Protein HID1

Overview
NameProtein HID1
Smed IDSMED30023973
Length (bp)2816
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein HID1 (SMED30023973) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein HID1 (SMED30023973) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein HID1 (SMED30023973) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein HID1 (SMED30023973) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023973

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30023973h1SMcG0004874 dd_Smed_v4_4543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein HID1 vs. Ensembl Human
Match: HID1 (HID1 domain containing [Source:HGNC Symbol;Acc:HGNC:15736])

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 457/846 (54.02%), Postives = 588/846 (69.50%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFW--FPFNQQCESNEDQDK--TPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVS-GNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGD-------------------------EWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MGS +SKLN+RKAVIQLTTKT+PV+ +++ FWDQFW +  T++QD+F L+PAAEIRA+REESP+NL+ LC KA++K++  +E+ C + KE+  +LNC R+LTR++PYIFED +W  FFW   P   +    E+ D+   P+AE L+  I++LLF PDFTV S ++S  D+ ED   ++SC+YIWE GVGF+ S     I D NR E+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLN V +YDPVGYG+PYNHL+FSDYREPLVE A Q+L +                       + + + +   + ++D   +     +   ++   GPEN F+N++SRIH++ DF FIL+G +RLL+NPL  TYLPNS KKIQFHQELL+L W++C+ NK F+F VLK   +++ILVPIL+ LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHADLL++VFHKIIT+GH RLQPL+DC LT++VNVSPYLKSLSMV++ K+LHL+EAFS+ WFLFS+  NHHL+FFLLEV NNIIQYQFDGNSN++Y++IRKR IFH L+++  D  +I +AL ++ +         P P+S   S  G+      P +P                  E G LK SL  TP +    +KS+ +         +  +   + QQ + D                         +W PTPEW  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI++FLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPP+WYDT+++LFEIQRV
Sbjct:    1 MGSTDSKLNFRKAVIQLTTKTQPVEATDDAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLCYKAVEKLVQGAESGCHSEKEKQIVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGQGEEDDEHARPLAESLLLAIADLLFCPDFTVQSHRRSTVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPAPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIV-----------------------TLDHDSASSASPTVDGTTT----GTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILFFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSIRVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLFDCLLTIVVNVSPYLKSLSMVTANKLLHLLEAFSTTWFLFSAAQNHHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRSIFHQLANLPTDPPTIHKALQRRRR--------TPEPLSRTGSQEGTSMEGSRPAAP-----------------AEPGTLKTSLVATPGIDKLTEKSQVS------EDGTLRSLEPEPQQSLEDGSPAKGEPSQAWREQRRPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAMWFRTYMWGVIYLRNVDPPVWYDTDVKLFEIQRV 788          
BLAST of Protein HID1 vs. Ensembl Human
Match: HID1 (HID1 domain containing [Source:HGNC Symbol;Acc:HGNC:15736])

HSP 1 Score: 267.7 bits (683), Expect = 2.293e-82
Identity = 119/171 (69.59%), Postives = 148/171 (86.55%), Query Frame = 1
Query: 1150 GPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVN 1662
            GPEN F+N++SRIH++ DF FIL+G +RLL+NPL  TYLPNS KKIQFHQELL+L W++C+ NK F+F VLK   +++ILVPIL+ LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHADLL++VFHKIIT+GH RLQPL+DC LT++VN
Sbjct:   27 GPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILFFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSIRVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLFDCLLTIVVN 197          
BLAST of Protein HID1 vs. Ensembl Human
Match: HID1 (HID1 domain containing [Source:HGNC Symbol;Acc:HGNC:15736])

HSP 1 Score: 238.81 bits (608), Expect = 1.109e-71
Identity = 118/255 (46.27%), Postives = 160/255 (62.75%), Query Frame = 1
Query:  511 EDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNS 1275
            +D+   P+AE L+  I++LLF PDFTV S ++S  D+ ED   ++SC+YIWE GVGF+ S     I D NR E+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLN V +YDPVGYG+PYNHL+FSDYREPLVE A Q+L +                       + + + +   + ++D   +     +   ++   GPEN F+N++SRIH++ DF FIL+G +RLL+NPL  TYLPNS
Sbjct:   26 DDEHARPLAESLLLAIADLLFCPDFTVQSHRRSTVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPAPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIV-----------------------TLDHDSASSASPTVDGTTT----GTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPNS 253          
BLAST of Protein HID1 vs. Ensembl Human
Match: HID1 (HID1 domain containing [Source:HGNC Symbol;Acc:HGNC:15736])

