SMED30023982

Overview
NameSMED30023982
Smed IDSMED30023982
Length (bp)1913
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30023982 (SMED30023982) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30023982 (SMED30023982) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023982

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023982SMESG000020498.1 SmedASXL_007389SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30023982SMESG000020498.1 dd_Smed_v4_16795_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023982SMESG000020498.1 dd_Smed_v6_16795_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30023982SMESG000020498.1 dd_Smed_v6_44096_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30023982 vs. TrEMBL
Match: A0A158QE86 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7029 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.761e-43
Identity = 90/243 (37.04%), Postives = 135/243 (55.56%), Query Frame = -2
Query: 1202 RFIIISIVFVNLISCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNST-NEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAK-------KSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSI 1906
            R+ ++ +    ++  D+Y VV  GPC+ +   YC  +V NS+CS   NECFC   YV ++E  G+ CKPLL+ + C  D +C  + N SICHPGAG C CP G ++V+ ++ CRN     T N  C  C+++ GICF  +  +     +   K  CSCP+ T  P  K       +S+  +  C AI V++GE CND DLIC  +N++C  S       C+CK+GY  VY++   +  C + +
Sbjct:   15 RYALVILEPWWMVKADEYHVVASGPCVDEGDAYCIKRVPNSFCSVTKNECFCQPAYVAIQEEYGITCKPLLTSLSCHVDKDCIHVKN-SICHPGAGFCACPGGTVYVAQEHACRNLAEKQTNNSFCEKCTQINGICFYADTPDKGDSENKTPKFGCSCPYKTAMPMPKQVYASNDQSLSPWAFCRAILVDVGELCNDADLICRPRNAEC-SSRNGDPRTCRCKSGYFPVYQQSLHYHECFKQV 255          
BLAST of SMED30023982 vs. TrEMBL
Match: A0A0R3U7J3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2797 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 4.200e-43
Identity = 89/240 (37.08%), Postives = 130/240 (54.17%), Query Frame = -2
Query: 1202 IVFVNLISCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQ-----CSCPFNTMTPN------AKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSI 1888
            + +  L   D+Y VV  GPC+++   YC  +V NS CS   NECFC   +V ++E  G+ CKPLL+ + C  D +C  + N SICHPGAG C CP G I+V   + CRN      +  C  C ++ G+C+ EE     P  SN   S      C+CPF+T  P+      +K+ +  +  C AI V++G  CN  DL+C  +NS+C      L + C+C+ GY  VY++   +  C RS+
Sbjct:   13 VAWPALTHADEYHVVAAGPCVAEGDAYCIRRVTNSVCSATKNECFCQPSFVAIQEEYGITCKPLLTSLSCHVDRDCVHVRN-SICHPGAGFCACPGGTIYVPQAHACRNLADKENSTFCETCRQVNGVCYYEEQ----PGGSNNRNSSSPGLGCTCPFDTAMPSPSPDAASKEPVPHWAFCKAILVDIGGLCNQIDLLCRPRNSECTSVGGSLRS-CRCQKGYFPVYQQSLHYHECFRSV 246          
BLAST of SMED30023982 vs. TrEMBL
Match: A0A5K3FMK4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 3.034e-40
Identity = 89/240 (37.08%), Postives = 130/240 (54.17%), Query Frame = -2
Query: 1202 IVFVNLISCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQ-----CSCPFNTMTPN------AKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSI 1888
