLTNYS+NK     +   D        KW+L  L  +     VD   +  +IE++I+K+ IS E PI      F      C+EL+G DII+DE+ +PWLLEVN+SPSL   +PLD  +K+ +  D+ +L G+
Sbjct:  138 GRHLKSAQYRALQPHQKVNHFPGAFHIGRKDRLWMHIRK-QQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHVIVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINK-----LAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGV 428          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 211.075 bits (536), Expect = 6.175e-58
Identity = 116/297 (39.06%), Postives = 176/297 (59.26%), Query Frame = 3
Query:  513 GGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYII-KPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGI 1400
            G H+K    R +  HQKVNHFP ++ + RKDRL+ +I+K QQ +    FD +P +Y++P++ QEL +    + + ++I KP A +RG GI ++  P   P    L+A  YI  P  IN  KFD+R+Y  V +++PL  Y+Y++GL RFA+V Y ++   +  + MHLTNYS+NK     +   D        KW+L  L  +     VD   +  +IE++I+K+ IS E PI      F      C+EL+G DII+DE+ +PWLLEVN+SPSL   +PLD  +K+ +  D+ +L G+
Sbjct:  138 GRHLKSAQYRALQPHQKVNHFPGAFHIGRKDRLWMHIRK-QQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHVIVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINK-----LAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGV 428          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 211.846 bits (538), Expect = 6.207e-58
Identity = 116/297 (39.06%), Postives = 176/297 (59.26%), Query Frame = 3
Query:  513 GGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYII-KPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGI 1400
            G H+K    R +  HQKVNHFP ++ + RKDRL+ +I+K QQ +    FD +P +Y++P++ QEL +    + + ++I KP A +RG GI ++  P   P    L+A  YI  P  IN  KFD+R+Y  V +++PL  Y+Y++GL RFA+V Y ++   +  + MHLTNYS+NK     +   D        KW+L  L  +     VD   +  +IE++I+K+ IS E PI      F      C+EL+G DII+DE+ +PWLLEVN+SPSL   +PLD  +K+ +  D+ +L G+
Sbjct:  176 GRHLKSAQYRALQPHQKVNHFPGAFHIGRKDRLWMHIRK-QQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHVIVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINK-----LAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGV 466          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Fly
Match: TTLL5 (gene:FBgn0051108 transcript:FBtr0084802)

HSP 1 Score: 393.275 bits (1009), Expect = 4.914e-119
Identity = 201/443 (45.37%), Postives = 297/443 (67.04%), Query Frame = 3
Query:  366 DSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVL-NNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            +  I     +  ++YK ++T+ KLL+ + N HG  E Q  +N++NLLWTG H+K   +R ++ +Q+VNHFPRSYE+TRKDRL+KNI++MQ L+G+KHFD VP ++++P E ++L    +K +  +I+KP A SRGRGIF+ N P QIP DEQ + SKYI +P  I+  K D+R+YVLVTS+DPL+ YLYEEG+ R ATVKY     NL   CMHL NYS+NK ++++I + DA  ED G+KW+L ALLR+LK ++ DT  LM+ IED+I+K++++    I +  RMF    +NCFELYG+DI+ID  L+PWLLE+NLSPS+  DSPLD K+KS +M+D+ + +GI    P + ++ +Q +  S+ RSS+  +  T    P        S ++  A          +     ++ R++R  R +Y R+GG++RIFPT +S++ Y
Sbjct:  204 ECGINMPASKLKITYKFHQTETKLLRKLFNVHGLTEVQGENNNFNLLWTGVHMKLDIVRNLAPYQRVNHFPRSYEMTRKDRLYKNIERMQHLRGMKHFDIVPQTFVLPIESRDLVVAHNKHRGPWIVKPAASSRGRGIFIVNSPDQIPQDEQAVVSKYIVDPLCIDGHKCDLRVYVLVTSFDPLIIYLYEEGIVRLATVKYDRHADNLWNPCMHLCNYSINKYHSDYIRSSDAQDEDVGHKWTLSALLRHLKLQSCDTRQLMLNIEDLIIKAVLACAQSIISACRMFVPNGNNCFELYGFDILIDNALKPWLLEINLSPSMGVDSPLDTKVKSCLMADLLTCVGIPAYSPEMKSHYDQKW--SRFRSSSCQRIAT---FPSTSQKTKKSKKKGAA---------INLNLTGEEQRILRNARLQYSRRGGFVRIFPTDDSMQRY 632          

HSP 2 Score: 53.1434 bits (126), Expect = 1.693e-6
Identity = 53/194 (27.32%), Postives = 88/194 (45.36%), Query Frame = 3
Query: 2295 VQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEF--EIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLNPNLNTKNPEPTTDDSIRHHHLXXXXXXXXTAGLHKSVS 2870
            + +G +LT  QAR  FS YL  V RR            L++   ++HE+I  +++FL +   ++        + TI   S+    R   +AKLLG+F+  Y R+T   A     ++  +I   ++  FL  A E+DLE  L+ +T V        N    +  P P     + H  L A P    + G+++ +S
Sbjct:  728 ISNGSELTPFQARQTFSMYLESVLRR------------LTEDPKDNHEKI--ILKFLNKFGGSVKPPVMFRNMQTIKVASK---ARSAMVAKLLGDFLENYKRDTE--AYVDSFDHFGMIPSSAYNQFLMHAQESDLEAVLTLHTNVTGIMPFLYNRCGLSVPPTPPIPSGL-HGFLRALPSMVSSTGINRELS 901          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Fly
Match: TTLL5 (gene:FBgn0051108 transcript:FBtr0339247)

HSP 1 Score: 393.275 bits (1009), Expect = 4.914e-119
Identity = 201/443 (45.37%), Postives = 297/443 (67.04%), Query Frame = 3
Query:  366 DSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVL-NNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            +  I     +  ++YK ++T+ KLL+ + N HG  E Q  +N++NLLWTG H+K   +R ++ +Q+VNHFPRSYE+TRKDRL+KNI++MQ L+G+KHFD VP ++++P E ++L    +K +  +I+KP A SRGRGIF+ N P QIP DEQ + SKYI +P  I+  K D+R+YVLVTS+DPL+ YLYEEG+ R ATVKY     NL   CMHL NYS+NK ++++I + DA  ED G+KW+L ALLR+LK ++ DT  LM+ IED+I+K++++    I +  RMF    +NCFELYG+DI+ID  L+PWLLE+NLSPS+  DSPLD K+KS +M+D+ + +GI    P + ++ +Q +  S+ RSS+  +  T    P        S ++  A          +     ++ R++R  R +Y R+GG++RIFPT +S++ Y
Sbjct:  204 ECGINMPASKLKITYKFHQTETKLLRKLFNVHGLTEVQGENNNFNLLWTGVHMKLDIVRNLAPYQRVNHFPRSYEMTRKDRLYKNIERMQHLRGMKHFDIVPQTFVLPIESRDLVVAHNKHRGPWIVKPAASSRGRGIFIVNSPDQIPQDEQAVVSKYIVDPLCIDGHKCDLRVYVLVTSFDPLIIYLYEEGIVRLATVKYDRHADNLWNPCMHLCNYSINKYHSDYIRSSDAQDEDVGHKWTLSALLRHLKLQSCDTRQLMLNIEDLIIKAVLACAQSIISACRMFVPNGNNCFELYGFDILIDNALKPWLLEINLSPSMGVDSPLDTKVKSCLMADLLTCVGIPAYSPEMKSHYDQKW--SRFRSSSCQRIAT---FPSTSQKTKKSKKKGAA---------INLNLTGEEQRILRNARLQYSRRGGFVRIFPTDDSMQRY 632          

HSP 2 Score: 53.1434 bits (126), Expect = 1.693e-6
Identity = 53/194 (27.32%), Postives = 88/194 (45.36%), Query Frame = 3
Query: 2295 VQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEF--EIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLNPNLNTKNPEPTTDDSIRHHHLXXXXXXXXTAGLHKSVS 2870
            + +G +LT  QAR  FS YL  V RR            L++   ++HE+I  +++FL +   ++        + TI   S+    R   +AKLLG+F+  Y R+T   A     ++  +I   ++  FL  A E+DLE  L+ +T V        N    +  P P     + H  L A P    + G+++ +S
Sbjct:  728 ISNGSELTPFQARQTFSMYLESVLRR------------LTEDPKDNHEKI--ILKFLNKFGGSVKPPVMFRNMQTIKVASK---ARSAMVAKLLGDFLENYKRDTE--AYVDSFDHFGMIPSSAYNQFLMHAQESDLEAVLTLHTNVTGIMPFLYNRCGLSVPPTPPIPSGL-HGFLRALPSMVSSTGINRELS 901          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Fly
Match: TTLL4A (gene:FBgn0026147 transcript:FBtr0300402)

HSP 1 Score: 234.958 bits (598), Expect = 6.531e-64
Identity = 121/307 (39.41%), Postives = 191/307 (62.21%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSK--EKNT-YIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVN 1313
            L ++I     K+++ IL + G +     +ND+  +W G H+K    + +  +QK+NH P S+ + RKD  +KN+Q+       K F F+P +Y+IP++   L +++ K  ++NT +IIKP A +RG GI + N  GQIP    LI  KYI  P LIN  KFD+R+YVLVTS +PL  ++Y  GL RFA+VKY      L  +CMHLTNYS+NK ++ +  N+D +    G+KW++ +L  YL ++ V T CL   +  ++++++++ E  I++  R     + +CFEL+G+D+I+D +L PWLLEVN
Sbjct:  324 LKWRITNIMPKVVRLILANSG-MRMLKKTNDWMGVW-GKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNAC-HGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVN 627          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Fly
Match: TTLL4A (gene:FBgn0026147 transcript:FBtr0300401)

HSP 1 Score: 234.958 bits (598), Expect = 6.531e-64
Identity = 121/307 (39.41%), Postives = 191/307 (62.21%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSK--EKNT-YIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVN 1313
            L ++I     K+++ IL + G +     +ND+  +W G H+K    + +  +QK+NH P S+ + RKD  +KN+Q+       K F F+P +Y+IP++   L +++ K  ++NT +IIKP A +RG GI + N  GQIP    LI  KYI  P LIN  KFD+R+YVLVTS +PL  ++Y  GL RFA+VKY      L  +CMHLTNYS+NK ++ +  N+D +    G+KW++ +L  YL ++ V T CL   +  ++++++++ E  I++  R     + +CFEL+G+D+I+D +L PWLLEVN
Sbjct:  324 LKWRITNIMPKVVRLILANSG-MRMLKKTNDWMGVW-GKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNAC-HGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVN 627          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Fly
Match: TTLL4A (gene:FBgn0026147 transcript:FBtr0304950)

HSP 1 Score: 234.572 bits (597), Expect = 7.333e-64
Identity = 121/307 (39.41%), Postives = 191/307 (62.21%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSK--EKNT-YIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVN 1313
            L ++I     K+++ IL + G +     +ND+  +W G H+K    + +  +QK+NH P S+ + RKD  +KN+Q+       K F F+P +Y+IP++   L +++ K  ++NT +IIKP A +RG GI + N  GQIP    LI  KYI  P LIN  KFD+R+YVLVTS +PL  ++Y  GL RFA+VKY      L  +CMHLTNYS+NK ++ +  N+D +    G+KW++ +L  YL ++ V T CL   +  ++++++++ E  I++  R     + +CFEL+G+D+I+D +L PWLLEVN
Sbjct:  324 LKWRITNIMPKVVRLILANSG-MRMLKKTNDWMGVW-GKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNAC-HGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVN 627          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Zebrafish
Match: ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:ZFIN;Acc:ZDB-GENE-100922-236])

HSP 1 Score: 522.316 bits (1344), Expect = 3.672e-164
Identity = 245/466 (52.58%), Postives = 347/466 (74.46%), Query Frame = 3
Query:  294 VIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
             I  +   K+IP L+F  EA++ KD  IR +GE+YNL++KI +T+ +L++ IL +HGF E    SND+NL+WTG H+KP+ LR++ + QKVNHFPRSYELTRKDRL+KNIQ+MQQ  G  +F  VP ++++P+E+QE   +FSK+K  +IIKP+A SRGRGI+L ++  QIPLDE ++ S+YISNP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATVKY +   N+K Q MHLTNYSVNKK+++++  DD +VED+GNKWS+ A+LRYL+ +  DTT LM +IED+I+K+++S E  I+ + +MF  +R NCFELYG+D++ID NL+PWLLEVNLSPSL+CD+PLD K+K+ M+SDMFSL+G  C+DP+L  P        +R    +Q     + P   ++ +   +R   G +  D + S     +++++++RRV+EEY+R+GG+IRIFPT ++ E Y
Sbjct:   24 CIAWSGVSKRIPVLLFCAEAIVSKDVAIRSVGEKYNLAFKIVRTESRLVRGILVNHGFHEVHPNSNDFNLMWTGSHLKPYLLRSLQDFQKVNHFPRSYELTRKDRLYKNIQRMQQSHGFHNFSIVPQTFVLPAEYQEFSNSFSKDKGPWIIKPVASSRGRGIYLVSNISQIPLDENILVSRYISNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVKYDHATANIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEIHIATSCKMFVPHRCNCFELYGFDVLIDSNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFSLVGFVCQDPLLRQPRAERAGFDLRLKIPTQKHQRQR-PASSSSADPQTQREKHGCKHTDDTLS---LSAEEMKVLRRVQEEYERRGGFIRIFPTPDTWEIY 485          

HSP 2 Score: 110.538 bits (275), Expect = 7.147e-24
Identity = 71/161 (44.10%), Postives = 98/161 (60.87%), Query Frame = 3
Query: 2292 IVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATN----MSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKE--IENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            I+Q G  L+K+QARMAFS+YL RVQ RLL E R+  S + + KE   H+Q+ELV+RFLKRA++N    MS  E      PS    L +RQ  L++ L +FI++Y +ET     + E   +    I+   F  F+  ASE+DLE  L+ YT+ NKSA +FL 
Sbjct:  601 ILQQGWDLSKVQARMAFSSYLHRVQLRLLAESRANRSPAWTQKE---HDQMELVVRFLKRASSNLHQGMSVKE------PSLHLCLQERQHILSQQLESFIQLYDQETKQMVQSLEPMTDEGRCINSTVFQEFILEASESDLEEVLTFYTQKNKSASVFLG 752          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Zebrafish
Match: ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:ZFIN;Acc:ZDB-GENE-070912-313])

HSP 1 Score: 252.292 bits (643), Expect = 1.019e-71
Identity = 161/432 (37.27%), Postives = 250/432 (57.87%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLK-TILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF--SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSST---PFRSDQLRMIRRVREEYKRKGGWIRIFPTSES 1679
            L +KI      ++K TI  SH   +    S+D+   W G H+K    + + E QK+NHFP S+++ RKDRL++N+ KMQ   G + F F P S+++P + + L + +     K  +I+KP A +RG GI + +   Q+P    L+  KY+  PYLI+  KFD+R+YV VTSYDPL  Y++ +GL RFA+ KY ++ K L  + MHLTNYSVNKKN+E+  N D D    G+KW+L AL +YL S+ ++TT +  KI+D+++K++I+ +  +++  +M      +C EL+G+DI++DENL+PW+LEVN+SPSL  ++PLD  IK  M+ D+ +L G       L +   P  +S   S++        K    I+      R      R  D    +T       D +R++    +E  RKG + R+FP+  S
Sbjct:   25 LKWKITTVTPNVVKNTIFRSH--FKATKKSHDWLGCW-GHHMKSPGFKAIREFQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFILPQDIKLLRKAWDDGGSKQKWIVKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRIYIFNDGLVRFASCKYSSSMKTLNNKFMHLTNYSVNKKNSEYQSNSD-DKACQGHKWALKALWQYLGSQGINTTLIWEKIKDMVIKTIIASDPYVNSLVKMHVRSPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNTPLDVSIKGQMIRDLLNLAGFVLP---LRDDFAPSGSSASSSTSSLCGGVREKWRPDISPDEKVKRAFYLSQRFGDQDFCATVLDVLTPDDVRVLAESEDELSRKGDFERVFPSHAS 449          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Zebrafish
Match: ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:ZFIN;Acc:ZDB-GENE-070912-313])