HSP 1 Score: 168.318 bits (425), Expect = 4.180e-47
Identity = 70/118 (59.32%), Postives = 98/118 (83.05%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFF 477
            MGS +SKLN+RKAVIQLTTKT+PV+ +++ FWDQFW +  T++QD+F L+PAAEIRA+REESP+NL+ LC KA++K++  +E+ C + KE+  +LNC R+LTR++PYIFED +W  FF
Sbjct:    1 MGSTDSKLNFRKAVIQLTTKTQPVEATDDAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLCYKAVEKLVQGAESGCHSEKEKQIVLNCSRLLTRVLPYIFEDPDWRGFF 118          
BLAST of Protein HID1 vs. Ensembl Human
Match: HID1 (HID1 domain containing [Source:HGNC Symbol;Acc:HGNC:15736])

HSP 1 Score: 102.064 bits (253), Expect = 5.391e-25
Identity = 58/164 (35.37%), Postives = 82/164 (50.00%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFW--FPFNQQCESNEDQDKT-PVAEQLMNCISNLLFYPDFTVSSLKK 606
            MGS +SKLN+RKAVIQLTTKT+                                                  A++K++  +E+ C + KE+  +LNC R+LTR++PYIFED +W  FFW   P   +    ED +   P+AE L+  I++LLF PDFTV S ++
Sbjct:    1 MGSTDSKLNFRKAVIQLTTKTQ--------------------------------------------------AVEKLVQGAESGCHSEKEKQIVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGGEEDDEHARPLAESLLLAIADLLFCPDFTVQSHRR 114          
BLAST of Protein HID1 vs. Ensembl Celegans
Match: hid-1 (HID-1; High temperature-Induced Dauer formation [Source:UniProtKB/TrEMBL;Acc:G5EG65])

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 396/818 (48.41%), Postives = 543/818 (66.38%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPL--SHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG++ S++++++ V+ +T+K    D +   FWDQ W  +  ++ +IF +I   +IR LR+ESP NL+ L  K ++K+   S     T  ++ TI N +R+LTRI+PY+ ED+EW  +FW P       + D  K P+A  L+  +S+LLF P+FT++       D   D   I+SC+YIWE GVG        ++   NRTEILKLLLTCF+  +Y  P         W+++FTS  N H LP+FTSLLN+V +YDPVGYG+PYN+L+F+D REPLVE+A+Q+L + L                                         +E +  T +S Y+  +N+FIN++SRIH++ DFDF+L+G +RLL+NP+  S +YLPNS K++ FHQELL+LLW+ CEIN+ FMF+VLK   +++ILVPILYH++DAR D  R+G++H+GVFI+LLLSGERNFGV+LNK Y  + NI+V  FTGTHADLL+LV HK+ITTG+ RLQ L+DCFLT++VNVSPY+KSLSMV++ K++HL+EAFS+PWFLFSSPTN  L+F LLEV NN+IQYQFDGNSN+IY++IRKR +F+ LS++  D+ASI++ LS +  ++A    M+    S  S +     P+ P +                 D    Q    +  T  L  T            + + +   +  + +    +EW+ T EWA +WK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPI+IR+YQ+N GT+ WFR YMWGVIYL++  PPIWYDT+++LFE+QR 
Sbjct:    1 MGAQGSRVDFKQVVLDVTSKPGKDDET---FWDQAW--WPDSVNEIFAMISGEDIRKLRDESPKNLATLVYKTVEKL-QFSRNHPATIDQKKTI-NAIRLLTRIVPYLLEDAEWRGYFWSPI-----PHGDAAK-PLAAVLLETLSDLLFCPEFTITHANGQKID---DLSTIDSCEYIWEAGVGSGNKPPMVALHYQNRTEILKLLLTCFAELIYA-PVSDETRLR-WVIHFTSVTNPHVLPIFTSLLNIVCAYDPVGYGLPYNYLLFNDSREPLVEIALQVLIVCL----------------------------------------DKETQPNTDDSGYK--DNYFINYLSRIHREEDFDFMLKGITRLLSNPIHSSSSYLPNSTKRVNFHQELLVLLWKCCEINQKFMFYVLKTSDVLDILVPILYHISDARNDSGRVGLIHMGVFIILLLSGERNFGVRLNKPYTAKANINVQTFTGTHADLLILVIHKLITTGNYRLQTLFDCFLTIMVNVSPYMKSLSMVAANKLVHLVEAFSTPWFLFSSPTNPQLVFSLLEVFNNVIQYQFDGNSNLIYTIIRKRNVFYQLSNLSTDAASIAKTLSGRKSKSANRDEMVDQLKSPTSTA----PPEIPAA-----------------DAPAAQTLGGVSTTTGLAAT--------PALASMTGNVGNWEERPESSQDNEWIATQEWADAWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPIVIRRYQTNIGTNHWFRIYMWGVIYLKHTQPPIWYDTDVKLFEVQRA 729          
BLAST of Protein HID1 vs. Ensembl Celegans
Match: hid-1 (HID-1; High temperature-Induced Dauer formation [Source:UniProtKB/TrEMBL;Acc:G5EG65])