            + +  L   D+Y VV  GPC+++   YC  +V NS CS   NECFC   +V ++E  G+ CKPLL+ + C  D +C  + N SICHPGAG C CP G I+V   + CRN      +  C  C ++ G+C+ EE     P  SN   S      C+CPF+T  P+      +K+ +  +  C AI V++G  CN  DL+C  +NS+C      L + C+C+ GY  VY++   +  C RS+
Sbjct:   13 VAWPALTHADEYHVVAAGPCVAEGDAYCIRRVTNSVCSATKNECFCQPSFVAIQEEYGITCKPLLTSLSCHVDRDCVHVRN-SICHPGAGFCACPGGTIYVPQAHACRNLADKENSTFCETCRQVNGVCYYEEQ----PGGSNNRNSSSPGLGCTCPFDTAMPSPSPDAASKEPVPHWAFCKAILVDIGGLCNQIDLLCRPRNSECTSVGGSLRS-CRCQKGYFPVYQQSLHYHECFRSV 246          
BLAST of SMED30023982 vs. TrEMBL
Match: A0A068X171 (Uncharacterized protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000926400 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 2.960e-38
Identity = 85/237 (35.86%), Postives = 129/237 (54.43%), Query Frame = -2
Query: 1202 SIVFVNLISCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKK-------SIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSI 1891
            S+ F  +    + + +  GPC+ +  +YC  +V NS+CS   NECFC   +V ++E  G+ CKPLL+ + C  D +C  + N SICHPGAG C CP G  +V+ ++ C N   NS N  C  C ++ GIC+  EN       S   +  C+CPFNT  P  ++       SI ++  C AI V++G+ CN  DL+C  +NS+C  S       C+CK G+  VY++   +  C + +
Sbjct:   16 SLHFAQIEDDLRLRSLDLGPCVEEGDFYCSRRVPNSFCSVTKNECFCQPAFVAIQEEYGITCKPLLTSLNCHVDKDCVHVKN-SICHPGAGFCACPGGTAYVAQEHACHNVAENSNNSFCETCKQMNGICYHAEN-------SKKQEFGCACPFNTAMPLPQRLYASNDGSIAQWAFCKAILVDVGDLCNQVDLLCRPRNSEC-SSLNGGPKSCRCKPGFFPVYQQSLHYHECFKQV 243          
BLAST of SMED30023982 vs. TrEMBL
Match: A0A068YE62 (Uncharacterized protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000926400 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 4.667e-38
Identity = 84/237 (35.44%), Postives = 128/237 (54.01%), Query Frame = -2
Query: 1202 SIVFVNLISCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKK-------SIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSI 1891
            S+ F  +    + + +  GPC+ +  +YC  +V NS+CS   NECFC   +V ++E  G+ CKPLL+ + C  D +C  + N SICHPGAG C CP G  +V+ ++ C N   NS N  C  C ++ GIC+  EN       S   +  C+CPFNT  P  ++        I ++  C AI V++G  CN +DL+C  +NS+C  S       C+CK G+  VY++   +  C + +
Sbjct:   16 SLHFAQIEDDLRLRSLDLGPCVEEGDFYCSRRVPNSFCSVTKNECFCHPAFVAIQEEYGITCKPLLTSLNCHVDKDCVHVKN-SICHPGAGFCACPGGTAYVAQEHACHNVAENSNNSFCETCKQMNGICYHAEN-------SKKQEFGCACPFNTAMPLPQRLHASNGGPIAQWAFCKAILVDVGHLCNQEDLLCRPRNSEC-SSLNGGPKSCRCKPGFFPVYQQSLHYHECFKQV 243          
BLAST of SMED30023982 vs. Planmine SMEST
Match: SMESG000020498.1 (SMESG000020498.1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 338/347 (97.41%), Postives = 341/347 (98.27%), Query Frame = -3
Query:  196 KRKATLIAVDQLVSDIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQRLHFSEIKIKHKIRGFTRHLLNSSTNFHDQKILFISSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ 1236
            ++K +     QLVSDIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQRLHFSEIKIKHKIRGFTRHLLNSSTNFHDQKILFISSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ
Sbjct:  225 EKKESHFNCYQLVSDIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQRLHFSEIKIKHKIRGFTRHLLNSSTNFHDQKILFISSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ 571          