HSP 1 Score: 251.906 bits (642), Expect = 2.831e-69
Identity = 161/432 (37.27%), Postives = 250/432 (57.87%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLK-TILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF--SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSST---PFRSDQLRMIRRVREEYKRKGGWIRIFPTSES 1679
            L +KI      ++K TI  SH   +    S+D+   W G H+K    + + E QK+NHFP S+++ RKDRL++N+ KMQ   G + F F P S+++P + + L + +     K  +I+KP A +RG GI + +   Q+P    L+  KY+  PYLI+  KFD+R+YV VTSYDPL  Y++ +GL RFA+ KY ++ K L  + MHLTNYSVNKKN+E+  N D D    G+KW+L AL +YL S+ ++TT +  KI+D+++K++I+ +  +++  +M      +C EL+G+DI++DENL+PW+LEVN+SPSL  ++PLD  IK  M+ D+ +L G       L +   P  +S   S++        K    I+      R      R  D    +T       D +R++    +E  RKG + R+FP+  S
Sbjct:  319 LKWKITTVTPNVVKNTIFRSH--FKATKKSHDWLGCW-GHHMKSPGFKAIREFQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFILPQDIKLLRKAWDDGGSKQKWIVKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRIYIFNDGLVRFASCKYSSSMKTLNNKFMHLTNYSVNKKNSEYQSNSD-DKACQGHKWALKALWQYLGSQGINTTLIWEKIKDMVIKTIIASDPYVNSLVKMHVRSPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNTPLDVSIKGQMIRDLLNLAGFVLP---LRDDFAPSGSSASSSTSSLCGGVREKWRPDISPDEKVKRAFYLSQRFGDQDFCATVLDVLTPDDVRVLAESEDELSRKGDFERVFPSHAS 743          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Zebrafish
Match: ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:ZFIN;Acc:ZDB-GENE-070912-313])

HSP 1 Score: 252.292 bits (643), Expect = 2.061e-68
Identity = 141/335 (42.09%), Postives = 217/335 (64.78%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLK-TILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF--SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIG 1397
            L +KI      ++K TI  SH   +    S+D+   W G H+K    + + E QK+NHFP S+++ RKDRL++N+ KMQ   G + F F P S+++P + + L + +     K  +I+KP A +RG GI + +   Q+P    L+  KY+  PYLI+  KFD+R+YV VTSYDPL  Y++ +GL RFA+ KY ++ K L  + MHLTNYSVNKKN+E+  N D D    G+KW+L AL +YL S+ ++TT +  KI+D+++K++I+ +  +++  +M      +C EL+G+DI++DENL+PW+LEVN+SPSL  ++PLD  IK  M+ D+ +L G
Sbjct:  517 LKWKITTVTPNVVKNTIFRSH--FKATKKSHDWLGCW-GHHMKSPGFKAIREFQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFILPQDIKLLRKAWDDGGSKQKWIVKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRIYIFNDGLVRFASCKYSSSMKTLNNKFMHLTNYSVNKKNSEYQSNSD-DKACQGHKWALKALWQYLGSQGINTTLIWEKIKDMVIKTIIASDPYVNSLVKMHVRSPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNTPLDVSIKGQMIRDLLNLAG 847          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Zebrafish
Match: ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:ZFIN;Acc:ZDB-GENE-070912-313])

HSP 1 Score: 252.292 bits (643), Expect = 2.061e-68
Identity = 141/335 (42.09%), Postives = 217/335 (64.78%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLK-TILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF--SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIG 1397
            L +KI      ++K TI  SH   +    S+D+   W G H+K    + + E QK+NHFP S+++ RKDRL++N+ KMQ   G + F F P S+++P + + L + +     K  +I+KP A +RG GI + +   Q+P    L+  KY+  PYLI+  KFD+R+YV VTSYDPL  Y++ +GL RFA+ KY ++ K L  + MHLTNYSVNKKN+E+  N D D    G+KW+L AL +YL S+ ++TT +  KI+D+++K++I+ +  +++  +M      +C EL+G+DI++DENL+PW+LEVN+SPSL  ++PLD  IK  M+ D+ +L G
Sbjct:  517 LKWKITTVTPNVVKNTIFRSH--FKATKKSHDWLGCW-GHHMKSPGFKAIREFQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFILPQDIKLLRKAWDDGGSKQKWIVKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRIYIFNDGLVRFASCKYSSSMKTLNNKFMHLTNYSVNKKNSEYQSNSD-DKACQGHKWALKALWQYLGSQGINTTLIWEKIKDMVIKTIIASDPYVNSLVKMHVRSPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNTPLDVSIKGQMIRDLLNLAG 847          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Xenopus
Match: mboat7 (membrane bound O-acyltransferase domain containing 7 [Source:Xenbase;Acc:XB-GENE-978827])

HSP 1 Score: 510.76 bits (1314), Expect = 2.551e-160
Identity = 242/504 (48.02%), Postives = 356/504 (70.63%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPV--LNNPNQPYLNSKVRSSNYSQSTTDNKIPK--QINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFXXXXXXXXXXXXXTHTYMNLNRLLHSKLFPNHIIDIDN 1817
            +K+P ++F  EAVL K+ ++R +GERY LSYKI +TD +L+++IL++HGF E  + SND+N++WTG HVKP  +R+++  QKVNHFPRSYELTRKDRL+KN+Q+MQQ  G K+F  +P +YL+P+E+Q+ C  F+K++  +I+KP+A SRGRG++L N P  I +++ ++ S+YI NP LI+  KFD+R+YVL+TSYDPLV YLYEEGLTRFAT KY    KN+K Q MHLTNYSVNKK+ +++  DD DVED+GNKWS+ A+LRYLK    DT  LM ++ED+I+K+++S E PI++  +   T+R NCFELYG+D++ID NL+PWLLEVNLSPSL+CD+PLD K+K+ M+SDMF+L+G+ C+DP       +    + + + S + +  + N I    Q+ N+  ++RR +  L    LS        ++L+++RRV++EY+R+GG++RIFP   + + Y    + +               +LN +L + LFPN     D+
Sbjct:   32 RKVPIVMFHAEAVLHKNLSLRAVGERYKLSYKIVRTDSRLVRSILSAHGFQEVNANSNDFNIMWTGSHVKPHIMRSLTNFQKVNHFPRSYELTRKDRLYKNVQRMQQSHGFKNFHLLPQTYLLPAEYQDFCTAFAKDRGPWIVKPVASSRGRGVYLINSPSLISMEDNILVSRYIGNPLLIDGFKFDVRLYVLITSYDPLVIYLYEEGLTRFATAKYDRAAKNIKNQFMHLTNYSVNKKSGDYVSCDDPDVEDYGNKWSMSAMLRYLKQDGKDTAALMSQVEDLIIKTIVSAELPIASACKSLITHRGNCFELYGFDVLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLVGVECQDPQQRFGRASSSLYDKRTQKSTHQRPLSANDIDTGLQVGNREKAVRRTSCLL---GLSI-------EELKILRRVQDEYERRGGFVRIFPRHNTWQLYGSFLEYKT--------------SLNYMLVTHLFPNRAAGNDH 511          

HSP 2 Score: 105.531 bits (262), Expect = 3.546e-22
Identity = 69/166 (41.57%), Postives = 101/166 (60.84%), Query Frame = 3
Query: 2277 LSVDRIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIP-TIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIEN--PAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN-PN 2762
            +S+  I++ G  L+K+QAR AFS YL RVQ RL  E   E    +  KE    EQIELV+RFL+R A N+  +   +P  +P +S P  +R+  LAKLLG+F+ +Y++ET     ++E ++     ++   F  F+  ASEN+LE  L+ YT+ NKSA +FL  PN
Sbjct:  601 ISLMDILRKGADLSKVQARNAFSCYLQRVQNRLQTERNPER---VQPKE---EEQIELVMRFLQRGAANLKRS---LPLNLPGQSVPYLERRHLLAKLLGDFVALYNQETQQMQNSEETQSNEECGVNPDDFEAFVADASENELEEVLTFYTQKNKSASVFLGTPN 757          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Xenopus
Match: mboat7 (membrane bound O-acyltransferase domain containing 7 [Source:Xenbase;Acc:XB-GENE-978827])

HSP 1 Score: 454.907 bits (1169), Expect = 8.451e-148
Identity = 208/366 (56.83%), Postives = 290/366 (79.23%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDP 1415
            +K+P ++F  EAVL K+ ++R +GERY LSYKI +TD +L+++IL++HGF E  + SND+N++WTG HVKP  +R+++  QKVNHFPRSYELTRKDRL+KN+Q+MQQ  G K+F  +P +YL+P+E+Q+ C  F+K++  +I+KP+A SRGRG++L N P  I +++ ++ S+YI NP LI+  KFD+R+YVL+TSYDPLV YLYEEGLTRFAT KY    KN+K Q MHLTNYSVNKK+ +++  DD DVED+GNKWS+ A+LRYLK    DT  LM ++ED+I+K+++S E PI++  +   T+R NCFELYG+D++ID NL+PWLLEVNLSPSL+CD+PLD K+K+ M+SDMF+L+G+    P
Sbjct:   51 RKVPIVMFHAEAVLHKNLSLRAVGERYKLSYKIVRTDSRLVRSILSAHGFQEVNANSNDFNIMWTGSHVKPHIMRSLTNFQKVNHFPRSYELTRKDRLYKNVQRMQQSHGFKNFHLLPQTYLLPAEYQDFCTAFAKDRGPWIVKPVASSRGRGVYLINSPSLISMEDNILVSRYIGNPLLIDGFKFDVRLYVLITSYDPLVIYLYEEGLTRFATAKYDRAAKNIKNQFMHLTNYSVNKKSGDYVSCDDPDVEDYGNKWSMSAMLRYLKQDGKDTAALMSQVEDLIIKTIVSAELPIASACKSLITHRGNCFELYGFDVLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLVGMVVHLP 416          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Xenopus
Match: mboat7 (membrane bound O-acyltransferase domain containing 7 [Source:Xenbase;Acc:XB-GENE-978827])

HSP 1 Score: 455.292 bits (1170), Expect = 7.408e-144
Identity = 225/460 (48.91%), Postives = 319/460 (69.35%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINEL--KFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            +K+P ++F  EAVL K+ ++R +GERY LSYKI +TD +L+++IL++HGF E  + SND+N++WTG HVKP  +R+++  QKVNHFPRSYELTRKDRL+KN+Q+MQQ  G K+F  +P +YL+P+E+Q+ C  F+K++  +I+KP+A SRGRG+                        YLIN +  KFD+R+YVL+TSYDPLV YLYEEGLTRFAT KY    KN+K Q MHLTNYSVNKK+ +++  DD DVED+GNKWS+ A+LRYLK    DT  LM ++ED+I+K+++S E PI++  +   T+R NCFELYG+D++ID NL+PWLLEVNLSPSL+CD+PLD K+K+ M+SDMF+L+G+             Y  +K        S  D     Q+ N+  ++RR +  L    LS        ++L+++RRV++EY+R+GG++RIFP   + + Y
Sbjct:   51 RKVPIVMFHAEAVLHKNLSLRAVGERYKLSYKIVRTDSRLVRSILSAHGFQEVNANSNDFNIMWTGSHVKPHIMRSLTNFQKVNHFPRSYELTRKDRLYKNVQRMQQSHGFKNFHLLPQTYLLPAEYQDFCTAFAKDRGPWIVKPVASSRGRGV------------------------YLINSVRFKFDVRLYVLITSYDPLVIYLYEEGLTRFATAKYDRAAKNIKNQFMHLTNYSVNKKSGDYVSCDDPDVEDYGNKWSMSAMLRYLKQDGKDTAALMSQVEDLIIKTIVSAELPIASACKSLITHRGNCFELYGFDVLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLVGM-------------YFYTK---HQRPLSANDIDTGLQVGNREKAVRRTSCLL---GLSI-------EELKILRRVQDEYERRGGFVRIFPRHNTWQLY 460          

HSP 2 Score: 96.6709 bits (239), Expect = 1.092e-19
Identity = 63/152 (41.45%), Postives = 90/152 (59.21%), Query Frame = 3
Query: 2319 KIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIP-TIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIEN--PAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN-PN 2762
            K+QAR AFS YL RVQ RL  E   E        +    EQIELV+RFL+R A N+  +   +P  +P +S P  +R+  LAKLLG+F+ +Y++ET     ++E ++     ++   F  F+  ASEN+LE  L+ YT+ NKSA +FL  PN
Sbjct:  462 KVQARNAFSCYLQRVQNRLQTERNPERV------QPKEEEQIELVMRFLQRGAANLKRS---LPLNLPGQSVPYLERRHLLAKLLGDFVALYNQETQQMQNSEETQSNEECGVNPDDFEAFVADASENELEEVLTFYTQKNKSASVFLGTPN 604          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Xenopus
Match: mboat7 (membrane bound O-acyltransferase domain containing 7 [Source:Xenbase;Acc:XB-GENE-978827])

HSP 1 Score: 454.136 bits (1167), Expect = 1.874e-143
Identity = 225/460 (48.91%), Postives = 319/460 (69.35%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINEL--KFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            +K+P ++F  EAVL K+ ++R +GERY LSYKI +TD +L+++IL++HGF E  + SND+N++WTG HVKP  +R+++  QKVNHFPRSYELTRKDRL+KN+Q+MQQ  G K+F  +P +YL+P+E+Q+ C  F+K++  +I+KP+A SRGRG+                        YLIN +  KFD+R+YVL+TSYDPLV YLYEEGLTRFAT KY    KN+K Q MHLTNYSVNKK+ +++  DD DVED+GNKWS+ A+LRYLK    DT  LM ++ED+I+K+++S E PI++  +   T+R NCFELYG+D++ID NL+PWLLEVNLSPSL+CD+PLD K+K+ M+SDMF+L+G+             Y  +K        S  D     Q+ N+  ++RR +  L    LS        ++L+++RRV++EY+R+GG++RIFP   + + Y
Sbjct:   51 RKVPIVMFHAEAVLHKNLSLRAVGERYKLSYKIVRTDSRLVRSILSAHGFQEVNANSNDFNIMWTGSHVKPHIMRSLTNFQKVNHFPRSYELTRKDRLYKNVQRMQQSHGFKNFHLLPQTYLLPAEYQDFCTAFAKDRGPWIVKPVASSRGRGV------------------------YLINSVRFKFDVRLYVLITSYDPLVIYLYEEGLTRFATAKYDRAAKNIKNQFMHLTNYSVNKKSGDYVSCDDPDVEDYGNKWSMSAMLRYLKQDGKDTAALMSQVEDLIIKTIVSAELPIASACKSLITHRGNCFELYGFDVLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLVGM-------------YFYTK---HQRPLSANDIDTGLQVGNREKAVRRTSCLL---GLSI-------EELKILRRVQDEYERRGGFVRIFPRHNTWQLY 460          

HSP 2 Score: 72.7886 bits (177), Expect = 3.115e-12
Identity = 44/110 (40.00%), Postives = 69/110 (62.73%), Query Frame = 3
Query: 2445 ELVIRFLKRAATNMSANEFEIP-TIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIEN--PAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN-PN 2762
            ELV+RFL+R A N+  +   +P  +P +S P  +R+  LAKLLG+F+ +Y++ET     ++E ++     ++   F  F+  ASEN+LE  L+ YT+ NKSA +FL  PN
Sbjct:  511 ELVMRFLQRGAANLKRS---LPLNLPGQSVPYLERRHLLAKLLGDFVALYNQETQQMQNSEETQSNEECGVNPDDFEAFVADASENELEEVLTFYTQKNKSASVFLGTPN 617          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Xenopus
Match: mboat7 (membrane bound O-acyltransferase domain containing 7 [Source:Xenbase;Acc:XB-GENE-978827])