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 384/798 (48.12%), Postives = 526/798 (65.91%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPL--SHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLR 2511
            MG++ S++++++ V+ +T+K    D +   FWDQ W  +  ++ +IF +I   +IR LR+ESP NL+ L  K ++K+   S     T  ++ TI N +R+LTRI+PY+ ED+EW  +FW P       + D  K P+A  L+  +S+LLF P+FT++       D   D   I+SC+YIWE GVG        ++   NRTEILKLLLTCF+  +Y  P         W+++FTS  N H LP+FTSLLN+V +YDPVGYG+PYN+L+F+D REPLVE+A+Q+L + L                                         +E +  T +S Y+  +N+FIN++SRIH++ DFDF+L+G +RLL+NP+  S +YLPNS K++ FHQELL+LLW+ CEIN+ FMF+VLK   +++ILVPILYH++DAR D  R+G++H+GVFI+LLLSGERNFGV+LNK Y  + NI+V  FTGTHADLL+LV HK+ITTG+ RLQ L+DCFLT++VNVSPY+KSLSMV++ K++HL+EAFS+PWFLFSSPTN  L+F LLEV NN+IQYQFDGNSN+IY++IRKR +F+ LS++  D+ASI++ LS +  ++A    M+    S  S +     P+ P +                 D    Q    +  T  L  T            + + +   +  + +    +EW+ T EWA +WK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPI+IR+YQ+N GT+ WFR YMWGVIYL+
Sbjct:    1 MGAQGSRVDFKQVVLDVTSKPGKDDET---FWDQAW--WPDSVNEIFAMISGEDIRKLRDESPKNLATLVYKTVEKL-QFSRNHPATIDQKKTI-NAIRLLTRIVPYLLEDAEWRGYFWSPI-----PHGDAAK-PLAAVLLETLSDLLFCPEFTITHANGQKID---DLSTIDSCEYIWEAGVGSGNKPPMVALHYQNRTEILKLLLTCFAELIYA-PVSDETRLR-WVIHFTSVTNPHVLPIFTSLLNIVCAYDPVGYGLPYNYLLFNDSREPLVEIALQVLIVCL----------------------------------------DKETQPNTDDSGYK--DNYFINYLSRIHREEDFDFMLKGITRLLSNPIHSSSSYLPNSTKRVNFHQELLVLLWKCCEINQKFMFYVLKTSDVLDILVPILYHISDARNDSGRVGLIHMGVFIILLLSGERNFGVRLNKPYTAKANINVQTFTGTHADLLILVIHKLITTGNYRLQTLFDCFLTIMVNVSPYMKSLSMVAANKLVHLVEAFSTPWFLFSSPTNPQLVFSLLEVFNNVIQYQFDGNSNLIYTIIRKRNVFYQLSNLSTDAASIAKTLSGRKSKSANRDEMVDQLKSPTSTA----PPEIPAA-----------------DAPAAQTLGGVSTTTGLAAT--------PALASMTGNVGNWEERPESSQDNEWIATQEWADAWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPIVIRRYQTNIGTNHWFRIYMWGVIYLK 709          
BLAST of Protein HID1 vs. Ensembl Fly
Match: CG8841 (gene:FBgn0033713 transcript:FBtr0087966)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 327/605 (54.05%), Postives = 437/605 (72.23%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKT-PVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKK 1935
            MG+ +SKLN+RKA++QLT K + +DPS+ +FW+QFW  ++TT++D+F L+ ++EIR +R E+P NL+ LC KA++K+    ++SC T  EQ  +LNCVR+L R +PYIFED +W  FFW        S   QDKT P+A+ L+N   +LLF PDFTV++ +++GP+  E+   I+SC+YIWE GVGF+ S    +  +  RTE+LKLLLTCFS  MY  P Q   EPN WI YFTS +N+H LPLFTS LN V SYDPVG+G+PYNHL+F+D  EPLVE  +Q+L +TL+       Q            ++  + S DE N  D                     N FIN++SR+H+D DF F+L+G +RLLNNPL   YLPNS K++  HQELLIL W++C+ NK F++ VLK   +++IL+PILYHLN +R D +R+G+MHIGVFILLLLSGERNFGV+LNK Y   V +D+PVFTGTHADLL+ VFHKII TGH RLQPL+DC LT++VNVSPYLK+LSMV+S K+LHL+EAFS+PWFL S+P+NHHL+FFLLE+ NNIIQYQFDGNSN++Y++IRKR +FH ++++  D A I++ LS +
Sbjct:    1 MGNTDSKLNFRKAIVQLTQKNQKIDPSDEQFWEQFWQGHQTTLEDVFALVTSSEIRQIRNENPANLATLCYKAVEKLAQAVDSSCRTQAEQQCVLNCVRLLVRCLPYIFEDEKWRDFFW-------SSLPSQDKTMPLAQSLLNATCDLLFCPDFTVTATRRAGPEKAEELANIDSCEYIWEAGVGFAQSPPHNAHMERRRTELLKLLLTCFSEPMYRSPQQS-EEPNKWIAYFTSADNRHALPLFTSFLNTVCSYDPVGFGVPYNHLLFADTTEPLVEACLQLLIVTLDHDMVVQQQL-----------TQPGQASYDEGNCGD---------------------NLFINYLSRVHRDEDFHFVLKGITRLLNNPLVQNYLPNSTKRLHCHQELLILFWKICDYNKKFLYFVLKSSDVLDILIPILYHLNYSRADQSRVGLMHIGVFILLLLSGERNFGVRLNKAYSATVPMDIPVFTGTHADLLITVFHKIIATGHQRLQPLFDCLLTILVNVSPYLKTLSMVASVKMLHLLEAFSTPWFLLSAPSNHHLVFFLLEIFNNIIQYQFDGNSNLVYTIIRKRHVFHAMANLPTDMAGIAKCLSGR 565          