HSP 2 Score: 483.797 bits (1244), Expect = 4.935e-161
Identity = 233/238 (97.90%), Postives = 235/238 (98.74%), Query Frame = -2
Query: 1199 MKRFIIISIVFVNLISCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSIS 1912
            MKRFIIISIVFVNLI CDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNC + +S
Sbjct:    1 MKRFIIISIVFVNLIYCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCYQLVS 238          
BLAST of SMED30023982 vs. Planmine SMEST
Match: SMESG000020498.1 (SMESG000020498.1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 303/347 (87.32%), Postives = 306/347 (88.18%), Query Frame = -3
Query:  196 KRKATLIAVDQLVSDIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQRLHFSEIKIKHKIRGFTRHLLNSSTNFHDQKILFISSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ 1236
            ++K +     QLVSDIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQ                                   SSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ
Sbjct:  223 EKKESHFNCYQLVSDIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQ-----------------------------------SSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ 534          

HSP 2 Score: 474.167 bits (1219), Expect = 8.576e-158
Identity = 231/238 (97.06%), Postives = 233/238 (97.90%), Query Frame = -2
Query: 1199 MKRFIIISIVFVNLISCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSIS 1912
            MKRFIIISIVFVNLI CDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNF  NYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNC + +S
Sbjct:    1 MKRFIIISIVFVNLIYCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNF--NYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCYQLVS 236          
BLAST of SMED30023982 vs. Planmine SMEST
Match: SMESG000020498.1 (SMESG000020498.1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 303/347 (87.32%), Postives = 306/347 (88.18%), Query Frame = -3
Query:  196 KRKATLIAVDQLVSDIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQRLHFSEIKIKHKIRGFTRHLLNSSTNFHDQKILFISSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ 1236
            ++K +     QLVSDIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQ                                   SSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ
Sbjct:  225 EKKESHFNCYQLVSDIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQ-----------------------------------SSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ 536          

HSP 2 Score: 483.797 bits (1244), Expect = 1.813e-161
Identity = 233/238 (97.90%), Postives = 235/238 (98.74%), Query Frame = -2
Query: 1199 MKRFIIISIVFVNLISCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSIS 1912
            MKRFIIISIVFVNLI CDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNC + +S
Sbjct:    1 MKRFIIISIVFVNLIYCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCYQLVS 238          
BLAST of SMED30023982 vs. Planmine SMEST
Match: SMESG000039966.1 (SMESG000039966.1)

HSP 1 Score: 174.481 bits (441), Expect = 1.398e-55
Identity = 87/228 (38.16%), Postives = 136/228 (59.65%), Query Frame = -2
Query: 1196 DKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICF--SEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKS----IKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSISK 1861
            D + +V  GPCL K   YC N V NS+CS++ NECFC  G+V ++E++G+ICK LL+++KC  D +C ++  SS CHPG G C+CP+   +V+ ++ C++Y +N  + +C HC  +GG C+  +   L++ PK  NI   +C+CP    TP A       +   +IC  I V+LG YCND D+ C +K ++C +S      +C C   Y+AVY+    ++ C   I +
Sbjct:   20 DNFHIVASGPCLKKGKNYCQNIVPNSFCSEEKNECFCQNGFVAIKEKNGLICKTLLTDLKCSTDRDCKDVYGSS-CHPGPGQCSCPAETFYVAQEHVCKDYPKNIPDPLCKHCRNIGGKCYFNTISPLSVIPK-QNIYSGKCNCPGILSTPTATNEKSQLMPSLEICQGIMVDLGSYCNDYDITCRAKIAECAHSTVMKYKVCVCPKDYIAVYQHYLKYYECYPKIER 245          