HSP 1 Score: 454.136 bits (1167), Expect = 2.913e-143
Identity = 225/460 (48.91%), Postives = 319/460 (69.35%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINEL--KFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            +K+P ++F  EAVL K+ ++R +GERY LSYKI +TD +L+++IL++HGF E  + SND+N++WTG HVKP  +R+++  QKVNHFPRSYELTRKDRL+KN+Q+MQQ  G K+F  +P +YL+P+E+Q+ C  F+K++  +I+KP+A SRGRG+                        YLIN +  KFD+R+YVL+TSYDPLV YLYEEGLTRFAT KY    KN+K Q MHLTNYSVNKK+ +++  DD DVED+GNKWS+ A+LRYLK    DT  LM ++ED+I+K+++S E PI++  +   T+R NCFELYG+D++ID NL+PWLLEVNLSPSL+CD+PLD K+K+ M+SDMF+L+G+             Y  +K        S  D     Q+ N+  ++RR +  L    LS        ++L+++RRV++EY+R+GG++RIFP   + + Y
Sbjct:   51 RKVPIVMFHAEAVLHKNLSLRAVGERYKLSYKIVRTDSRLVRSILSAHGFQEVNANSNDFNIMWTGSHVKPHIMRSLTNFQKVNHFPRSYELTRKDRLYKNVQRMQQSHGFKNFHLLPQTYLLPAEYQDFCTAFAKDRGPWIVKPVASSRGRGV------------------------YLINSVRFKFDVRLYVLITSYDPLVIYLYEEGLTRFATAKYDRAAKNIKNQFMHLTNYSVNKKSGDYVSCDDPDVEDYGNKWSMSAMLRYLKQDGKDTAALMSQVEDLIIKTIVSAELPIASACKSLITHRGNCFELYGFDVLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLVGM-------------YFYTK---HQRPLSANDIDTGLQVGNREKAVRRTSCLL---GLSI-------EELKILRRVQDEYERRGGFVRIFPRHNTWQLY 460          

HSP 2 Score: 72.7886 bits (177), Expect = 2.843e-12
Identity = 44/110 (40.00%), Postives = 69/110 (62.73%), Query Frame = 3
Query: 2445 ELVIRFLKRAATNMSANEFEIP-TIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIEN--PAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN-PN 2762
            ELV+RFL+R A N+  +   +P  +P +S P  +R+  LAKLLG+F+ +Y++ET     ++E ++     ++   F  F+  ASEN+LE  L+ YT+ NKSA +FL  PN
Sbjct:  511 ELVMRFLQRGAANLKRS---LPLNLPGQSVPYLERRHLLAKLLGDFVALYNQETQQMQNSEETQSNEECGVNPDDFEAFVADASENELEEVLTFYTQKNKSASVFLGTPN 617          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Mouse
Match: Ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:MGI Symbol;Acc:MGI:2443657])

HSP 1 Score: 507.294 bits (1305), Expect = 4.102e-166
Identity = 249/473 (52.64%), Postives = 341/473 (72.09%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQ---PYLNSKVRSSNYSQSTTD--NKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  EA+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP     N+   P   S  R+       T   +    ++ N  +S R    G     L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHAEAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGKDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRTSNRSIYPSFESSRRNPFQKPQRTRPLSASDAEMKNLVASAREKVPG----KLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 495          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Mouse
Match: Ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:MGI Symbol;Acc:MGI:2443657])

HSP 1 Score: 516.538 bits (1329), Expect = 5.314e-161
Identity = 247/474 (52.11%), Postives = 343/474 (72.36%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQ---PYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRR---DLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  EA+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP     N+   P   S  R+       T     + ++  ++ ++   A  R +    L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHAEAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGKDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRTSNRSIYPSFESSRRNPFQKPQRT-----RPLSASDAEMKNLVASAREKVPGKLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 495          

HSP 2 Score: 91.6633 bits (226), Expect = 4.763e-18
Identity = 67/162 (41.36%), Postives = 98/162 (60.49%), Query Frame = 3
Query: 2289 RIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEE-SHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAI-----IDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            +I+Q  G L+K+QAR+AFS YL  VQ RL  +   +  S S + KE    EQ+ELV+RFLKRA++N+  +   +  +PSR   L +R+  LA  LG+FI +Y++ET   A  K  +         ++ +SF  F+R ASE +LE  L+ YT+ NKSA +FL 
Sbjct:  663 QILQDNGNLSKVQARLAFSAYLQHVQIRLTKDSGGQTLSPSWAAKED---EQMELVVRFLKRASSNLQHSLRMV--LPSRRLALLERRRILAHQLGDFIGVYNKETEQMAEKKSKKKLEEEEEDGVNAESFQEFIRQASEAELEEVLTFYTQKNKSASVFLG 819          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Mouse
Match: Ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:MGI Symbol;Acc:MGI:2443657])

HSP 1 Score: 516.153 bits (1328), Expect = 9.930e-161
Identity = 247/474 (52.11%), Postives = 343/474 (72.36%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQ---PYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRR---DLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  EA+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP     N+   P   S  R+       T     + ++  ++ ++   A  R +    L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHAEAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGKDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRTSNRSIYPSFESSRRNPFQKPQRT-----RPLSASDAEMKNLVASAREKVPGKLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 495          

HSP 2 Score: 91.6633 bits (226), Expect = 5.298e-18
Identity = 67/162 (41.36%), Postives = 98/162 (60.49%), Query Frame = 3
Query: 2289 RIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEE-SHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAI-----IDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            +I+Q  G L+K+QAR+AFS YL  VQ RL  +   +  S S + KE    EQ+ELV+RFLKRA++N+  +   +  +PSR   L +R+  LA  LG+FI +Y++ET   A  K  +         ++ +SF  F+R ASE +LE  L+ YT+ NKSA +FL 
Sbjct:  676 QILQDNGNLSKVQARLAFSAYLQHVQIRLTKDSGGQTLSPSWAAKED---EQMELVVRFLKRASSNLQHSLRMV--LPSRRLALLERRRILAHQLGDFIGVYNKETEQMAEKKSKKKLEEEEEDGVNAESFQEFIRQASEAELEEVLTFYTQKNKSASVFLG 832          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Mouse
Match: Ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:MGI Symbol;Acc:MGI:2443657])

HSP 1 Score: 516.538 bits (1329), Expect = 1.274e-160
Identity = 247/474 (52.11%), Postives = 343/474 (72.36%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQ---PYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRR---DLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  EA+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP     N+   P   S  R+       T     + ++  ++ ++   A  R +    L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHAEAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGKDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRTSNRSIYPSFESSRRNPFQKPQRT-----RPLSASDAEMKNLVASAREKVPGKLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 495          

HSP 2 Score: 91.6633 bits (226), Expect = 5.447e-18
Identity = 67/162 (41.36%), Postives = 98/162 (60.49%), Query Frame = 3
Query: 2289 RIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEE-SHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAI-----IDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            +I+Q  G L+K+QAR+AFS YL  VQ RL  +   +  S S + KE    EQ+ELV+RFLKRA++N+  +   +  +PSR   L +R+  LA  LG+FI +Y++ET   A  K  +         ++ +SF  F+R ASE +LE  L+ YT+ NKSA +FL 
Sbjct:  676 QILQDNGNLSKVQARLAFSAYLQHVQIRLTKDSGGQTLSPSWAAKED---EQMELVVRFLKRASSNLQHSLRMV--LPSRRLALLERRRILAHQLGDFIGVYNKETEQMAEKKSKKKLEEEEEDGVNAESFQEFIRQASEAELEEVLTFYTQKNKSASVFLG 832          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Mouse
Match: Ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:MGI Symbol;Acc:MGI:2443657])

HSP 1 Score: 471.855 bits (1213), Expect = 1.745e-154
Identity = 221/383 (57.70%), Postives = 298/383 (77.81%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQ 1436
            C +    C  ++IP L+F  EA+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP     N+
Sbjct:   29 CIMWTGGC--RRIPVLVFHAEAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGKDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRTSNR 409          
BLAST of Tubulin polyglutamylase TTLL5 vs. UniProt/SwissProt
Match: sp|Q8CHB8|TTLL5_MOUSE (Tubulin polyglutamylase TTLL5 OS=Mus musculus OX=10090 GN=Ttll5 PE=1 SV=3)

HSP 1 Score: 516.538 bits (1329), Expect = 8.911e-160
Identity = 247/474 (52.11%), Postives = 343/474 (72.36%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQ---PYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRR---DLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  EA+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP     N+   P   S  R+       T     + ++  ++ ++   A  R +    L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHAEAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGKDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRTSNRSIYPSFESSRRNPFQKPQRT-----RPLSASDAEMKNLVASAREKVPGKLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 495          

HSP 2 Score: 91.6633 bits (226), Expect = 3.810e-17
Identity = 67/162 (41.36%), Postives = 98/162 (60.49%), Query Frame = 3
Query: 2289 RIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEE-SHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAI-----IDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            +I+Q  G L+K+QAR+AFS YL  VQ RL  +   +  S S + KE    EQ+ELV+RFLKRA++N+  +   +  +PSR   L +R+  LA  LG+FI +Y++ET   A  K  +         ++ +SF  F+R ASE +LE  L+ YT+ NKSA +FL 
Sbjct:  676 QILQDNGNLSKVQARLAFSAYLQHVQIRLTKDSGGQTLSPSWAAKED---EQMELVVRFLKRASSNLQHSLRMV--LPSRRLALLERRRILAHQLGDFIGVYNKETEQMAEKKSKKKLEEEEEDGVNAESFQEFIRQASEAELEEVLTFYTQKNKSASVFLG 832          
BLAST of Tubulin polyglutamylase TTLL5 vs. UniProt/SwissProt
Match: sp|Q6EEF3|TTLL5_CHLAE (Tubulin polyglutamylase TTLL5 OS=Chlorocebus aethiops OX=9534 GN=TTLL5 PE=2 SV=2)

HSP 1 Score: 512.301 bits (1318), Expect = 1.704e-158
Identity = 248/483 (51.35%), Postives = 341/483 (70.60%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIR-RPTA----------GLRRR----DLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  +A+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP      +P   +   S           +P Q ++     R RP +          G  R      L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHADAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDATLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRASTRPIYPTFESSRRNPFQKPQRPLPAQFHSSEPKQRSRPLSASDAEMKNLVGSAREKGPGKLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 509          

HSP 2 Score: 90.5077 bits (223), Expect = 8.301e-17
Identity = 65/162 (40.12%), Postives = 98/162 (60.49%), Query Frame = 3
Query: 2289 RIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEE-SHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAI-----IDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            +++Q  G L+K+QAR+AFS YL  VQ RL+ +   +  S S + KE    EQ+ELV+RFLKRA+ N+  +   +  +PSR   L +R+  LA  LG+FI +Y++ET   A  K  +         ++ ++F  F+R ASE +LE  L+ YT+ NKSA +FL 
Sbjct:  677 QVLQDNGNLSKVQARIAFSTYLQHVQIRLMKDSGGQTFSASWAAKED---EQMELVVRFLKRASNNLQQSLRMV--LPSRRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVFLG 833          
BLAST of Tubulin polyglutamylase TTLL5 vs. UniProt/SwissProt
Match: sp|Q6EMB2|TTLL5_HUMAN (Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3)

HSP 1 Score: 511.916 bits (1317), Expect = 1.981e-158
Identity = 249/477 (52.20%), Postives = 341/477 (71.49%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQP-YLNSKVRSSNYSQ--------STTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  +A+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP      +P Y   +    N  Q        S +D     ++ N   S R    G     L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHADAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRASTRPIYPTFESSRRNPFQKPQRCRPLSASD----AEMKNLVGSAREKGPG----KLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 495          

HSP 2 Score: 89.3521 bits (220), Expect = 1.668e-16
Identity = 66/162 (40.74%), Postives = 98/162 (60.49%), Query Frame = 3
Query: 2289 RIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEE-SHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAI-----IDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            +I+Q  G L+K+QAR+AFS YL  VQ RL+ +   +  S S + KE    EQ+ELV+RFLKRA+ N+  +   +  +PSR   L +R+  LA  LG+FI +Y++ET   A  K  +         ++ ++F  F+R ASE +LE  L+ YT+ NKSA +FL 
Sbjct:  663 QILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKED---EQMELVVRFLKRASNNLQHSLRMV--LPSRRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVFLG 819          
BLAST of Tubulin polyglutamylase TTLL5 vs. UniProt/SwissProt
Match: sp|Q5R978|TTLL5_PONAB (Tubulin polyglutamylase TTLL5 OS=Pongo abelii OX=9601 GN=TTLL5 PE=2 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 2.422e-158
Identity = 249/477 (52.20%), Postives = 341/477 (71.49%), Query Frame = 3
Query:  288 CTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQP-YLNSKVRSSNYSQ--------STTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
            C +    C  ++IP L+F  +A+L KD+NIR IGERY+LSYKI +TD +L+++IL +HGF E    S DYNL+WTG H+KPF LRT+SE QKVNHFPRSYELTRKDRL+KNI +MQ   G K F  +P ++L+P+E+ E C ++SK++  +I+KP+A SRGRG++L N+P QI L+E ++ S+YI+NP LI++ KFD+R+YVLVTSYDPLV YLYEEGL RFATV+Y    KN++ Q MHLTNYSVNKK+ +++  DD +VED+GNKWS+ A+LRYLK +  DTT LM  +ED+I+K++IS E  I+   + F  +RS+CFELYG+D++ID  L+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMF+++G  C+DP      +P Y   +    N  Q        S +D     ++ N   S R    G     L  S      ++++++RRV+EE  R+GG+IRIFPTSE+ E Y
Sbjct:   29 CIMWTGGC--RRIPVLVFHADAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRASTRPIYPTFESSRRNPFQKPQRCRPLSASD----AEMKNLVGSAREKGPG----KLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIY 495          