HSP 2 Score: 211.46 bits (537), Expect = 1.064e-56
Identity = 94/114 (82.46%), Postives = 102/114 (89.47%), Query Frame = 1
Query: 2230 GDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
             D W PTPEW  SW+ KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTY+WGVIYLRN++P IWYDT ++LFEIQRV
Sbjct:  724 SDRWTPTPEWIVSWRSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTTAWFRTYIWGVIYLRNVEPAIWYDTEVKLFEIQRV 837          
BLAST of Protein HID1 vs. Ensembl Fly
Match: CG8841 (gene:FBgn0033713 transcript:FBtr0087965)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 327/605 (54.05%), Postives = 437/605 (72.23%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKT-PVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKK 1935
            MG+ +SKLN+RKA++QLT K + +DPS+ +FW+QFW  ++TT++D+F L+ ++EIR +R E+P NL+ LC KA++K+    ++SC T  EQ  +LNCVR+L R +PYIFED +W  FFW        S   QDKT P+A+ L+N   +LLF PDFTV++ +++GP+  E+   I+SC+YIWE GVGF+ S    +  +  RTE+LKLLLTCFS  MY  P Q   EPN WI YFTS +N+H LPLFTS LN V SYDPVG+G+PYNHL+F+D  EPLVE  +Q+L +TL+       Q            ++  + S DE N  D                     N FIN++SR+H+D DF F+L+G +RLLNNPL   YLPNS K++  HQELLIL W++C+ NK F++ VLK   +++IL+PILYHLN +R D +R+G+MHIGVFILLLLSGERNFGV+LNK Y   V +D+PVFTGTHADLL+ VFHKII TGH RLQPL+DC LT++VNVSPYLK+LSMV+S K+LHL+EAFS+PWFL S+P+NHHL+FFLLE+ NNIIQYQFDGNSN++Y++IRKR +FH ++++  D A I++ LS +
Sbjct:    1 MGNTDSKLNFRKAIVQLTQKNQKIDPSDEQFWEQFWQGHQTTLEDVFALVTSSEIRQIRNENPANLATLCYKAVEKLAQAVDSSCRTQAEQQCVLNCVRLLVRCLPYIFEDEKWRDFFW-------SSLPSQDKTMPLAQSLLNATCDLLFCPDFTVTATRRAGPEKAEELANIDSCEYIWEAGVGFAQSPPHNAHMERRRTELLKLLLTCFSEPMYRSPQQS-EEPNKWIAYFTSADNRHALPLFTSFLNTVCSYDPVGFGVPYNHLLFADTTEPLVEACLQLLIVTLDHDMVVQQQL-----------TQPGQASYDEGNCGD---------------------NLFINYLSRVHRDEDFHFVLKGITRLLNNPLVQNYLPNSTKRLHCHQELLILFWKICDYNKKFLYFVLKSSDVLDILIPILYHLNYSRADQSRVGLMHIGVFILLLLSGERNFGVRLNKAYSATVPMDIPVFTGTHADLLITVFHKIIATGHQRLQPLFDCLLTILVNVSPYLKTLSMVASVKMLHLLEAFSTPWFLLSAPSNHHLVFFLLEIFNNIIQYQFDGNSNLVYTIIRKRHVFHAMANLPTDMAGIAKCLSGR 565          