HSP 2 Score: 62.3882 bits (150), Expect = 1.398e-55
Identity = 78/337 (23.15%), Postives = 138/337 (40.95%), Query Frame = -3
Query:  196 CSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYF----DVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQN---IQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQRLH---FSEIKIKHKIRGFTRHLLNSSTNFHDQKILFISSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ 1176
            C  C +S G+CI  V S  N    C C K++      D       C      IKC S  +E+C+N   N +Y  +    I      I  ++  S   N     C +   + S   T   +    + +T   ++C   +    N  +   ++ +    +I D  NDF ++++CK    + N   GQI ++SW G    I P +  +++D + + + +    + + V ++    + +  K  KR  +  YFL EKCS I   S   IY R+     S    ++++  F              K+   S+ F    + +     +SC+ +LC+D   C+Q
Sbjct:  250 CEHCQNSQGSCI-DVNSDGNED-SCYCGKWKSISNQEDTELSQPICKDDMLIIKCSSVHLEVCIN---NDKYIPKKRMAISEYSTGIFYTNLVSKSTNF----CSVTGLRKSKSLTCFQMSKPIQ-STSFENNCSTISFGQDNSVYYSTFLFIPMDKFIFDPINDFNYEISCKADFKRSNPSMGQITEKSWKGEINSIEP-LIETMEDLLSLKVVDFQSKTLKEVKIEQMFALDVFMK--KRNVKFNYFLPEKCSLINGKSNQVIYSRIKSISMSSSPNQNELNMFAFSTTPKVDQNEPHKLR--SNYFPAFMLKSKGISTFSCVFRLCQDSSMCNQ 571          
BLAST of SMED30023982 vs. Planmine SMEST
Match: SMESG000039966.1 (SMESG000039966.1)

HSP 1 Score: 174.481 bits (441), Expect = 1.557e-55
Identity = 87/228 (38.16%), Postives = 136/228 (59.65%), Query Frame = -2
Query: 1196 DKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNNECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSCTCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICF--SEENLNLFPKTSNIIKSQCSCPFNTMTPNAKKS----IKKYQICMAIRVNLGEYCNDDDLICISKNSKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSISK 1861
            D + +V  GPCL K   YC N V NS+CS++ NECFC  G+V ++E++G+ICK LL+++KC  D +C ++  SS CHPG G C+CP+   +V+ ++ C++Y +N  + +C HC  +GG C+  +   L++ PK  NI   +C+CP    TP A       +   +IC  I V+LG YCND D+ C +K ++C +S      +C C   Y+AVY+    ++ C   I +
Sbjct:   28 DNFHIVASGPCLKKGKNYCQNIVPNSFCSEEKNECFCQNGFVAIKEKNGLICKTLLTDLKCSTDRDCKDVYGSS-CHPGPGQCSCPAETFYVAQEHVCKDYPKNIPDPLCKHCRNIGGKCYFNTISPLSVIPK-QNIYSGKCNCPGILSTPTATNEKSQLMPSLEICQGIMVDLGSYCNDYDITCRAKIAECAHSTVMKYKVCVCPKDYIAVYQHYLKYYECYPKIER 253          