HSP 2 Score: 90.1225 bits (222), Expect = 1.000e-16
Identity = 66/162 (40.74%), Postives = 98/162 (60.49%), Query Frame = 3
Query: 2289 RIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEE-SHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAI-----IDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLN 2756
            +I+Q  G L+K+QAR+AFS YL  VQ RL+ +   +  S S + KE    EQ+ELV+RFLKRA+ N+  +   +  +PSR   L +R+  LA  LG+FI +Y++ET   A  K  +         ++ ++F  F+R ASE +LE  L+ YT+ NKSA +FL 
Sbjct:  676 QILQDNGNLSKVQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKED---EQMELVVRFLKRASNNLQHSLRMV--LPSRRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVFLG 832          
BLAST of Tubulin polyglutamylase TTLL5 vs. UniProt/SwissProt
Match: sp|E9P886|TTLL5_CAEEL (Tubulin polyglutamylase ttll-5 OS=Caenorhabditis elegans OX=6239 GN=ttll-5 PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 2.373e-91
Identity = 184/513 (35.87%), Postives = 306/513 (59.65%), Query Frame = 3
Query:  249 IVGTNKEKSNSDICTVIGTNCFGKKIPYLIFSVEAV--LRKDSNIRK----IGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF---SKE----------KNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKT-QCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDL-------STSSTPFRSDQL-RMIRRVREEYKRKGGWIRIFPTSESLETYFPLF 1703
            +V  NK+  NSD               Y++FS +A+  +  D+ + +    +GER  L++K+ ++D +L++T+ +SHGF++C S +   N++W G  VK   +R +   Q++N FPRS ELT+KDRL++NI++ + + G + FDF+P  Y+ P E +++   F   +KE             +I+KP    +G+GIF +N    IP +  L+ S+Y+ +PYL+N  KFD+R+YV VTS+ PLVAY+Y EGL R A+  Y  +  +  + + +HLTNYS+NK +  F+ N+    ED G+KW+LGALLRY++++  D   LM++IED+IVKSL+S++  ++  SR    +    FEL+G+D+++D+ L+PWLLEVNLSPSL+CD+PLD  +K+ +++D+ +L  +   D  + +   P L   + S     S TD+     +  +  +++R   GL+R  L       STS  P    +  +++R+   E  R+G +IR+FP + +   Y P+ 
Sbjct:   81 LVSRNKKSRNSD---------------YMLFSSDALVHIAHDAKVSEKYTWLGERLRLTFKMMRSDSRLIRTMCHSHGFMQCSSKNPSVNVIWMGAPVKSVRMRELMPWQRLNQFPRSTELTKKDRLYENIERSKSIFG-ESFDFIPEFYVTPRENRKMENAFVRVAKEIAAAGGELCFPGEFIVKPTNSRQGKGIFFANSMADIPAEGPLLVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVENEGKDAKLLMLRIEDLIVKSLLSIQNSVATASRTNLRFACTNFELFGFDVLVDQALKPWLLEVNLSPSLACDAPLDSLLKTRLIADLLNLACVPLLDRKIIDSVTPALRKSMNSQESESSETDDLELDPMCAK--TLKRRPVGLKRSVLNKKIVSGSTSLIPNNEKKFDQIVRKAELEDGRRGDFIRVFPRNGTWGMYSPVM 575          
BLAST of Tubulin polyglutamylase TTLL5 vs. TrEMBL
Match: A0A267GSD8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002170g4 PE=4 SV=1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 359/842 (42.64%), Postives = 514/842 (61.05%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDP---VLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFXXXXXXXXXXXXXTHTYMNLNRLLHSKLFPNHIIDIDNFARSISQNQAIIKSRISLHSVNYNSSYHKDPFNQTLPTNQGTYKRISQNYSDTQTRIPYYERKL--GEEPQLRN--------QPEKSSFQDPIETAKNSNPIENNFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDEEHTSTASHNIPSSMSQSSKEILSVDRIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLS-DKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFL--NPNLNT--KNPEPT 2789
            +K P L+F   AV R++  +R IGE+Y+L++KI +T+CKLLKTIL +HGF E    S D+NL+WTGGH+KP++LR M+E QK+NHFPRSYELTRKDRLFKN+Q+MQQL G +HFDFVP S+++P+E+Q+LC     EK  +I+KPIA SRGRGIF+ N+P QI LDEQL+A KYI+NP L++  KFD+R+YV VTSYDPL+ Y+YEEGL RFATV+YQ   + L+ QCMHLTNYSVNK+N +F+ NDDA+VED+GNKWSLGALLRYL+S+  DT  LMM+IED+++KS++SVE+ +SA  RMFQ +R NCFELYG+DII+DE LRPWLLEVNLSPSL+CDSPLDFKIK +M+SD+ SL+G  C+DP   VL+ P          + + S+  + + + +   +      +P+                 D+ RM+R  REE++R+GGW+R+FP+  S +TY                       L+R+L+ K +P       + A S S +  +   ++SLHS++  S          L + Q  Y RI   Y     R+  YE +L   E P + N        +P +        T   +  +E++         +S+++ + S    +      S +    +  +     +  SS +  +   +  + +V  GG ++ +QAR AF+ YL+R++RRLL +       +LS + E  +++Q++LV+RFL+RA    +    +   +PSR   L QRQ  LA LL +F+R Y+RET       E +    +    F  F+R A E  LE  L+ YTR N+SAG+F+  +P  +T    P PT
Sbjct:   73 RKRPILVFLPHAVERRNPQVRCIGEKYHLAFKIVRTECKLLKTILLAHGFHETHPNSLDFNLVWTGGHLKPYSLRGMTEFQKINHFPRSYELTRKDRLFKNVQRMQQLMGARHFDFVPSSFILPAEYQDLCSYHHAEKGPFIVKPIASSRGRGIFIVNNPEQIVLDEQLVACKYIANPLLVDGFKFDLRIYVAVTSYDPLMIYVYEEGLARFATVRYQADGRQLRNQCMHLTNYSVNKRNRDFVQNDDAEVEDYGNKWSLGALLRYLRSEGHDTAALMMRIEDVVIKSILSVESAVSAACRMFQPHRGNCFELYGFDIILDEALRPWLLEVNLSPSLACDSPLDFKIKCNMLSDLLSLVGFVCQDPMLRVLHAPGGGAGARAGSAGSSSRPGSASSV-RSAGSAGGGGGQPSL----------------DEQRMLRIAREEFRRRGGWLRVFPSQHSWDTYSAFL-------QQSPQQGQANAALHRMLYPKRWPTQASQAQSRAGSASAS-TVPAGKLSLHSISSASLAGALRTAAGLASRQ--YGRIRAAYRTALRRVRRYESRLTRDEAPVIVNAAPAPPALRPSRQRTTTTTATTTEAPAVESSVEALPPRPPASTAATATSANARSRPPRPKSSVRQPTDPTSQQQQQHPASSGATPAAPPVDPESVVSRGGGMSPLQARQAFAAYLARIRRRLLADQAVLAHETLSPEDERLANDQLDLVLRFLRRADAEGAG---KASGLPSRRLSLAQRQSVLAGLLADFVRRYARETETMRQRGE-DGSGGLPAGEFAVFVRTAEEAQLEALLTAYTRANRSAGVFIRASPASSTTAAGPPPT 883          
BLAST of Tubulin polyglutamylase TTLL5 vs. TrEMBL
Match: A0A267F4A0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002170g1 PE=4 SV=1)

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 360/839 (42.91%), Postives = 511/839 (60.91%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFXXXXXXXXXXXXXTHTYMNLNRLLHSKLFPNHIIDIDNFARSISQNQAIIKSRISLHSVNYNSSYHKDPFNQTLPTNQGTYKRISQNYSDTQTRIPYYERKL--GEEPQLRN--------QPEKSSFQDPIETAKNSNPIENNFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDEEHTSTASHNIPSSMSQSSKEILSVDRIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLS-DKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFL--NPNLNT--KNPEPT 2789
            +K P L+F   AV R++  +R IGE+Y+L++KI +T+CKLLKTIL +HGF E    S D+NL+WTGGH+KP++LR M+E QK+NHFPRSYELTRKDRLFKN+Q+MQQL G +HFDFVP S+++P+E+Q+LC     EK  +I+KPIA SRGRGIF+ N+P QI LDEQL+A KYI+NP L++  KFD+R+YV VTSYDPL+ Y+YEEGL RFATV+YQ   + L+ QCMHLTNYSVNK+N +F+ NDDA+VED+GNKWSLGALLRYL+S+  DT  LMM+IED+++KS++SVE+ +SA  RMFQ +R NCFELYG+DII+DE LRPWLLEVNLSPSL+CDSPLDFKIK +M+SD+ SL+G  C+DP+L   + P   +  R+ +   S+             SS+R   +          S     D+ RM+R  REE++R+GGW+R+FP+  S +TY                       L+R+L+ K +P       + A   +   A+   ++SLHS++  S          L + Q  Y RI   Y     R+  YE +L   E P + N        +P +        T   +  +E++         +S+++ +      +      S +    +  +        SS +  +   +  + +V  GG ++ +QAR AF+ YL+R++RRLL +       +LS + E  +++Q++LV+RFL+RA    +    +   +PSR   L QRQ  LA LL +F+R Y+RET       E +    +    F  F+R A E  LE  L+ YTR N+SAG+F+  +P  +T    P PT
Sbjct:   73 RKRPILVFLPHAVERRNPQVRCIGEKYHLAFKIVRTECKLLKTILLAHGFHETHPNSLDFNLVWTGGHLKPYSLRGMTEFQKINHFPRSYELTRKDRLFKNVQRMQQLMGARHFDFVPASFILPAEYQDLCSYHHAEKGPFIVKPIASSRGRGIFIVNNPEQIVLDEQLVACKYIANPLLVDGFKFDLRIYVAVTSYDPLMIYVYEEGLARFATVRYQADGRQLRNQCMHLTNYSVNKRNRDFVQNDDAEVEDYGNKWSLGALLRYLRSEGHDTAALMMRIEDVVIKSILSVESAVSAACRMFQPHRGNCFELYGFDIILDEALRPWLLEVNLSPSLACDSPLDFKIKCNMLSDLLSLVGFVCQDPMLRVLHAPGGGAGARAGSAGSSSR--------PGSASSVRSAGSAGGGGGGGQPSL----DEQRMLRIAREEFRRRGGWLRVFPSQHSWDTYSAFL-------QQSPQQGQANAALHRMLYPKRWPAQASQAQSRA-GSASASAVPAGKLSLHSISSASLAGALRTAAGLASRQ--YGRIRAAYRTALRRVRRYESRLTRDEAPVIVNAAPAPPALRPSRQRTTTTTATTTEAPAVESSVEALPPRPPASTAATATGANARSRPPRPKSSVRQPTDPTSQQQQQRPASSGATPAAPPVDPESVVSRGGGMSPLQARQAFAAYLARIRRRLLADQAVLAHETLSPEDERLANDQLDLVLRFLRRADAEGAG---KASGLPSRRLSLAQRQSVLAGLLADFVRRYARETETMRQRGE-DGSGGLPAGEFAVFVRTAEEAQLEALLTAYTRANRSAGVFIRASPASSTTAAGPPPT 885          
BLAST of Tubulin polyglutamylase TTLL5 vs. TrEMBL
Match: A0A267H1X6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017515g1 PE=4 SV=1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 300/594 (50.51%), Postives = 399/594 (67.17%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPT--------------------AGLRRRD---------LSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFXXXXXXXXXXXXXTHTYMNLNRLLHSKLFPNHIIDIDNFARSISQNQAIIKSRISLHSVNYNSSYHKDPFNQTLPTNQGTYKRISQNYSDTQTRIPYYERKLG 2012
            KK P  IFS  AV R+D   R +GE+Y++++KI KTDCKLLKTIL SHGF E    S+D+NL+WTG H+KP+ LR++SE QKVNHFPRSYELTRKDRL+KN+Q++QQLKG+KHFDFVPP+++ P+EFQE C  + K+K  +I+KPIA SRGRGIF++ HP QIPLD+QL+  KY++NP +++  KFD+R+YV VTSYDPLV Y+YEEGL RFATVKYQ   K  + QCMHLTNYSVNKKN E++ NDDADVED+GNKWSLGALLRYLKS+  DT+ LMM++ED+IVK+++SVE PI++  +MFQ ++ NCFELYG+DIIID+ LRPWLLEVNLSPSL+CDSPLDFKIK HM+SD+ SL+G  C DP+L    Q +  S   ++  S S + +       ++ + + RP                       L +R             ++ P  ++++RMIRR REE+ R+GGW+RIFPT +S E Y                   T    N LLH +LFPN    +   A+S  Q     K ++ LHS++       D  +  L ++   ++++ + Y     R  +YERKLG
Sbjct:   54 KKFPIFIFSPHAVERRDPQFRSVGEKYHMAFKIIKTDCKLLKTILVSHGFHETHPNSSDFNLMWTGSHLKPYVLRSLSEFQKVNHFPRSYELTRKDRLYKNVQRLQQLKGVKHFDFVPPTFIFPAEFQEFCTYYLKDKGPFIVKPIASSRGRGIFIATHPDQIPLDDQLVVCKYVANPLVVDGFKFDLRIYVAVTSYDPLVIYMYEEGLARFATVKYQAALKYSRNQCMHLTNYSVNKKNQEYVQNDDADVEDYGNKWSLGALLRYLKSEGHDTSALMMRLEDVIVKAILSVEMPIASACKMFQPHKGNCFELYGFDIIIDDTLRPWLLEVNLSPSLACDSPLDFKIKCHMLSDLLSLVGFVCHDPML---RQLHTTSGRSTAAGSGSGSRDSPVSAARSRQAQMSRPGSASSLRSLSATRLGGWHQQQGPLHQRQQSSGAAAASAPGTAPPLSAEEVRMIRRCREEFHRRGGWLRIFPTPDSWEAYSGFL--------------QTLSPNNLLLHQRLFPN----VWRQAKSTPQASG-AKCKVPLHSLS------SDNLSIVLDSHSEHHRKVHRMYRSASQRTLFYERKLG 619          

HSP 2 Score: 108.612 bits (270), Expect = 6.470e-20
Identity = 66/159 (41.51%), Postives = 99/159 (62.26%), Query Frame = 3
Query: 2277 LSVDRIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFL 2753
               + +++ GG +TK+QAR AF+ YL+RVQRRLL + +   S +  + +  ++EQ++LV+RFL+RAA    A        PSR   L QRQ  LA +L +F+R YSR+T      +E   PA + +  F  FLR+A E+ LE  L++YT VNK+AG+F+
Sbjct:  719 FDAETVLKQGGNMTKVQARQAFAAYLTRVQRRLLADHQLPPS-TGDEADRLANEQLDLVLRFLRRAAGAKIAG-------PSRRLGLRQRQRILANMLADFVRSYSRDTEGMRPQQEDGAPAGVPEPQFTSFLRLAEESQLESLLTSYTLVNKAAGVFI 869          
BLAST of Tubulin polyglutamylase TTLL5 vs. TrEMBL
Match: A0A267EQ94 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027105g1 PE=4 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 299/594 (50.34%), Postives = 399/594 (67.17%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPT--------------------AGLRRRD---------LSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFXXXXXXXXXXXXXTHTYMNLNRLLHSKLFPNHIIDIDNFARSISQNQAIIKSRISLHSVNYNSSYHKDPFNQTLPTNQGTYKRISQNYSDTQTRIPYYERKLG 2012
            KK P  IFS  AV R+D   R +GE+Y++++KI KTDCKLLKTIL SHGF E    S+D+NL+WTG H+KP+ LR++SE QKVNHFPRSYELTRKDRL+KN+Q++QQLKG+KHFDFVPP+++ P+EFQE C  + K+K  +I+KPIA SRGRGIF++ HP QIPLD+QL+  KY++NP +++  KFD+R+YV VTSYDPLV Y+YEEGL RFATVKYQ   +  + QCMHLTNYSVNKKN E++ NDDADVED+GNKWSLGALLRYLKS+  DT+ LMM++ED+IVK+++SVE PI++  +MFQ ++ NCFELYG+DIIID+ LRPWLLEVNLSPSL+CDSPLDFKIK HM+SD+ SL+G  C DP+L    Q +  S   ++  S S + +       ++ + + RP                       L +R           + ++ P  ++++RMIRR REE+ R+GGW+RIFPT +S E Y                   T    N LLH +LFPN    +   A+S  Q     K ++ LHS++       D     L ++   ++++ + Y     R  +YERKLG
Sbjct:   54 KKFPIFIFSPHAVERRDPQFRSVGEKYHMAFKIIKTDCKLLKTILVSHGFHETHPNSSDFNLMWTGSHLKPYVLRSLSEFQKVNHFPRSYELTRKDRLYKNVQRLQQLKGVKHFDFVPPTFIFPAEFQEFCTYYLKDKGPFIVKPIASSRGRGIFIATHPDQIPLDDQLVVCKYVANPLVVDGFKFDLRIYVAVTSYDPLVIYMYEEGLARFATVKYQAALRYSRNQCMHLTNYSVNKKNQEYVQNDDADVEDYGNKWSLGALLRYLKSEGHDTSALMMRLEDVIVKAILSVEMPIASACKMFQPHKGNCFELYGFDIIIDDTLRPWLLEVNLSPSLACDSPLDFKIKCHMLSDLLSLVGFVCHDPML---RQLHTTSGRATAAGSGSGSRDSPVSAARSRQAQMSRPGSASSLRSLSATRLGGWHQQQGPLHQRQQSSGPAAASAAGAAPPLSAEEVRMIRRCREEFHRRGGWLRIFPTPDSWEAYSGFL--------------QTLSPNNLLLHQRLFPN----VWRQAKSTPQASG-AKCKVPLHSLS------SDNLATVLDSHSEHHRKVHRMYRSASQRTLFYERKLG 619          

HSP 2 Score: 108.227 bits (269), Expect = 6.959e-20
Identity = 66/159 (41.51%), Postives = 99/159 (62.26%), Query Frame = 3
Query: 2277 LSVDRIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFL 2753
               + +++ GG +TK+QAR AF+ YL+RVQRRLL + +   S +  + +  ++EQ++LV+RFL+RAA    A        PSR   L QRQ  LA +L +F+R YSR+T      +E   PA + +  F  FLR+A E+ LE  L++YT VNK+AG+F+
Sbjct:  724 FDAETVLKQGGNMTKVQARQAFAAYLTRVQRRLLADHQLPPS-TGDEADRLANEQLDLVLRFLRRAAGAKIAG-------PSRRLGLRQRQRILANMLADFVRSYSRDTEGMRPQQEDGAPAGVPEPQFTSFLRLAEESQLESLLTSYTLVNKAAGVFI 874          
BLAST of Tubulin polyglutamylase TTLL5 vs. TrEMBL
Match: A0A267DE65 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027105g2 PE=4 SV=1)