HSP 2 Score: 211.46 bits (537), Expect = 1.064e-56
Identity = 94/114 (82.46%), Postives = 102/114 (89.47%), Query Frame = 1
Query: 2230 GDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
             D W PTPEW  SW+ KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTY+WGVIYLRN++P IWYDT ++LFEIQRV
Sbjct:  724 SDRWTPTPEWIVSWRSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTTAWFRTYIWGVIYLRNVEPAIWYDTEVKLFEIQRV 837          
BLAST of Protein HID1 vs. Ensembl Fly
Match: CG8841 (gene:FBgn0033713 transcript:FBtr0087964)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 327/605 (54.05%), Postives = 437/605 (72.23%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKT-PVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKK 1935
            MG+ +SKLN+RKA++QLT K + +DPS+ +FW+QFW  ++TT++D+F L+ ++EIR +R E+P NL+ LC KA++K+    ++SC T  EQ  +LNCVR+L R +PYIFED +W  FFW        S   QDKT P+A+ L+N   +LLF PDFTV++ +++GP+  E+   I+SC+YIWE GVGF+ S    +  +  RTE+LKLLLTCFS  MY  P Q   EPN WI YFTS +N+H LPLFTS LN V SYDPVG+G+PYNHL+F+D  EPLVE  +Q+L +TL+       Q            ++  + S DE N  D                     N FIN++SR+H+D DF F+L+G +RLLNNPL   YLPNS K++  HQELLIL W++C+ NK F++ VLK   +++IL+PILYHLN +R D +R+G+MHIGVFILLLLSGERNFGV+LNK Y   V +D+PVFTGTHADLL+ VFHKII TGH RLQPL+DC LT++VNVSPYLK+LSMV+S K+LHL+EAFS+PWFL S+P+NHHL+FFLLE+ NNIIQYQFDGNSN++Y++IRKR +FH ++++  D A I++ LS +
Sbjct:    1 MGNTDSKLNFRKAIVQLTQKNQKIDPSDEQFWEQFWQGHQTTLEDVFALVTSSEIRQIRNENPANLATLCYKAVEKLAQAVDSSCRTQAEQQCVLNCVRLLVRCLPYIFEDEKWRDFFW-------SSLPSQDKTMPLAQSLLNATCDLLFCPDFTVTATRRAGPEKAEELANIDSCEYIWEAGVGFAQSPPHNAHMERRRTELLKLLLTCFSEPMYRSPQQS-EEPNKWIAYFTSADNRHALPLFTSFLNTVCSYDPVGFGVPYNHLLFADTTEPLVEACLQLLIVTLDHDMVVQQQL-----------TQPGQASYDEGNCGD---------------------NLFINYLSRVHRDEDFHFVLKGITRLLNNPLVQNYLPNSTKRLHCHQELLILFWKICDYNKKFLYFVLKSSDVLDILIPILYHLNYSRADQSRVGLMHIGVFILLLLSGERNFGVRLNKAYSATVPMDIPVFTGTHADLLITVFHKIIATGHQRLQPLFDCLLTILVNVSPYLKTLSMVASVKMLHLLEAFSTPWFLLSAPSNHHLVFFLLEIFNNIIQYQFDGNSNLVYTIIRKRHVFHAMANLPTDMAGIAKCLSGR 565          