HSP 2 Score: 62.003 bits (149), Expect = 1.557e-55
Identity = 78/337 (23.15%), Postives = 138/337 (40.95%), Query Frame = -3
Query:  196 CSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYF----DVTGHSIQCMKVTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKNISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVGLYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVILPDVFISLDDTVDMYITNLNGLSYEFVSLQN---IQIHFKSFKRKDELPYFLVEKCSEIYSDSQITIYQRLH---FSEIKIKHKIRGFTRHLLNSSTNFHDQKILFISSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQ 1176
            C  C +S G+CI  V S  N    C C K++      D       C      IKC S  +E+C+N   N +Y  +    I      I  ++  S   N     C +   + S   T   +    + +T   ++C   +    N  +   ++ +    +I D  NDF ++++CK    + N   GQI ++SW G    I P +  +++D + + + +    + + V ++    + +  K  KR  +  YFL EKCS I   S   IY R+     S    ++++  F              K+   S+ F    + +     +SC+ +LC+D   C+Q
Sbjct:  258 CEHCQNSQGSCI-DVNSDGNED-SCYCGKWKSISNQEDTELSQPICKDDMLIIKCSSVHLEVCIN---NDKYIPKKRMAISEYSTGIFYTNLVSKSTNF----CSVTGLRKSKSLTCFQMSKPIQ-STSFENNCSTISFGQDNSVYYSTFLFIPMDKFIFDPINDFNYEISCKADFKRSNPSMGQITEKSWKGEINSIEP-LIETMEDLLSLKVVDFQSKTLKEVKIEQMFALDVFMK--KRNVKFNYFLPEKCSLINGKSNQVIYSRIKSISMSSSPNQNELNMFAFSTTPKVDQNEPHKLR--SNYFPAFMLKSKGISTFSCVFRLCQDSSMCNQ 579          
The following BLAST results are available for this feature:
BLAST of SMED30023982 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QE861.761e-4337.04Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3U7J34.200e-4337.08Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FMK43.034e-4037.08Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068X1712.960e-3835.86Uncharacterized protein OS=Echinococcus granulosus... [more]
A0A068YE624.667e-3835.44Uncharacterized protein OS=Echinococcus multilocul... [more]
back to top
BLAST of SMED30023982 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023982 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020498.14.935e-16197.41SMESG000020498.1[more]
SMESG000020498.18.576e-15887.32SMESG000020498.1[more]
SMESG000020498.11.813e-16187.32SMESG000020498.1[more]
SMESG000039966.11.398e-5538.16SMESG000039966.1[more]
SMESG000039966.11.557e-5538.16SMESG000039966.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023982 ID=SMED30023982|Name=SMED30023982|organism=Schmidtea mediterranea sexual|type=transcript|length=1913bp
AAAAAAAAAAAAATAAATTCTTTTCCCCTTCTTTAATATTTTTTTTAAAA
TTATTAAATATGTTCAAATTTTAAATTATTCATTAAAATAAGATCCTGTT
TCGAAATAATTATAATTTACGACAATACTTATTTTTCTAAATAAAATCTC
GAAAAATTTAATATTTCAACATAAATACAAATGATTAAAAATTACTTGAG
AGCACCAAAACAAATCTTCACATAGTTTAATAATGCAACTATATAATACA
TTAGTAACTGCAGAAACGTTTGGAATTTGGAATTCAGAGCTGATAAATAA
TATTTTTTGATCATGAAAGTTGGTGGAAGAGTTTAATAAATGACGAGTGA
ACCCACGAATTTTATGTTTAATCTTTATCTCTGAAAAATGTAACCTTTGA
TATATAGTTATTTGAGAATCACTGTAAATTTCTGAACATTTTTCCACCAA
AAAATATGGCAATTCATCTTTCCTTTTAAAGGATTTGAAATGAATCTGAA
TATTCTGCAGCGAAACAAATTCATATGACAAGCCATTCAAATTGGTAATA
TACATGTCAACGGTGTCGTCTAAACTAATAAATACATCTGGTAAAATAAC
TTTCCCTGTTCCTGTCCATGATCTGTCTAATATTTGGCCGTTCACGAGAT
TTTCTTGATCGACACTTGTTTTACAAGTTAAGTCGAAAAGAAAGTCATTT
GCTATATCGATGATGTAAGGTTGGTTCCAAACTCGCATGTATAAACCGAC
GAAGTTGATATTCAAATAATTACCGTTTGATATCCCGCAATGATCTGAAG
GTTTTGTGTTTATTTCAAAATCGCTGCAAAGTGATGCTACGGTTTTTTCA
TACGAAATTTTATATTCGTTCATTTTGCAAATTTTTTTACTGATATTTTT
ACGATGAGAATACGCATCAGATATAGATATTGCTTTCGGTGTCCTTCGAA
TGTAATCTAGCAATTGTGCATAATATTCATAATTTGTAGGAATATTCAAA
CAGATTTCTATTTTTTGTGATTGACATTTTATACCAGCTGTAACTTTCAT
ACATTGAATTGAATGGCCAGTGACATCGAAATACTGATATTTGTCACATA
GACATTTCAGAACTACATTTCTGCTGGACTTGACTTGGATAATACATGTT
CCACCCGAGGAGTAACAGAGACTACATCTTGGGTATTCGATATCACTTAC
TAATTGATCTACAGCAATTAAAGTGGCTTTCCTTTTTTTCATAAACTGCA
AGGTATCCTGTTTTACACTGGCAAATCGTAGCAAGATACTCATGAGAATA
AATACATTTAGAATTTTTTGATATGCAAATAAGGTCGTCATCATTACAAT
ATTCACCTAAATTAACACGAATCGCCATGCATATTTGATATTTTTTAATG
CTTTTCTTTGCATTTGGTGTCATCGTGTTGAATGGACAGCTGCATTGAGA
TTTGATGATGTTTGATGTTTTCGGAAATAAATTTAAATTTTCTTCTGAAA
AACAGATGCCGCCCAATCTTGAACAATGATAACAAATTTCATTTGTACTG
TTTCTCAAATAGTTTCTACAAAAGTTTTGATGTGAAACAAATATCATTCC
AGATGGGCAAGTGCACGAGCCAGCTCCAGGATGGCAAATACTGGAATTGG
TGATTTCACTACATTCTGCGTCAAAACGACATTTCATTTCTGATAATAAT
GGTTTGCAAATAACTCCCGAACGTTCACGAACTGTTACATAACCGAATGA
GCAAAAACATTCATTGTTTTGTTTCGAGCAATAACTATTTTTCACTTTAT
TATGACAATAATAACTTGGTTTTGACAAACAAGGTCCACGATAAACAACC
TGATACTTGTCGCAAGAAATGAGGTTGACAAAAACTATGGAAATTATAAT
GAATCTTTTCATG
back to top