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 299/594 (50.34%), Postives = 399/594 (67.17%), Query Frame = 3
Query:  318 KKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPT--------------------AGLRRRD---------LSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFXXXXXXXXXXXXXTHTYMNLNRLLHSKLFPNHIIDIDNFARSISQNQAIIKSRISLHSVNYNSSYHKDPFNQTLPTNQGTYKRISQNYSDTQTRIPYYERKLG 2012
            KK P  IFS  AV R+D   R +GE+Y++++KI KTDCKLLKTIL SHGF E    S+D+NL+WTG H+KP+ LR++SE QKVNHFPRSYELTRKDRL+KN+Q++QQLKG+KHFDFVPP+++ P+EFQE C  + K+K  +I+KPIA SRGRGIF++ HP QIPLD+QL+  KY++NP +++  KFD+R+YV VTSYDPLV Y+YEEGL RFATVKYQ   +  + QCMHLTNYSVNKKN E++ NDDADVED+GNKWSLGALLRYLKS+  DT+ LMM++ED+IVK+++SVE PI++  +MFQ ++ NCFELYG+DIIID+ LRPWLLEVNLSPSL+CDSPLDFKIK HM+SD+ SL+G  C DP+L    Q +  S   ++  S S + +       ++ + + RP                       L +R           + ++ P  ++++RMIRR REE+ R+GGW+RIFPT +S E Y                   T    N LLH +LFPN    +   A+S  Q     K ++ LHS++       D     L ++   ++++ + Y     R  +YERKLG
Sbjct:   54 KKFPIFIFSPHAVERRDPQFRSVGEKYHMAFKIIKTDCKLLKTILVSHGFHETHPNSSDFNLMWTGSHLKPYVLRSLSEFQKVNHFPRSYELTRKDRLYKNVQRLQQLKGVKHFDFVPPTFIFPAEFQEFCTYYLKDKGPFIVKPIASSRGRGIFIATHPDQIPLDDQLVVCKYVANPLVVDGFKFDLRIYVAVTSYDPLVIYMYEEGLARFATVKYQAALRYSRNQCMHLTNYSVNKKNQEYVQNDDADVEDYGNKWSLGALLRYLKSEGHDTSALMMRLEDVIVKAILSVEMPIASACKMFQPHKGNCFELYGFDIIIDDTLRPWLLEVNLSPSLACDSPLDFKIKCHMLSDLLSLVGFVCHDPML---RQLHTTSGRATAAGSGSGSRDSPVSAARSRQAQMSRPGSASSLRSLSATRLGGWHQQQGPLHQRQQSSGPAAASAAGAAPPLSAEEVRMIRRCREEFHRRGGWLRIFPTPDSWEAYSGFL--------------QTLSPNNLLLHQRLFPN----VWRQAKSTPQASG-AKCKVPLHSLS------SDNLATVLDSHSEHHRKVHRMYRSASQRTLFYERKLG 619          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 513.072 bits (1320), Expect = 2.517e-159
Identity = 245/470 (52.13%), Postives = 351/470 (74.68%), Query Frame = 3
Query:  294 VIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNN--PNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAG--LRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
             I  +   +KIP L+F  EA++  D NIR IGE+YNL +KI +T+ +L++ IL +HGF E    SNDYNL+WTG H+K + LRT+ + Q+VNHFPRS+ELTRKDRL+KNIQ+MQQ  G ++F  VP ++++P+E+QE C  FSK+K  +IIKP+A SRGRGI+L + P QIP++E L+ S+YI+NP LI++ KFD+R+YVLVTSYDP++ Y+YEEGL RFATVKY +  KN+K Q MHLTNYSVNKK+++++  DD +VED+GNKWS+ A+LRYL+ +  DTT LM +IED+I+K+++S E  I+   +MF  +R+NCFELYG+D++ID NL+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMFSL+G  C+DPV+     ++  L+S V+  N +Q T   + P    + ++  +    G  + R DL+       +++ +++RR +EE++R+GG+IRIFPT ++ E Y
Sbjct:   24 CIAWSGVSRKIPVLLFHAEALVLTDGNIRSIGEKYNLGFKIVRTESRLVRGILVNHGFHEVHPNSNDYNLMWTGTHLKTYLLRTLQDFQRVNHFPRSHELTRKDRLYKNIQRMQQTYGFQNFHIVPQTFVLPAEYQEFCNYFSKDKGPWIIKPVASSRGRGIYLVSSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEIQIATACKMFVPHRNNCFELYGFDVLIDSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLVGFVCQDPVVKQMRSDKAGLDSSVK--NQTQKT---QRPLSATDTDADQKEKQGGKQVERLDLT-------AEEAKVLRRTQEEHERRGGFIRIFPTPQTWELY 481          

HSP 2 Score: 114.39 bits (285), Expect = 4.780e-25
Identity = 70/162 (43.21%), Postives = 100/162 (61.73%), Query Frame = 3
Query: 2292 IVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETS--LAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLNPNLNT 2771
            I+Q G  L+K+QARMAFS+YL RVQ RLL E R+  S +  +K+   ++Q+ELV+RFLKRAA+N+  +   +  +PSR   L  RQ  L+  LG FI+ Y++ET   + +  K  ++   I+   F  F+  ASE+DLE  L+ YT  NKSA +FL     T
Sbjct:  627 ILQQGWDLSKVQARMAFSSYLHRVQMRLLAESRANSSSAWREKD---NDQMELVMRFLKRAASNLQQDMRVV--LPSRQLSLPDRQRILSHQLGEFIQCYNKETEQMVKSLEKIKDDDRCINPNVFQEFILEASESDLEEVLTFYTHKNKSASVFLGTKCQT 783          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 511.916 bits (1317), Expect = 6.176e-159
Identity = 244/479 (50.94%), Postives = 354/479 (73.90%), Query Frame = 3
Query:  294 VIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNN--PNQPYLNSKVRSS------NYSQSTTDNKI---PKQINNQNSSIRRPTAG--LRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
             I  +   +KIP L+F  EA++  D NIR IGE+YNL +KI +T+ +L++ IL +HGF E    SNDYNL+WTG H+K + LRT+ + Q+VNHFPRS+ELTRKDRL+KNIQ+MQQ  G ++F  VP ++++P+E+QE C  FSK+K  +IIKP+A SRGRGI+L + P QIP++E L+ S+YI+NP LI++ KFD+R+YVLVTSYDP++ Y+YEEGL RFATVKY +  KN+K Q MHLTNYSVNKK+++++  DD +VED+GNKWS+ A+LRYL+ +  DTT LM +IED+I+K+++S E  I+   +MF  +R+NCFELYG+D++ID NL+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMFSL+G  C+DPV+     ++  L+S V++       ++S  +  +K+   P    + ++  +    G  + R DL+       +++ +++RR +EE++R+GG+IRIFPT ++ E Y
Sbjct:   24 CIAWSGVSRKIPVLLFHAEALVLTDGNIRSIGEKYNLGFKIVRTESRLVRGILVNHGFHEVHPNSNDYNLMWTGTHLKTYLLRTLQDFQRVNHFPRSHELTRKDRLYKNIQRMQQTYGFQNFHIVPQTFVLPAEYQEFCNYFSKDKGPWIIKPVASSRGRGIYLVSSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEIQIATACKMFVPHRNNCFELYGFDVLIDSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLVGFVCQDPVVKQMRSDKAGLDSSVKNQTQKTQRSFSAQSAKSKVHQRPLSATDTDADQKEKQGGKQVERLDLT-------AEEAKVLRRTQEEHERRGGFIRIFPTPQTWELY 495          

HSP 2 Score: 114.005 bits (284), Expect = 5.700e-25
Identity = 70/162 (43.21%), Postives = 100/162 (61.73%), Query Frame = 3
Query: 2292 IVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETS--LAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLNPNLNT 2771
            I+Q G  L+K+QARMAFS+YL RVQ RLL E R+  S +  +K+   ++Q+ELV+RFLKRAA+N+  +   +  +PSR   L  RQ  L+  LG FI+ Y++ET   + +  K  ++   I+   F  F+  ASE+DLE  L+ YT  NKSA +FL     T
Sbjct:  641 ILQQGWDLSKVQARMAFSSYLHRVQMRLLAESRANSSSAWREKD---NDQMELVMRFLKRAASNLQQDMRVV--LPSRQLSLPDRQRILSHQLGEFIQCYNKETEQMVKSLEKIKDDDRCINPNVFQEFILEASESDLEEVLTFYTHKNKSASVFLGTKCQT 797          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 512.301 bits (1318), Expect = 8.062e-159
Identity = 244/479 (50.94%), Postives = 354/479 (73.90%), Query Frame = 3
Query:  294 VIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNN--PNQPYLNSKVRSS------NYSQSTTDNKI---PKQINNQNSSIRRPTAG--LRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETY 1691
             I  +   +KIP L+F  EA++  D NIR IGE+YNL +KI +T+ +L++ IL +HGF E    SNDYNL+WTG H+K + LRT+ + Q+VNHFPRS+ELTRKDRL+KNIQ+MQQ  G ++F  VP ++++P+E+QE C  FSK+K  +IIKP+A SRGRGI+L + P QIP++E L+ S+YI+NP LI++ KFD+R+YVLVTSYDP++ Y+YEEGL RFATVKY +  KN+K Q MHLTNYSVNKK+++++  DD +VED+GNKWS+ A+LRYL+ +  DTT LM +IED+I+K+++S E  I+   +MF  +R+NCFELYG+D++ID NL+PWLLEVNLSPSL+CD+PLD KIK+ M+SDMFSL+G  C+DPV+     ++  L+S V++       ++S  +  +K+   P    + ++  +    G  + R DL+       +++ +++RR +EE++R+GG+IRIFPT ++ E Y
Sbjct:   24 CIAWSGVSRKIPVLLFHAEALVLTDGNIRSIGEKYNLGFKIVRTESRLVRGILVNHGFHEVHPNSNDYNLMWTGTHLKTYLLRTLQDFQRVNHFPRSHELTRKDRLYKNIQRMQQTYGFQNFHIVPQTFVLPAEYQEFCNYFSKDKGPWIIKPVASSRGRGIYLVSSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEIQIATACKMFVPHRNNCFELYGFDVLIDSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLVGFVCQDPVVKQMRSDKAGLDSSVKNQTQKTQRSFSAQSAKSKVHQRPLSATDTDADQKEKQGGKQVERLDLT-------AEEAKVLRRTQEEHERRGGFIRIFPTPQTWELY 495          

HSP 2 Score: 114.39 bits (285), Expect = 4.933e-25
Identity = 70/162 (43.21%), Postives = 100/162 (61.73%), Query Frame = 3
Query: 2292 IVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETS--LAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLNPNLNT 2771
            I+Q G  L+K+QARMAFS+YL RVQ RLL E R+  S +  +K+   ++Q+ELV+RFLKRAA+N+  +   +  +PSR   L  RQ  L+  LG FI+ Y++ET   + +  K  ++   I+   F  F+  ASE+DLE  L+ YT  NKSA +FL     T
Sbjct:  641 ILQQGWDLSKVQARMAFSSYLHRVQMRLLAESRANSSSAWREKD---NDQMELVMRFLKRAASNLQQDMRVV--LPSRQLSLPDRQRILSHQLGEFIQCYNKETEQMVKSLEKIKDDDRCINPNVFQEFILEASESDLEEVLTFYTHKNKSASVFLGTKCQT 797          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Cavefish
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:NCBI gene;Acc:103047112])

HSP 1 Score: 261.536 bits (667), Expect = 2.546e-71
Identity = 164/441 (37.19%), Postives = 257/441 (58.28%), Query Frame = 3
Query:  390 ERYNLSYKIYKTDCKLLK-TILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF--SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGI---GCEDPV----LNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDL-STSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSES 1679
            +R  L +K+      ++K TI  SH   +    S+D+   W G H+K    R + E+QK+NHFP S+++ RKDRL++N+ KMQ   G + F F P S+++P + + L + +     +  +IIKP A +RG GI + +   Q+P    L+  KY+  PYLI+  KFD+R+YV VTSYDPL  Y++ +GL RFA+ KY ++ K+L  + MHLTNYSVNKKN+E+  N D D    G+KW+L AL +YL  + V+TT +  KI+D++VK++I+ +  +++  +M      +C EL+G+DI++DENL+PW+LEVN+SPSL  +S LD  IK  M+ D+ +L G      ED +     ++ +   L   VR  + S  + D K+ +            T     +D  ST       D +R++    +E  R+G + R+FP+  S
Sbjct:  563 QRKLLKWKMSSVTPNIVKHTITRSH--FKVTKKSHDWLGCW-GHHMKSLGFRAIREYQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFVLPQDMKLLKKAWEDGGSRQKWIIKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRVYIFNDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKKNSEYQTNSD-DKACQGHKWALKALWQYLGYRGVNTTLIWDKIKDMVVKTIIAADPYVNSLVKMHLRSSYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNSALDVSIKGQMIRDVLNLAGFVLPHSEDVLPPGSSDSSSTSSLCGGVREKSRSDLSADEKVKRAF--------YLTQRFGDQDFYSTVLDVLTPDDVRVLAETEDELSRQGEFERVFPSPTS 991          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Cavefish
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:NCBI gene;Acc:103047112])

HSP 1 Score: 261.536 bits (667), Expect = 2.768e-71
Identity = 164/441 (37.19%), Postives = 257/441 (58.28%), Query Frame = 3
Query:  390 ERYNLSYKIYKTDCKLLK-TILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF--SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGI---GCEDPV----LNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDL-STSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSES 1679
            +R  L +K+      ++K TI  SH   +    S+D+   W G H+K    R + E+QK+NHFP S+++ RKDRL++N+ KMQ   G + F F P S+++P + + L + +     +  +IIKP A +RG GI + +   Q+P    L+  KY+  PYLI+  KFD+R+YV VTSYDPL  Y++ +GL RFA+ KY ++ K+L  + MHLTNYSVNKKN+E+  N D D    G+KW+L AL +YL  + V+TT +  KI+D++VK++I+ +  +++  +M      +C EL+G+DI++DENL+PW+LEVN+SPSL  +S LD  IK  M+ D+ +L G      ED +     ++ +   L   VR  + S  + D K+ +            T     +D  ST       D +R++    +E  R+G + R+FP+  S
Sbjct:  563 QRKLLKWKMSSVTPNIVKHTITRSH--FKVTKKSHDWLGCW-GHHMKSLGFRAIREYQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFVLPQDMKLLKKAWEDGGSRQKWIIKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRVYIFNDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKKNSEYQTNSD-DKACQGHKWALKALWQYLGYRGVNTTLIWDKIKDMVVKTIIAADPYVNSLVKMHLRSSYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNSALDVSIKGQMIRDVLNLAGFVLPHSEDVLPPGSSDSSSTSSLCGGVREKSRSDLSADEKVKRAF--------YLTQRFGDQDFYSTVLDVLTPDDVRVLAETEDELSRQGEFERVFPSPTS 991          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008895.1 (pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 gene:ENSPMAG00000008053.1 transcript:ENSPMAT00000008895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 413.305 bits (1061), Expect = 1.185e-133
Identity = 199/380 (52.37%), Postives = 283/380 (74.47%), Query Frame = 3
Query:  258 TNKEKSNSDICTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIG 1397
            T  E+ +S +   +G+     K P L+F  +A++  +   + IGERY+L+YK  +T+ +L++ IL SHGF E    SND+NL+WTG H KPF+LR++++ QKVNHFPRSYELTRKDRL KN+Q+MQQ  G KHF+ +P ++L+P+E+Q+ C   SK++  +I+KP+A SRGRG++L N P Q+ +DE ++ S+Y+ NP LI++ KFD+R+YVLVTSY+PLV YLYEEGLTRFATVKY    K +K Q MHLTNYSVNKK+ +++  DD +VEDFGNKWS+ A+LR LK    DTT LM +IED+IVK+++SVE  I+++ RMF  +R NCF + G  +++ +  R +LL ++LS +L  D+PLD K+K+ M+SDMFSL+G
Sbjct:   20 TEPEREHSLVVQWVGS---AHKTPVLLFHPDAIVGSELAFKTIGERYHLAYKFVRTESRLVRNILGSHGFHEVHPSSNDFNLMWTGTHPKPFSLRSLTDFQKVNHFPRSYELTRKDRLCKNVQRMQQSHGHKHFNIIPATFLLPAEYQDFCSAHSKDRGPWIVKPVASSRGRGVYLVNSPNQVTMDENILVSRYLGNPLLIDDFKFDVRLYVLVTSYEPLVIYLYEEGLTRFATVKYDRNSKFIKNQFMHLTNYSVNKKSRDYVSCDDPEVEDFGNKWSMSAMLRCLKQDGHDTTALMARIEDLIVKTILSVEQTIASSVRMFVPHRGNCFGMMGLGVLLYKRGRTFLLHLDLSLTLCSDAPLDLKVKASMVSDMFSLVG 396          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 96.6709 bits (239), Expect = 9.149e-21
Identity = 71/241 (29.46%), Postives = 118/241 (48.96%), Query Frame = 3
Query:  714 NFSKEKNTYIIKPIALSRGR----GIFLSNHPGQ----------IPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLI 1394
            +    +NT+++KP A+SRGR    G+   N   +          +  D + I  KY+  P LI+  KFDIR + LVT ++PL  + Y++   RF+T  +Q    NL T  +HL N S+ +K+ E      A +    N W     + YL+S       L    E ++V  +          ++     R   FELYG D ++ E+ RPWLLE+N SP++S  +P+  ++ + +  D+  ++
Sbjct:  286 DMEGTRNTWVVKPGAMSRGRVTPPGVLCMNRLCEMLRLVECDTALVKDGRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQL--DNLDTS-IHLCNNSI-QKHFENAQGRSAQLPR-DNIWHGRQFVSYLESLG-----LGFAWEGVVVPGMKQAIIHALQAAQDVVDARRGSFELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVV 516          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 96.6709 bits (239), Expect = 9.635e-21
Identity = 71/241 (29.46%), Postives = 118/241 (48.96%), Query Frame = 3
Query:  714 NFSKEKNTYIIKPIALSRGR----GIFLSNHPGQ----------IPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLI 1394
            +    +NT+++KP A+SRGR    G+   N   +          +  D + I  KY+  P LI+  KFDIR + LVT ++PL  + Y++   RF+T  +Q    NL T  +HL N S+ +K+ E      A +    N W     + YL+S       L    E ++V  +          ++     R   FELYG D ++ E+ RPWLLE+N SP++S  +P+  ++ + +  D+  ++
Sbjct:  313 DMEGTRNTWVVKPGAMSRGRVTPPGVLCMNRLCEMLRLVECDTALVKDGRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQL--DNLDTS-IHLCNNSI-QKHFENAQGRSAQLPR-DNIWHGRQFVSYLESLG-----LGFAWEGVVVPGMKQAIIHALQAAQDVVDARRGSFELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVV 543          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Sea Lamprey
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:HGNC Symbol;Acc:HGNC:26693])