HSP 2 Score: 211.46 bits (537), Expect = 1.064e-56
Identity = 94/114 (82.46%), Postives = 102/114 (89.47%), Query Frame = 1
Query: 2230 GDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
             D W PTPEW  SW+ KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTY+WGVIYLRN++P IWYDT ++LFEIQRV
Sbjct:  724 SDRWTPTPEWIVSWRSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTTAWFRTYIWGVIYLRNVEPAIWYDTEVKLFEIQRV 837          
BLAST of Protein HID1 vs. Ensembl Zebrafish
Match: hid1b (HID1 domain containing b [Source:ZFIN;Acc:ZDB-GENE-040718-239])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 453/830 (54.58%), Postives = 585/830 (70.48%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWF---PFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKI--AVMIPAPVSGNSPSGSFYTP-QTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIG--------DEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ +SKL +RKAVIQLTTKT+PV+ S + FWDQFWN+ +   QDIF L+PAAEIRA+REESP+NL+ LC KA+++++  ++  C+  +++ T+L C R+LTRI+PYIFED +W+ FFW       +  +  E++   P+AE L++ +S+LLF PDFTV S  K+  D   D Q I+SC++IWE GVGF+ +       DSNRTE+LKLLLTCFS  MY  P   H   NPW+ +F SR N+H LPLFTSLLNVV +YDP+GYG+PYNHLMFSD R  L E+A+Q L I                       S E+E +    N+    ++     +TT        EN F+N++SRIH++ DF+FILRG SRLLNNPL  TYLP+S KKIQFHQELL+L W++C++NK F+F+VLK   +++ILVP+L++LNDAR + +R+G++HIGVFILLLLSGERNFGV+LNK Y  RV +D+ VF GTHADLL++VFHKIIT+GH RLQPLYDC LT+IVNVSPYLKSLSMV++ K+LHL+E FSSPWFLFS+P +HHL+FFLLEV NNIIQYQFDGNSN++Y +IRKR +FH L+++  D   I +AL +K  R+  I  AV +      +S   S  TP QT     S +           S V        ++ + S +   D S     +    ++ ++  NS ++ C G         +W PTP+W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI++FLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWG+IYLRN+DPP+WYDT+++LFEIQRV
Sbjct:    1 MGNSDSKLRFRKAVIQLTTKTQPVEASEDVFWDQFWNDIDLMAQDIFTLVPAAEIRAVREESPSNLATLCYKAVERLVLNADTGCVCERDRQTVLICTRLLTRILPYIFEDPDWHGFFWSTVPKLGKSVDEGEEECTRPLAESLLSAVSDLLFCPDFTVESNFKTSADI--DIQSIDSCEFIWEAGVGFAQTPPLNYSHDSNRTELLKLLLTCFSEEMYQSPSDTHTL-NPWVSFFCSRENRHALPLFTSLLNVVCAYDPIGYGVPYNHLMFSDQRGELAELALQTLII-----------------------SLEQELNDTHPNTHTTADTDYNRNNTTEACPTSRGENLFVNYLSRIHREEDFNFILRGISRLLNNPLMQTYLPHSCKKIQFHQELLVLFWKLCDLNKKFLFYVLKSSDVLDILVPVLFYLNDARANQSRVGLVHIGVFILLLLSGERNFGVRLNKPYSVRVPMDITVFAGTHADLLIVVFHKIITSGHQRLQPLYDCLLTIIVNVSPYLKSLSMVAANKLLHLLEVFSSPWFLFSTPVHHHLVFFLLEVFNNIIQYQFDGNSNLVYGIIRKRSLFHQLANLPTDITLIQKALQRKKSRSNSIHNAVFMEISNPYSSEGLSKTTPAQTGTLNASLKDIPRIDKLTETSQVSEDGTTLLIQHSESARSQSDHSSETRVQHNEPTSGEEDKNSANEDCDGSQKSASSSSDWAPTPDWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANEGTALWFRTYMWGIIYLRNVDPPVWYDTDVKLFEIQRV 804          
BLAST of Protein HID1 vs. Ensembl Zebrafish
Match: hid1a (HID1 domain containing a [Source:ZFIN;Acc:ZDB-GENE-030131-8263])

HSP 1 Score: 209.534 bits (532), Expect = 7.274e-62
Identity = 94/111 (84.68%), Postives = 102/111 (91.89%), Query Frame = 1
Query: 2239 WMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            W P P+W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQR+
Sbjct:   96 WNPKPDWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLRNVDPPIWYDTDVRLFEIQRM 206          
BLAST of Protein HID1 vs. Ensembl Zebrafish
Match: hid1a (HID1 domain containing a [Source:ZFIN;Acc:ZDB-GENE-030131-8263])

HSP 1 Score: 195.667 bits (496), Expect = 2.897e-58
Identity = 90/102 (88.24%), Postives = 97/102 (95.10%), Query Frame = 1
Query: 2266 SWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQR+
Sbjct:    4 SWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLRNVDPPIWYDTDVRLFEIQRM 105          
BLAST of Protein HID1 vs. Ensembl Xenopus
Match: p3h4 (prolyl 3-hydroxylase family member 4 (non-enzymatic) [Source:Xenbase;Acc:XB-GENE-1007100])