protein sequence of SMED30023982-orf-1

>SMED30023982-orf-1 ID=SMED30023982-orf-1|Name=SMED30023982-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=393bp
MMTTLFAYQKILNVFILMSILLRFASVKQDTLQFMKKRKATLIAVDQLVS
DIEYPRCSLCYSSGGTCIIQVKSSRNVVLKCLCDKYQYFDVTGHSIQCMK
VTAGIKCQSQKIEICLNIPTNYEYYAQLLDYIRRTPKAISISDAYSHRKN
ISKKICKMNEYKISYEKTVASLCSDFEINTKPSDHCGISNGNYLNINFVG
LYMRVWNQPYIIDIANDFLFDLTCKTSVDQENLVNGQILDRSWTGTGKVI
LPDVFISLDDTVDMYITNLNGLSYEFVSLQNIQIHFKSFKRKDELPYFLV
EKCSEIYSDSQITIYQRLHFSEIKIKHKIRGFTRHLLNSSTNFHDQKILF
ISSEFQIPNVSAVTNVLYSCIIKLCEDLFWCSQVIFNHLYLC*
back to top

protein sequence of SMED30023982-orf-2

>SMED30023982-orf-2 ID=SMED30023982-orf-2|Name=SMED30023982-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MKRFIIISIVFVNLISCDKYQVVYRGPCLSKPSYYCHNKVKNSYCSKQNN
ECFCSFGYVTVRERSGVICKPLLSEMKCRFDAECSEITNSSICHPGAGSC
TCPSGMIFVSHQNFCRNYLRNSTNEICYHCSRLGGICFSEENLNLFPKTS
NIIKSQCSCPFNTMTPNAKKSIKKYQICMAIRVNLGEYCNDDDLICISKN
SKCIYSHEYLATICQCKTGYLAVYEKKESHFNCCRSISK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 5..27