HSP 1 Score: 78.5666 bits (192), Expect = 1.930e-15
Identity = 65/268 (24.25%), Postives = 116/268 (43.28%), Query Frame = 3
Query:  603 DRLFKNIQKMQQLKGLKHFDFVPPSYL--IPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIP-LDEQL-------------------IASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKS---------KNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVN 1313
            +R+   +Q   Q + LK  DF P +    +  E  E   ++ +E   +I KP  L++GRGIFL    G +  L E+L                   I  +Y++NP L++  KFD+R Y+L+ S  P +  L+  G  R +   Y     +L     HLTN  + KK+  +    +  V      W++     ++           K+   T    +++ ++    ++ ++ +          +   F+L G D +IDE+ + WLLE+N
Sbjct:   81 ERIISKLQVTSQPRMLKMDDFFPHTLRLDVRGERDEFFDSY-QEGEKWICKPTGLNQGRGIFLLRSAGDVAALRERLLLDADAGPRTPRAHVPQARIVQRYVTNPLLLDGRKFDVRSYMLIASAAPPIV-LFRHGYARLSCQSYSPESNDLTA---HLTNQYMQKKSPVYQEVKEETV------WTMSRFNDHVNEHCAPHKGLPKDWVLTTFTKRMQQVMTHCFLATKSKLEG--------KLGLFDLIGCDFLIDEDFKVWLLEMN 329          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004193.1 (pep scaffold:Pmarinus_7.0:GL495833:1191:3921:-1 gene:ENSPMAG00000003831.1 transcript:ENSPMAT00000004193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 3.183e-15
Identity = 43/97 (44.33%), Postives = 65/97 (67.01%), Query Frame = 3
Query: 1092 SLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDM 1382
            +L AL  YL  K VD   +  +I+DI VK++I+ E  +S+    F   R +C EL+G+D+++DE L+PWLLEVN+SPSL  +SPLD  +K  ++ D+
Sbjct:    1 ALKALWGYLCDKGVDCRTIWEQIKDIAVKTVIASEPFVSSLLAQFVGNRRSCHELFGFDVMLDEKLKPWLLEVNISPSLHSNSPLDVAVKVQLIKDL 97          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Nematostella
Match: EDO40146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W3])

HSP 1 Score: 492.271 bits (1266), Expect = 2.041e-162
Identity = 249/483 (51.55%), Postives = 337/483 (69.77%), Query Frame = 3
Query:  387 GERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINE---------LKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIR----RPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFXXXXXXXXXXXXXTHTYMNLNRLLHSKLFPN 1796
             E+++LSYK  KT+CKL+++ILNSH F E    S+++NL+WTG H+KP +LR M + QK+NHFPRSYELTRKDRL+KNIQ++Q  KGLKHFDF+P S+++P E+ E    F KE+  +I+KP+A SRGRGIFL +HP Q+PLD+ L+  +YI+NP LI+           KFD+R+YV VT YDPL  YLYEEGL+RFATVKY  + KN++  CMHLTNYSVNKK+  F+   D +VED+GNKWS+ A+LR++K K +DTT LMM+IED++VK++I+ E PI++  +MF  +  NCFE+YG+DI+IDENLRPWLLEVNLSPSL+CDSPLD KIKSH+++DMF+LIG    DP++  P     N   R  +Y+ +  + K  KQ      ++     RPT+   RR           ++ R++R+ +EEY R+GG++RIFP+SES E Y              + +TH     N LLHSKLFP 
Sbjct:    3 AEKFHLSYKFVKTECKLVRSILNSHAFREVHPNSSNFNLMWTGSHLKPHSLRGMQDFQKINHFPRSYELTRKDRLYKNIQRLQHSKGLKHFDFIPNSFVLPEEYNEFYAAFMKERGHWIVKPVASSRGRGIFLISHPSQVPLDDHLLVCRYITNPLLIDGNIYCFNFIGFKFDVRLYVGVTCYDPLRIYLYEEGLSRFATVKYDKSGKNIRNSCMHLTNYSVNKKSENFVSCQDPEVEDYGNKWSMSAMLRFIKHKGIDTTALMMRIEDVVVKTIIAGELPIASACKMFMPHPGNCFEIYGFDILIDENLRPWLLEVNLSPSLACDSPLDLKIKSHLVTDMFNLIGFVAHDPLIRRP-----NGTRRVPDYA-AARNKKYQKQRTQSAGALSTSGLRPTSAAARRKAVDEELTLTPEESRILRQTKEEYARRGGFVRIFPSSESWELYGSFL---------EHRTTH-----NHLLHSKLFPG 465          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Nematostella
Match: EDO38145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDP2])

HSP 1 Score: 247.669 bits (631), Expect = 9.264e-72
Identity = 161/469 (34.33%), Postives = 265/469 (56.50%), Query Frame = 3
Query:  294 VIGTNCFGKKIPYLIFSVEA--VLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSK--EKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKW-SLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVL--NNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSES 1679
             +  + F    P + F+VE   V    S++RK+     L +K+      ++K  +   GF   +  ++D+   W G H+K  T +++ E+QKVNHFP ++++ RKDRL++N+ KM    G K F F+P +Y++P +F+ L + + +   +  +I+KP A +RG GI + +   QIP    +I  KY+  P+LIN  KFD+R+YV VTSYDPL  Y++E+GL RFAT KY ++ K+L  + MHLTNYSVNKKN     ++  D    G+KW  L +L  Y K   ++   +   ++D+IVK++I+ ++ ++   +    +RS C EL+G D+++DENL+PWLLEVN+SPSL  +S LD  IK  M+ D+ +L      + ++     +   LNS V+  + +  ++D +           + R      R+ +    TP     +R++    +EY R+G + R FP+  S
Sbjct:    3 ALTASLFAYVQPTIHFTVEGEKVESLPSDLRKL-----LRWKMSSITPNVVKQCIAWSGFRPTKR-AHDWLGYW-GKHMKSTTFKSIREYQKVNHFPGTFQIGRKDRLWRNLSKMMVHHGKKEFGFLPQTYVLPYDFKLLKRAWDEGGSRQKWILKPPASARGIGIRVIHKWTQIPRKRPVIVQKYLHKPFLINGSKFDLRIYVYVTSYDPLRIYIFEDGLVRFATCKYSSSVKSLSNRFMHLTNYSVNKKNEGAYQSNADDSLCQGHKWYYLKSLWGYFKRMGINHAQVWDSVKDVIVKAIIASDSFVNTLIKQNVRHRSCCHELFGCDVMLDENLKPWLLEVNISPSLHSNSQLDRNIKGQMIRDLMNLAAFRIPENLVTTTTASASSLNSFVQDKSTTSLSSDERAKHAF-----YVGRNVDERTRQSILDILTP---SDVRILMETEDEYSRRGCFQRAFPSMVS 456          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Nematostella
Match: EDO42060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K6])

HSP 1 Score: 202.216 bits (513), Expect = 1.216e-57
Identity = 124/330 (37.58%), Postives = 191/330 (57.88%), Query Frame = 3
Query:  432 KLLKTILNSHGFLECQSYSND----YNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEK----NTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQ-NTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLI 1394
            +LL+ +    G+ E    + D    ++L W     +          Q++NHFP++  +TRKD L +N+++M+ + G   F+F P S+ +P+++++    +SK+K    N +I KP  LSRGRGIFL  +   +  D   +  +YIS+P LI   KFD+R+YVLVTS+ PL  Y+Y EG+ RF+T K+  +T  NL +   HLTN S+NK+   +  + D +    G KW+L  L  Y    N+    L  +I  II+ +L++    +S +        +NCFELYG+DI+IDENL+PWLLEVN SPSL  D  +D  IK  +++D F L+
Sbjct:   14 ELLRDVCLERGWHEFDEEAVDPDATWSLWWKSSGFRTGEYEDCRPWQRLNHFPKTSAITRKDCLARNLRRMRGVYGNYLFNFAPLSFNLPNDYRKFVAEYSKKKDATKNIWICKPADLSRGRGIFLFENLLDLTYDSAAVVQRYISSPLLICGYKFDLRLYVLVTSFHPLCIYVYHEGMVRFSTEKFDLSTLSNLFS---HLTNSSINKQGPSY--SLDKERIGTGCKWTLSQLRAYFHQHNIGDGMLWHRINTIIILTLLTQAPEVSKSC-------TNCFELYGFDILIDENLKPWLLEVNFSPSLGSDCLVDLTIKKPLLNDTFELL 331          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Nematostella
Match: EDO34389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH2])

HSP 1 Score: 201.445 bits (511), Expect = 4.171e-56
Identity = 125/341 (36.66%), Postives = 196/341 (57.48%), Query Frame = 3
Query:  423 TDCKL--LKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSE---FQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKY---QNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMF---QTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCED 1412
            T+CK   ++ +    G  E     +D++L W    V       M  +QK+NHFP   E+ RKD L +N+ ++ + +  K +   P ++++P++   FQ  C+   K+  T+I KP + S+G+GI ++ +P  I   E L+  +Y+S P+LI+  KFD+R+YVLVTS DPL  ++YE+GL RFAT KY   QN   NL   CMHLTNYS+NK + +FI +     E+ G+K  +  +  +      D   +   IED I+K+L++    +    R         S CFE+ G+D+++D+ L+PW++EVN SPS + DSPLD +IK  +MSD  +L+  G  D
Sbjct:    7 TNCKYDSVRRVTKRFGMKEVGE-EDDWSLFWIDCSVALERCMEMKRYQKINHFPGMSEICRKDLLARNMNRLWK-QFPKDYAVFPKTWVLPADYGDFQSYCR--QKKNKTFITKPESGSQGKGIVITKNPKDIKPGEHLVCQQYVSKPFLIDGFKFDLRIYVLVTSCDPLRVFVYEDGLARFATSKYTEPQNN--NLDDICMHLTNYSINKHSKDFIRD-----EEIGSKRRITTINNWFVENGYDLKEIWDGIEDCIIKTLVTAHPILKHNYRTCFPNHNKGSACFEILGFDVLLDKKLKPWVIEVNHSPSFTTDSPLDKEIKEGLMSDALALLNFGACD 336          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Nematostella
Match: EDO45410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT71])

HSP 1 Score: 196.052 bits (497), Expect = 1.096e-53
Identity = 139/407 (34.15%), Postives = 216/407 (53.07%), Query Frame = 3
Query:  501 LLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSE---FQELCQNFSKEK--NTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQ-NTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSN-----CFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCED-----PVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYK--RKGGWIRIFP 1667
             +W+   V       +  +Q++NHFP   E+ RKD L +NI KM++      + F P ++++P+E   FQ  C+   K+K   T+I+KP   + G GI L  +  +IP  EQL+  +YI  P+L++  KFD+R+YVLVTS DPL  ++Y +GL R  T  Y+  T  N+    MHLTNYS+NK N  F  +++   +D G+K S+  L  +L+S + D   L   I ++IVK+LI  +  +  + RM +   +      CFEL G+DI++D  L+PWLLE+N SPS   DS LD ++K   + D   L+ I   D           +Q  L ++ + S Y+ S ++    K I N+           RR +L       R +QLR     REE++    G + R++P
Sbjct:   39 FIWSDSSVGAERFIELKPYQRINHFPGMGEICRKDSLARNIAKMKRAHP-DEYSFAPQTWVLPAEYAAFQMYCRELKKKKRAKTFIMKPANGAMGNGISLIRNGDRIPSHEQLVIQEYIDRPFLLDGYKFDLRVYVLVTSCDPLRIFVYNDGLVRLGTECYEPPTEDNMDELFMHLTNYSINKHNENFERDEN---DDMGSKRSIKWLNEWLQSMDYDVNFLWRGITEVIVKTLIVAQPHVLHSYRMCRPGAATGSDSVCFELLGFDILLDRKLKPWLLEINRSPSFGTDSKLDQEVKGGALRDTLRLLNIKPSDRRRGMAAEKAESQRRLLTQPKRSEYTMSVSELDKKKMILNK-----------RRNELKE-----RLNQLRR-ESAREEFENINMGNFRRVYP 424          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Medaka
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:NCBI gene;Acc:101171290])

HSP 1 Score: 246.514 bits (628), Expect = 3.784e-67
Identity = 134/329 (40.73%), Postives = 201/329 (61.09%), Query Frame = 3
Query:  417 YKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNF--SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIG 1397
            Y  D    K     H +L C          W G H++    + + EHQK+NHFP ++++ RKDRL++N+ KM+   G + F F P ++++P + + L + +     K  +IIKP A +RG GI + +   Q+P    L+  KY+  PYLI+  KFD+R+YV V  YDPL  Y++ +GL RFA+ KY ++ K L  + MHLTNYSVNK+N E+  N D D    G+KW+L AL + L S+ V+TT +  KI+DI++K++I+ E  +    +M      +C EL+G+DI++DENL+PW+LEVN+SPSL   S LD  IK  M+ D+ +L G
Sbjct:  409 YTVDRSHFKVTKKGHDWLGC----------W-GHHMRSLGFKELGEHQKLNHFPGTFQIGRKDRLWRNLSKMRLRYGKQEFSFFPRTFILPQDIKRLRKAWEDGGSKQKWIIKPPASARGVGIQVIHKWSQMPHKRPLLVQKYLHKPYLISGNKFDLRIYVYVPCYDPLRIYIFSDGLVRFASCKYSSSMKTLGNKFMHLTNYSVNKQNAEYQTNSD-DKACQGHKWALKALWQLLGSRGVNTTLIWEKIKDIVIKTVIASEPYVHNLMKMHVKSPYSCHELFGFDIMLDENLKPWILEVNISPSLHSSSALDVSIKGQMIRDLLNLAG 725          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Medaka
Match: ttll6 (tubulin tyrosine ligase like 6 [Source:NCBI gene;Acc:101164261])