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 461/847 (54.43%), Postives = 591/847 (69.78%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPF-----NQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPD-QGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEG--PENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFN----------SKSQQCIGD-------------EWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ ++KLN+RKAVIQLTTKT+PV+ +++ FWDQFW +  T++QD+F LIPAAEIRA+REESP+NL+ LC KA++K+++ ++  C + K++  +LNC R+LTR++PYIFED +W  FFW        +Q+ E  E+    P+AE L+  I++LLF P+FTV S +KSG D  ED   ++SC+YIWE GVGF+ S       D NRTE+LKLLLTCFS  MY+ P  +  N  NPW+ +F S  N+H LPLFTSLLNVV +YDPVGYG+PYNHL+F D REPLVEV+ Q+L +                             + D + ++    S +   ++T+  + E   P+N F+N++SRIH++ DF FIL+G +RLL NPLS TYLPNS+KKI FHQELL+L W++C+ NK F+F VLK   +++ILVPILY LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y     +D+PVFTGTHADLL++VFHKIIT+GH RLQPLYDC LT+IVNVSPYLKSLSMV+S K+LHL+EAFSS WFLFSSP NHHL+FFLLEV NNIIQYQFDGNS+++Y++IRKR +F  L+++ +D++SI  AL +K K    I+         NS  G+      P +P                  E G LKASL  TP ++   +KS+ +   T      +   +          S ++   G+             +W PT +W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:    1 MGNTDTKLNFRKAVIQLTTKTQPVEATDDVFWDQFWTDSSTSVQDVFALIPAAEIRAVREESPSNLATLCYKAVEKLVAGADNGCHSDKQKQVVLNCARLLTRVLPYIFEDPDWRGFFWSSVPGAGRSQEDEEEEEDGSRPLAESLLLAIADLLFCPEFTVQSHRKSGTDTTEDIHTLDSCEYIWEAGVGFAHSPPLNQTHDLNRTELLKLLLTCFSEAMYLPPSPESSNTSNPWVQFFCSTENRHALPLFTSLLNVVCAYDPVGYGIPYNHLLFWDSREPLVEVSAQLLIV-----------------------------TLDSDLTVTSSPSMDGTTTSTAMDETESPPPDNLFVNYLSRIHREEDFQFILKGLARLLLNPLSQTYLPNSIKKINFHQELLVLFWKLCDYNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSVPFPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLYDCLLTIIVNVSPYLKSLSMVASNKLLHLLEAFSSTWFLFSSPQNHHLVFFLLEVFNNIIQYQFDGNSSLVYAIIRKRAVFQQLANLPSDTSSIQHALQRKKKPVEPIS-------RTNSQDGASMEGSRPAAP-----------------AEPGTLKASLVATPGIEKLTEKSQVSEDGTLRAVDPEVPLSPGETSPAHPQSDTESHSGENVQKRRRSSSSLSQWNPTTDWVMSWKVKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLRNMDPPIWYDTDVKLFEIQRV 794          
BLAST of Protein HID1 vs. Ensembl Xenopus
Match: p3h4 (prolyl 3-hydroxylase family member 4 (non-enzymatic) [Source:Xenbase;Acc:XB-GENE-1007100])

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 459/850 (54.00%), Postives = 587/850 (69.06%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPF-----NQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPD-QGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYE--GPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFN--------------SKSQQCIGDEW-------MPTPEWA-----QSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ ++KLN+RKAVIQLTTKT+PV+ +++ FWDQFW +  T++QD+F LIPAAEIRA+REESP+NL+ LC KA++K+++ ++  C + K++  +LNC R+LTR++PYIFED +W  FFW        +Q+ E  E+    P+AE L+  I++LLF P+FTV S +KSG     D   ++SC+YIWE GVGF+ S       D NRTE+LKLLLTCFS  MY+ P  +  N  NPW+ +F S  N+H LPLFTSLLNVV +YDPVGYG+PYNHL+F D REPLVEV+ Q+L +                             + D + ++    S +   ++T+  + E   P+N F+N++SRIH++ DF FIL+G +RLL NPLS TYLPNS+KKI FHQELL+L W++C+ NK F+F VLK   +++ILVPILY LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y     +D+PVFTGTHADLL++VFHKIIT+GH RLQPLYDC LT+IVNVSPYLKSLSMV+S K+LHL+EAFSS WFLFSSP NHHL+FFLLEV NNIIQYQFDGNS+++Y++IRKR +F  L+++ +D++SI  AL +K K    I+         NS  G+      P +P                  E G LKASL  TP ++   +KS+ +   T      +   +              S S   +G  W       M +  +A      SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:    1 MGNTDTKLNFRKAVIQLTTKTQPVEATDDVFWDQFWTDSSTSVQDVFALIPAAEIRAVREESPSNLATLCYKAVEKLVAGADNGCHSDKQKQVVLNCARLLTRVLPYIFEDPDWRGFFWSSVPGAGRSQEDEEEEEDGSRPLAESLLLAIADLLFCPEFTVQSHRKSG----TDIHTLDSCEYIWEAGVGFAHSPPLNQTHDLNRTELLKLLLTCFSEAMYLPPSPESSNTSNPWVQFFCSTENRHALPLFTSLLNVVCAYDPVGYGIPYNHLLFWDSREPLVEVSAQLLIV-----------------------------TLDSDLTVTSSPSMDGTTTSTAMDETEVPPPDNLFVNYLSRIHREEDFQFILKGLARLLLNPLSQTYLPNSIKKINFHQELLVLFWKLCDYNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSVPFPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLYDCLLTIIVNVSPYLKSLSMVASNKLLHLLEAFSSTWFLFSSPQNHHLVFFLLEVFNNIIQYQFDGNSSLVYAIIRKRAVFQQLANLPSDTSSIQHALQRKKKPVEPIS-------RTNSQDGASMEGSRPAAP-----------------AEPGTLKASLVATPGIEKLTEKSQVSEDGTLRAVDPEVPLSPGETSPAHPQSDTESHSGVRVGAHWECCIGMIMYSNFFAFFPQVMSWKVKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLRNMDPPIWYDTDVKLFEIQRV 793          
BLAST of Protein HID1 vs. Ensembl Xenopus
Match: p3h4 (prolyl 3-hydroxylase family member 4 (non-enzymatic) [Source:Xenbase;Acc:XB-GENE-1007100])