HSP 1 Score: 209.149 bits (531), Expect = 1.068e-55
Identity = 126/315 (40.00%), Postives = 188/315 (59.68%), Query Frame = 3
Query:  489 NDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKN--TYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKY-QNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISA----TSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCED 1412
             D+ LLWT   V    ++ M  +QK+NHFP   E+ RKD L +N+ +M +L   K ++  P ++ +P+++ +  Q +++ K   TYI KP    +G+GIF++     I  +E +I   YIS P +I+  KFD+R+YVLVTS DP   +++ EGL RF T KY + T  N++  CMHLTNYS+NK +  F+ +     ED G+K  L  L R+L+S N +T  +   IEDII+K+LIS   PI      T     T  S CFE+ G+D+++D  L+PW+LEVN SPS + DS LD ++K  ++ D   LI +   D
Sbjct:   80 EDWTLLWTDCSVSLDRVKDMKCYQKINHFPGMNEICRKDSLARNLNRMLKLFP-KDYNIFPKTWCLPADYSDF-QVYTRAKKSKTYICKPDTGCQGKGIFITKSSKDIQHEEHMICQVYISKPLIIDGYKFDLRIYVLVTSCDPFSIFMFREGLARFCTSKYNEPTRTNVEHVCMHLTNYSINKNSENFVRD-----EDTGSKRKLSTLNRHLESLNCNTEKMWEDIEDIIIKTLISAH-PILKHNYHTCFPNHTAGSACFEILGFDVLLDHRLKPWVLEVNHSPSFTTDSQLDREVKDALLYDTLVLINLAACD 386          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 201.06 bits (510), Expect = 1.057e-52
Identity = 136/443 (30.70%), Postives = 235/443 (53.05%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKE------KNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQN-TPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYR-----SNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRR--VREEYKRK--GGWIRIFPTSESL 1682
            +S  +  T  ++++ ++N   F++ +      NL+W    V+   +  +  +Q++NHFP   E+ RKD L +N+ KM + +  + + F+P +++ P+E+ +L QN+ KE      + T+I+KP   + G GI+L  +  ++P  E  I  +Y+  P+L+   KFD+R+Y+LVTS DPL  +LY +GL R  T KY   +  NL    MHLTNYSVNK N  F  ++  D    G+K S+    ++L+  + D       I +++VK+LI  E  +    RM +  +     S CFE+ G+DII+D  L+PWLLE+N +PS + D  +D+ +K   + +   L+ I   D   N   Q    ++ +   Y   +   K+P   ++     +R T   RR +L         +QL  +R+   RE+++++  G + RI+P  + L
Sbjct:   41 ISANVAGTKYEIVRIVINEMDFIKARDDDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMSKMIKCQP-QEYSFIPKTWIFPAEYTQL-QNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENFERDETVDK---GSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKGALLNALKLLNIRASDKKRNLAQQ---KAEAQRRLYGHGSM-KKLPAASSDWEK--QRHTLERRREEL--------KEQLAQVRKQFSREQHEKQHLGNYRRIYPPDDKL 464          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 201.06 bits (510), Expect = 1.789e-52
Identity = 136/443 (30.70%), Postives = 235/443 (53.05%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKE------KNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQN-TPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYR-----SNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRR--VREEYKRK--GGWIRIFPTSESL 1682
            +S  +  T  ++++ ++N   F++ +      NL+W    V+   +  +  +Q++NHFP   E+ RKD L +N+ KM + +  + + F+P +++ P+E+ +L QN+ KE      + T+I+KP   + G GI+L  +  ++P  E  I  +Y+  P+L+   KFD+R+Y+LVTS DPL  +LY +GL R  T KY   +  NL    MHLTNYSVNK N  F  ++  D    G+K S+    ++L+  + D       I +++VK+LI  E  +    RM +  +     S CFE+ G+DII+D  L+PWLLE+N +PS + D  +D+ +K   + +   L+ I   D   N   Q    ++ +   Y   +   K+P   ++     +R T   RR +L         +QL  +R+   RE+++++  G + RI+P  + L
Sbjct:   41 ISANVAGTKYEIVRIVINEMDFIKARDDDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMSKMIKCQP-QEYSFIPKTWIFPAEYTQL-QNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENFERDETVDK---GSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKGALLNALKLLNIRASDKKRNLAQQ---KAEAQRRLYGHGSM-KKLPAASSDWEK--QRHTLERRREEL--------KEQLAQVRKQFSREQHEKQHLGNYRRIYPPDDKL 464          
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 200.675 bits (509), Expect = 3.142e-52
Identity = 136/443 (30.70%), Postives = 235/443 (53.05%), Query Frame = 3
Query:  402 LSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKE------KNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQN-TPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYR-----SNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRR--VREEYKRK--GGWIRIFPTSESL 1682
            +S  +  T  ++++ ++N   F++ +      NL+W    V+   +  +  +Q++NHFP   E+ RKD L +N+ KM + +  + + F+P +++ P+E+ +L QN+ KE      + T+I+KP   + G GI+L  +  ++P  E  I  +Y+  P+L+   KFD+R+Y+LVTS DPL  +LY +GL R  T KY   +  NL    MHLTNYSVNK N  F  ++  D    G+K S+    ++L+  + D       I +++VK+LI  E  +    RM +  +     S CFE+ G+DII+D  L+PWLLE+N +PS + D  +D+ +K   + +   L+ I   D   N   Q    ++ +   Y   +   K+P   ++     +R T   RR +L         +QL  +R+   RE+++++  G + RI+P  + L
Sbjct:   41 ISANVAGTKYEIVRIVINEMDFIKARDDDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMSKMIKCQP-QEYSFIPKTWIFPAEYTQL-QNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENFERDETVDK---GSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKGALLNALKLLNIRASDKKRNLAQQ---KAEAQRRLYGHGSM-KKLPAASSDWEK--QRHTLERRREEL--------KEQLAQVRKQFSREQHEKQHLGNYRRIYPPDDKL 464          
BLAST of Tubulin polyglutamylase TTLL5 vs. Planmine SMEST
Match: SMESG000040121.1 (SMESG000040121.1)

HSP 1 Score: 2173.28 bits (5630), Expect = 0.000e+0
Identity = 1173/1173 (100.00%), Postives = 1173/1173 (100.00%), Query Frame = 3
Query:   24 MPSNNGNSVKSKRILNFNSSDYPIPNGHGXXXXXXXXYLGPQFXXXXXXXXXXXXXXXXXXHVNPKDIRTFNKKSIVGTNKEKSNSDICTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFXXXXXXXXXXXXXTHTYMNLNRLLHSKLFPNHIIDIDNFARSISQNQAIIKSRISLHSVNYNSSYHKDPFNQTLPTNQGTYKRISQNYSDTQTRIPYYERKLGEEPQLRNQPEKSSFQDPIETAKNSNPIENNFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDEEHTSTASHNIPSSMSQSSKEILSVDRIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLNPNLNTKNPEPTTDDSIRHHHLXXXXXXXXTAGLHKSVSMSNLTLKEKTSYESFQKPQKPIYKPLANKTQSSLQINQKQTIPVENYSNGTRRQSFSRPSSVNQTIPWRPGSTKLSXXXXXXXXXXPRPLTSNAITNRNNKIISKQEKSYDPDAISKALQRLTTDQRNRQLTASVFSFYDSDFEPLNQNPKSSNLDPLAQTLIRQYQQSKRLLQESRAKHNALLSQNSNSDLMSAGMIPKTVNLTNKPPPGIRTSQSAKFSCPP 3542
            MPSNNGNSVKSKRILNFNSSDYPIPNGHGDDNFDDDNYLGPQFDSEILDLDEDITDDEAELHVNPKDIRTFNKKSIVGTNKEKSNSDICTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNLSPSLSCDSPLDFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFQSQNSEQNNCNNSTHTYMNLNRLLHSKLFPNHIIDIDNFARSISQNQAIIKSRISLHSVNYNSSYHKDPFNQTLPTNQGTYKRISQNYSDTQTRIPYYERKLGEEPQLRNQPEKSSFQDPIETAKNSNPIENNFHDSDNEMLSSSSSISLSDKDNNSVDNSDSEIDDYDEEHTSTASHNIPSSMSQSSKEILSVDRIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLNPNLNTKNPEPTTDDSIRHHHLPAPPPPPPTAGLHKSVSMSNLTLKEKTSYESFQKPQKPIYKPLANKTQSSLQINQKQTIPVENYSNGTRRQSFSRPSSVNQTIPWRPGSTKLSTNNTNNNANNPRPLTSNAITNRNNKIISKQEKSYDPDAISKALQRLTTDQRNRQLTASVFSFYDSDFEPLNQNPKSSNLDPLAQTLIRQYQQSKRLLQESRAKHNALLSQNSNSDLMSAGMIPKTVNLTNKPPPGIRTSQSAKFSCPP
Sbjct:    1 MPSNNGNSVKSKRILNFNSSDYPIPNGHGDDNFDDDNYLGPQFDSEILDLDEDITDDEAELHVNPKDIRTFNKKSIVGTNKEKSNSDICTVIGTNCFGKKIPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNLSPSLSCDSPLDFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTSESLETYFPLFQSQNSEQNNCNNSTHTYMNLNRLLHSKLFPNHIIDIDNFARSISQNQAIIKSRISLHSVNYNSSYHKDPFNQTLPTNQGTYKRISQNYSDTQTRIPYYERKLGEEPQLRNQPEKSSFQDPIETAKNSNPIENNFHDSDNEMLSSSSSISLSDKDNNSVDNSDSEIDDYDEEHTSTASHNIPSSMSQSSKEILSVDRIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKESNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLGNFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYTRVNKSAGIFLNPNLNTKNPEPTTDDSIRHHHLPAPPPPPPTAGLHKSVSMSNLTLKEKTSYESFQKPQKPIYKPLANKTQSSLQINQKQTIPVENYSNGTRRQSFSRPSSVNQTIPWRPGSTKLSTNNTNNNANNPRPLTSNAITNRNNKIISKQEKSYDPDAISKALQRLTTDQRNRQLTASVFSFYDSDFEPLNQNPKSSNLDPLAQTLIRQYQQSKRLLQESRAKHNALLSQNSNSDLMSAGMIPKTVNLTNKPPPGIRTSQSAKFSCPP 1173          
BLAST of Tubulin polyglutamylase TTLL5 vs. Planmine SMEST
Match: SMESG000056158.1 (SMESG000056158.1)

HSP 1 Score: 275.018 bits (702), Expect = 4.578e-76
Identity = 160/419 (38.19%), Postives = 256/419 (61.10%), Query Frame = 3
Query:  477 QSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQ--ELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSD----------------QLRMIRRVREEYKRKGGWIRIFPTSES 1679
            ++ +ND+ +L+ G H+K    +++ ++QKVNHFP S++L RKDRL++NI +MQQ  G   FDF+P ++ +P++ +  + C      K+ +IIKP A +RG G+ +     QIP    ++  KYISNPYLIN+ KFD+R+YV +T  +PL  YLY++GL RFA+ KY N+ K L  + +HLTNYS+NK+N E++ N+D +    G+KWSL +L  Y+K + V+T  +  +I+D++VK++IS E  ISA+  ++     +  EL+G+D+I+DENL+PW+LEVN+SPSL  DSPLD  IK  M+ DMF++ G    +P    P    L       N++  ++D  I ++      S    +       ++T+ T FR D                 +R + +  +EY+R+G + R++P+S S
Sbjct:  669 ETETNDW-ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEP--ATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPSSLS 1083          
BLAST of Tubulin polyglutamylase TTLL5 vs. Planmine SMEST
Match: SMESG000056158.1 (SMESG000056158.1)

HSP 1 Score: 274.633 bits (701), Expect = 4.830e-76
Identity = 160/419 (38.19%), Postives = 256/419 (61.10%), Query Frame = 3
Query:  477 QSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQ--ELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSD----------------QLRMIRRVREEYKRKGGWIRIFPTSES 1679
            ++ +ND+ +L+ G H+K    +++ ++QKVNHFP S++L RKDRL++NI +MQQ  G   FDF+P ++ +P++ +  + C      K+ +IIKP A +RG G+ +     QIP    ++  KYISNPYLIN+ KFD+R+YV +T  +PL  YLY++GL RFA+ KY N+ K L  + +HLTNYS+NK+N E++ N+D +    G+KWSL +L  Y+K + V+T  +  +I+D++VK++IS E  ISA+  ++     +  EL+G+D+I+DENL+PW+LEVN+SPSL  DSPLD  IK  M+ DMF++ G    +P    P    L       N++  ++D  I ++      S    +       ++T+ T FR D                 +R + +  +EY+R+G + R++P+S S
Sbjct:  644 ETETNDW-ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEP--ATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPSSLS 1058          
BLAST of Tubulin polyglutamylase TTLL5 vs. Planmine SMEST
Match: SMESG000056158.1 (SMESG000056158.1)

HSP 1 Score: 275.018 bits (702), Expect = 4.886e-76
Identity = 160/419 (38.19%), Postives = 256/419 (61.10%), Query Frame = 3
Query:  477 QSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQ--ELCQNFSKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQNSSIRRPTAGLRRRDLSTSSTPFRSD----------------QLRMIRRVREEYKRKGGWIRIFPTSES 1679
            ++ +ND+ +L+ G H+K    +++ ++QKVNHFP S++L RKDRL++NI +MQQ  G   FDF+P ++ +P++ +  + C      K+ +IIKP A +RG G+ +     QIP    ++  KYISNPYLIN+ KFD+R+YV +T  +PL  YLY++GL RFA+ KY N+ K L  + +HLTNYS+NK+N E++ N+D +    G+KWSL +L  Y+K + V+T  +  +I+D++VK++IS E  ISA+  ++     +  EL+G+D+I+DENL+PW+LEVN+SPSL  DSPLD  IK  M+ DMF++ G    +P    P    L       N++  ++D  I ++      S    +       ++T+ T FR D                 +R + +  +EY+R+G + R++P+S S
Sbjct:  670 ETETNDW-ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEP--ATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPSSLS 1084          
BLAST of Tubulin polyglutamylase TTLL5 vs. Planmine SMEST
Match: SMESG000073336.1 (SMESG000073336.1)

HSP 1 Score: 248.44 bits (633), Expect = 1.637e-68
Identity = 136/353 (38.53%), Postives = 227/353 (64.31%), Query Frame = 3
Query:  387 GERYNLSYKIYKTDCKLLKTILNSHGFLECQSYSNDYNLLWTG---GHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKH-FDFVPPSYLIPSEFQELCQNF----SKEKNTYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSK-NVDTTCLMMKIEDIIVKSLISVEAPISATSRMFQTYRSNCFELYGYDIIIDENLRPWLLEVNXXXXXXXXXXXXFKIKSHMMSDMFSLIGIGCEDPV 1418
            G R  L ++       ++K  +   GF      +N   + W G    H+K    RT++EHQK+NH P S+++ RKDRL++N+  +   K   H F+F+P +Y +P++ + L + +    S++K  +I+KP A +RG G+ + +   Q+P     +   YIS P+LIN+ KFD+R+YV +TS DPL  Y+Y EGL RFA+ KY  + KN+  + +HLTNYSVNKKN+++++N+D + +  G+KW+L  L R+ +    +D   +   I+D I+K++ISVE+ I++  +MF T ++  +EL+G+D+++D NL+PW+LEVN+SPSL  +SPLD ++KS +++D+F+L+G     P+
Sbjct:  345 GYRPMLKWRYSAITPNVVKRAVKRSGF----KLTNKSGVKWIGYFGSHLKSSGFRTINEHQKINHMPGSFQIGRKDRLWRNVTALSSKKSKIHEFNFLPKTYCLPADLKLLKRIWDDEESRKKAKWILKPPAAARGIGVRVISKWSQVPKKRAALIQNYISRPFLINDSKFDLRIYVAITSCDPLRIYVYREGLVRFASHKYSKSSKNISNRFIHLTNYSVNKKNSDYLNNEDHN-KCQGHKWTLQTLWRHFEQDLRIDWIPIWKNIKDCIIKTIISVESHINSNIKMFCTNKNCVYELFGFDVLLDHNLKPWVLEVNVSPSLHSNSPLDIEVKSSLIADLFNLVGFQLYQPI 692          
The following BLAST results are available for this feature:
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL51.041e-15951.14tubulin tyrosine ligase like 5 [Source:HGNC Symbol... [more]
TTLL54.125e-15952.20tubulin tyrosine ligase like 5 [Source:HGNC Symbol... [more]
TTLL52.807e-8957.39tubulin tyrosine ligase like 5 [Source:HGNC Symbol... [more]
TTLL45.394e-7141.83tubulin tyrosine ligase like 4 [Source:HGNC Symbol... [more]
TTLL42.850e-7041.83tubulin tyrosine ligase like 4 [Source:HGNC Symbol... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll-54.428e-9335.87Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-51.866e-9235.87Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-46.175e-5839.06Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
ttll-46.175e-5839.06Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
ttll-46.207e-5839.06Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL54.914e-11945.37gene:FBgn0051108 transcript:FBtr0084802[more]
TTLL54.914e-11945.37gene:FBgn0051108 transcript:FBtr0339247[more]
TTLL4A6.531e-6439.41gene:FBgn0026147 transcript:FBtr0300402[more]
TTLL4A6.531e-6439.41gene:FBgn0026147 transcript:FBtr0300401[more]
TTLL4A7.333e-6439.41gene:FBgn0026147 transcript:FBtr0304950[more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll53.672e-16452.58tubulin tyrosine ligase-like family, member 5 [Sou... [more]
ttll41.019e-7137.27tubulin tyrosine ligase-like family, member 4 [Sou... [more]
ttll42.831e-6937.27tubulin tyrosine ligase-like family, member 4 [Sou... [more]
ttll42.061e-6842.09tubulin tyrosine ligase-like family, member 4 [Sou... [more]
ttll42.061e-6842.09tubulin tyrosine ligase-like family, member 4 [Sou... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mboat72.551e-16048.02membrane bound O-acyltransferase domain containing... [more]
mboat78.451e-14856.83membrane bound O-acyltransferase domain containing... [more]
mboat77.408e-14448.91membrane bound O-acyltransferase domain containing... [more]
mboat71.874e-14348.91membrane bound O-acyltransferase domain containing... [more]
mboat72.913e-14348.91membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttll54.102e-16652.64tubulin tyrosine ligase-like family, member 5 [Sou... [more]
Ttll55.314e-16152.11tubulin tyrosine ligase-like family, member 5 [Sou... [more]
Ttll59.930e-16152.11tubulin tyrosine ligase-like family, member 5 [Sou... [more]
Ttll51.274e-16052.11tubulin tyrosine ligase-like family, member 5 [Sou... [more]
Ttll51.745e-15457.70tubulin tyrosine ligase-like family, member 5 [Sou... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CHB8|TTLL5_MOUSE8.911e-16052.11Tubulin polyglutamylase TTLL5 OS=Mus musculus OX=1... [more]
sp|Q6EEF3|TTLL5_CHLAE1.704e-15851.35Tubulin polyglutamylase TTLL5 OS=Chlorocebus aethi... [more]
sp|Q6EMB2|TTLL5_HUMAN1.981e-15852.20Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9... [more]
sp|Q5R978|TTLL5_PONAB2.422e-15852.20Tubulin polyglutamylase TTLL5 OS=Pongo abelii OX=9... [more]
sp|E9P886|TTLL5_CAEEL2.373e-9135.87Tubulin polyglutamylase ttll-5 OS=Caenorhabditis e... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GSD80.000e+042.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F4A00.000e+042.91Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H1X66.470e-2050.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EQ946.959e-2050.34Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DE650.000e+050.34Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll52.517e-15952.13tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
ttll56.176e-15950.94tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
ttll58.062e-15950.94tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
ttll42.546e-7137.19tubulin tyrosine ligase like 4 [Source:NCBI gene;A... [more]
ttll42.768e-7137.19tubulin tyrosine ligase like 4 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008895.11.185e-13352.37pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 g... [more]
ttll39.149e-2129.46tubulin tyrosine ligase-like family, member 3 [Sou... [more]
ttll39.635e-2129.46tubulin tyrosine ligase-like family, member 3 [Sou... [more]
TTLL101.930e-1524.25tubulin tyrosine ligase like 10 [Source:HGNC Symbo... [more]
ENSPMAT00000004193.13.183e-1544.33pep scaffold:Pmarinus_7.0:GL495833:1191:3921:-1 ge... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401462.041e-16251.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381459.264e-7234.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420601.216e-5737.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343894.171e-5636.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454101.096e-5334.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll43.784e-6740.73tubulin tyrosine ligase like 4 [Source:NCBI gene;A... [more]
ttll61.068e-5540.00tubulin tyrosine ligase like 6 [Source:NCBI gene;A... [more]
ttll71.057e-5230.70tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll71.789e-5230.70tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll73.142e-5230.70tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040121.10.000e+0100.00SMESG000040121.1[more]
SMESG000056158.14.578e-7638.19SMESG000056158.1[more]
SMESG000056158.14.830e-7638.19SMESG000056158.1[more]
SMESG000056158.14.886e-7638.19SMESG000056158.1[more]
SMESG000073336.11.637e-6838.53SMESG000073336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023991 ID=SMED30023991|Name=Tubulin polyglutamylase TTLL5|organism=Schmidtea mediterranea sexual|type=transcript|length=3790bp
CTATATAAATCTTATATGTGATAATGCCATCTAATAATGGAAATTCTGTC
AAAAGCAAAAGGATTTTGAATTTTAATAGCAGTGATTATCCAATTCCTAA
TGGTCATGGAGATGATAACTTTGATGATGATAATTATTTAGGCCCGCAGT
TTGATTCAGAAATTCTTGATTTGGACGAAGATATCACAGATGATGAAGCA
GAATTGCACGTCAACCCAAAGGATATTAGAACTTTTAATAAAAAAAGTAT
TGTTGGTACGAATAAAGAAAAATCAAATTCTGATATTTGCACTGTAATCG
GAACAAATTGTTTTGGTAAAAAAATCCCATATCTGATTTTTTCTGTTGAA
GCGGTTTTAAGAAAAGATAGTAATATTCGAAAAATTGGCGAGAGATATAA
TTTGTCTTACAAAATTTACAAAACTGATTGTAAATTATTGAAAACAATTC
TCAACAGCCATGGATTTCTAGAATGCCAATCATATAGTAATGATTACAAT
TTGCTCTGGACAGGAGGTCATGTCAAACCGTTTACTCTTAGAACGATGAG
TGAGCACCAAAAAGTTAATCATTTCCCACGCTCATACGAACTAACACGAA
AAGATCGGCTTTTTAAAAATATTCAAAAAATGCAACAATTAAAAGGTTTA
AAACATTTTGATTTCGTTCCTCCGAGTTATTTAATTCCGAGCGAATTTCA
AGAACTATGTCAAAATTTTTCCAAAGAAAAAAATACTTACATTATTAAAC
CGATCGCACTTTCAAGAGGCCGTGGAATTTTTCTTAGCAACCATCCAGGA
CAAATTCCACTAGACGAGCAGTTGATAGCGTCCAAATACATAAGTAATCC
ATATTTGATAAATGAATTGAAATTTGACATAAGAATGTACGTTCTGGTCA
CTTCCTATGATCCTCTGGTGGCTTATTTGTATGAAGAAGGCCTAACCAGA
TTTGCTACTGTTAAATATCAAAATACTCCCAAAAATCTAAAGACTCAATG
CATGCATTTAACGAATTACAGTGTCAACAAAAAGAACAACGAATTTATTC
ACAATGACGATGCAGATGTAGAAGATTTCGGTAACAAGTGGTCTCTTGGA
GCTTTATTAAGATACCTGAAATCAAAAAATGTTGATACGACTTGTTTGAT
GATGAAAATTGAAGATATCATTGTCAAATCTTTGATATCAGTTGAAGCAC
CGATCTCTGCCACCTCTCGTATGTTCCAGACTTATCGTAGCAATTGTTTC
GAATTATATGGTTACGATATCATAATCGACGAGAATCTCAGGCCATGGCT
GTTAGAGGTTAATTTATCACCATCTCTGTCATGCGATTCGCCTTTGGATT
TTAAAATAAAATCTCATATGATGTCGGATATGTTTAGTTTGATAGGCATC
GGCTGCGAAGATCCCGTGTTAAATAATCCTAATCAACCATATTTGAACTC
TAAAGTGAGATCGTCAAATTACTCACAGTCTACCACTGATAATAAAATCC
CGAAACAAATAAATAATCAAAACTCATCAATTCGTAGACCAACCGCTGGT
CTACGACGACGGGACTTATCAACAAGTAGTACTCCATTTAGAAGTGATCA
ATTAAGAATGATCAGAAGAGTAAGAGAAGAATATAAGCGTAAAGGGGGTT
GGATAAGAATATTTCCAACTAGTGAATCATTAGAAACCTATTTCCCATTA
TTTCAATCGCAAAACTCAGAACAAAACAACTGTAACAATTCCACTCATAC
TTATATGAACTTAAATCGGCTTTTGCATTCGAAACTATTTCCTAATCACA
TAATTGACATTGACAATTTTGCTCGTTCCATCTCCCAAAACCAAGCCATC
ATTAAATCACGAATTTCTCTCCACAGTGTCAATTACAACTCCTCCTATCA
CAAGGATCCATTCAATCAGACGTTACCCACCAACCAAGGAACCTACAAAC
GAATATCACAGAATTACAGTGACACCCAAACGAGAATTCCATATTATGAA
AGAAAACTTGGCGAAGAACCCCAATTGAGAAATCAGCCTGAAAAATCCTC
ATTCCAAGATCCAATAGAAACAGCCAAAAACAGTAACCCAATTGAAAACA
ACTTCCATGATTCAGATAACGAAATGCTCTCGTCCAGTTCTTCGATATCG
TTATCAGACAAGGACAACAACAGTGTGGATAATTCCGATTCTGAGATCGA
TGATTATGACGAGGAGCACACCTCCACAGCCAGTCACAACATCCCCAGTT
CTATGTCGCAATCATCGAAAGAAATCCTATCTGTTGACAGAATTGTCCAA
TCTGGCGGGAAACTCACAAAAATCCAAGCTCGCATGGCCTTCAGCAACTA
TCTGAGCCGAGTTCAACGTCGACTGTTATTGGAATGTCGTTCAGAAGAAT
CACACTCATTATCGGACAAGGAGAGCAATTCCCACGAACAAATTGAGCTC
GTAATAAGATTCCTCAAAAGAGCTGCTACCAACATGTCAGCAAATGAATT
TGAAATCCCCACAATTCCTTCACGATCTCAGCCATTGTATCAACGCCAGG
AATGGTTGGCAAAGCTGTTGGGTAACTTCATCCGAATCTATTCCCGGGAA
ACCTCTCTCGCAGCAACTGCAAAAGAAATCGAAAATCCCGCAATAATCGA
CAAAAAGTCATTTCTTTGCTTTCTAAGAGTTGCCTCGGAAAACGACTTAG
AAATAACTCTCTCGAATTATACACGAGTCAACAAGTCGGCAGGAATCTTT
CTCAATCCCAATCTCAACACCAAAAATCCCGAACCGACAACTGATGATTC
CATAAGACATCACCATCTTCCTGCTCCCCCTCCTCCTCCTCCGACTGCCG
GGTTGCATAAGTCGGTATCGATGAGTAATTTAACACTGAAAGAGAAAACC
TCCTATGAAAGCTTTCAAAAACCTCAAAAACCAATTTACAAACCGTTAGC
CAATAAAACCCAGTCTAGTCTACAAATCAATCAGAAACAAACCATCCCAG
TGGAGAACTATAGCAATGGTACTCGTCGTCAGTCATTTAGTCGCCCGAGT
TCCGTAAATCAAACAATTCCATGGCGTCCGGGTTCAACGAAGCTATCGAC
CAACAACACCAACAACAATGCCAATAATCCAAGACCTTTAACCAGCAATG
CAATAACCAACAGAAACAACAAAATCATCAGCAAACAGGAGAAATCCTAC
GATCCCGATGCCATATCAAAAGCCCTACAACGATTGACAACCGATCAACG
AAACCGCCAACTGACGGCTTCGGTTTTCTCCTTTTACGACTCGGATTTCG
AACCACTGAACCAAAATCCAAAATCCAGCAATTTGGATCCGCTTGCCCAA
ACGCTGATTCGACAGTATCAACAGTCTAAAAGATTACTGCAAGAAAGTCG
TGCCAAACACAACGCGCTCCTGTCGCAGAATAGTAATTCCGATTTGATGT
CGGCCGGAATGATACCGAAAACGGTAAACCTCACAAATAAACCACCGCCC
GGAATTCGAACAAGCCAATCAGCGAAATTCTCGTGCCCTCCGAAAAAATA
GATGTTGAGAATTATTATTATTTTTTTAATTTTGACTTTTCAATAAAAAT
TACAAAAATCATAATTAGGCATTTTATTATTTCGAACATTTTCCCCTCAT
TCATTAATTGGAATTACATTTTGTATGGTTCCACAGATCGTTTAATCAAC
TGAAAATATTACATTTTTCCAATAAACGAATGCAACAACTAAGAATAACA
AATGAAATGGGATAGAGAAAAACATAATATTGTTTATATT
back to top

protein sequence of SMED30023991-orf-1

>SMED30023991-orf-1 ID=SMED30023991-orf-1|Name=SMED30023991-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1176bp
MPSNNGNSVKSKRILNFNSSDYPIPNGHGDDNFDDDNYLGPQFDSEILDL
DEDITDDEAELHVNPKDIRTFNKKSIVGTNKEKSNSDICTVIGTNCFGKK
IPYLIFSVEAVLRKDSNIRKIGERYNLSYKIYKTDCKLLKTILNSHGFLE
CQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNI
QKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKNTYIIKPIALSRGR
GIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVA
YLYEEGLTRFATVKYQNTPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVE
DFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRM
FQTYRSNCFELYGYDIIIDENLRPWLLEVNLSPSLSCDSPLDFKIKSHMM
SDMFSLIGIGCEDPVLNNPNQPYLNSKVRSSNYSQSTTDNKIPKQINNQN
SSIRRPTAGLRRRDLSTSSTPFRSDQLRMIRRVREEYKRKGGWIRIFPTS
ESLETYFPLFQSQNSEQNNCNNSTHTYMNLNRLLHSKLFPNHIIDIDNFA
RSISQNQAIIKSRISLHSVNYNSSYHKDPFNQTLPTNQGTYKRISQNYSD
TQTRIPYYERKLGEEPQLRNQPEKSSFQDPIETAKNSNPIENNFHDSDNE
MLSSSSSISLSDKDNNSVDNSDSEIDDYDEEHTSTASHNIPSSMSQSSKE
ILSVDRIVQSGGKLTKIQARMAFSNYLSRVQRRLLLECRSEESHSLSDKE
SNSHEQIELVIRFLKRAATNMSANEFEIPTIPSRSQPLYQRQEWLAKLLG
NFIRIYSRETSLAATAKEIENPAIIDKKSFLCFLRVASENDLEITLSNYT
RVNKSAGIFLNPNLNTKNPEPTTDDSIRHHHLPAPPPPPPTAGLHKSVSM
SNLTLKEKTSYESFQKPQKPIYKPLANKTQSSLQINQKQTIPVENYSNGT
RRQSFSRPSSVNQTIPWRPGSTKLSTNNTNNNANNPRPLTSNAITNRNNK
IISKQEKSYDPDAISKALQRLTTDQRNRQLTASVFSFYDSDFEPLNQNPK
SSNLDPLAQTLIRQYQQSKRLLQESRAKHNALLSQNSNSDLMSAGMIPKT
VNLTNKPPPGIRTSQSAKFSCPPKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013815ATP_grasp_subdomain_1
IPR004344TTL/TTLL_fam
Vocabulary: biological process
TermDefinition
GO:0006464cellular protein modification process
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1110..1130
NoneNo IPR availableCOILSCoilCoilcoord: 1177..1177
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 192..437
e-value: 5.8E-68
score: 231.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 980..1049
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1157..1177
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 671..718
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 664..750
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 481..520
NoneNo IPR availablePANTHERPTHR12241TUBULIN TYROSINE LIGASE-RELATEDcoord: 101..978
NoneNo IPR availablePANTHERPTHR12241:SF16TUBULIN POLYGLUTAMYLASE TTLL5coord: 101..978
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 205..457
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePFAMPF03133TTLcoord: 177..458
e-value: 1.8E-87
score: 293.2
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePROSITEPS51221TTLcoord: 126..471
score: 56.596
IPR013815ATP-grasp fold, subdomain 1GENE3DG3DSA:3.30.1490.20coord: 219..276
e-value: 5.8E-68
score: 231.1