HSP 1 Score: 893.649 bits (2308), Expect = 0.000e+0
Identity = 445/826 (53.87%), Postives = 570/826 (69.01%), Query Frame = 1
Query:  187 EPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKT-PVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPD-QGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEG--PENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFN--------------SKSQQCIGD-------------EWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            +PV+ +++ FWDQFW +  T++QD+F LIPAAEIRA+REESP+NL+ LC KA++K+++ ++  C + K++  +LNC R+LTR++PYIFED +W  FFW          E++D + P+AE L+  I++LLF P+FTV S +KSG D  ED   ++SC+YIWE GVGF+ S       D NRTE+LKLLLTCFS  MY+ P  +  N  NPW+ +F S  N+H LPLFTSLLNVV +YDPVGYG+PYNHL+F D REPLVEV+ Q+L +                             + D + ++    S +   ++T+  + E   P+N F+N++SRIH++ DF FIL+G +RLL NPLS TYLPNS+KKI FHQELL+L W++C+ NK F+F VLK   +++ILVPILY LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y     +D+PVFTGTHADLL++VFHKIIT+GH RLQPLYDC LT+IVNVSPYLKSLSMV+S K+LHL+EAFSS WFLFSSP NHHL+FFLLEV NNIIQYQFDGNS+++Y++IRKR +F  L+++ +D++SI  AL +K K    I+         NS  G+      P +P                  E G LKASL  TP ++   +KS+ +   T      +   +              S S   +G+             +W PT +W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:   16 KPVEATDDVFWDQFWTDSSTSVQDVFALIPAAEIRAVREESPSNLATLCYKAVEKLVAGADNGCHSDKQKQVVLNCARLLTRVLPYIFEDPDWRGFFWSSVPGAGHEEEEEDGSRPLAESLLLAIADLLFCPEFTVQSHRKSGTDTTEDIHTLDSCEYIWEAGVGFAHSPPLNQTHDLNRTELLKLLLTCFSEAMYLPPSPESSNTSNPWVQFFCSTENRHALPLFTSLLNVVCAYDPVGYGIPYNHLLFWDSREPLVEVSAQLLIV-----------------------------TLDSDLTVTSSPSMDGTTTSTAMDETESPPPDNLFVNYLSRIHREEDFQFILKGLARLLLNPLSQTYLPNSIKKINFHQELLVLFWKLCDYNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSVPFPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLYDCLLTIIVNVSPYLKSLSMVASNKLLHLLEAFSSTWFLFSSPQNHHLVFFLLEVFNNIIQYQFDGNSSLVYAIIRKRAVFQQLANLPSDTSSIQHALQRKKKPVEPIS-------RTNSQDGASMEGSRPAAP-----------------AEPGTLKASLVATPGIEKLTEKSQVSEDGTLRAVDPEVPLSPGETSPAHPQSDTESHSGVRVGENVQKRRRSSSSLSQWNPTTDWVMSWKVKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLRNMDPPIWYDTDVKLFEIQRV 788          
BLAST of Protein HID1 vs. Ensembl Xenopus
Match: p3h4 (prolyl 3-hydroxylase family member 4 (non-enzymatic) [Source:Xenbase;Acc:XB-GENE-1007100])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 444/827 (53.69%), Postives = 570/827 (68.92%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPF-----NQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPD-QGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEG--PENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFN----------SKSQQCIGD-------------EWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLR 2511
            MG+ ++KLN+RKAVIQLTTKT+PV+ +++ FWDQFW +  T++QD+F LIPAAEIRA+REESP+NL+ LC KA++K+++ ++  C + K++  +LNC R+LTR++PYIFED +W  FFW        +Q+ E  E+    P+AE L+  I++LLF P+FTV S +KSG D  ED   ++SC+YIWE GVGF+ S       D NRTE+LKLLLTCFS  MY+ P  +  N  NPW+ +F S  N+H LPLFTSLLNVV +YDPVGYG+PYNHL+F D REPLVEV+ Q+L +                             + D + ++    S +   ++T+  + E   P+N F+N++SRIH++ DF FIL+G +RLL NPLS TYLPNS+KKI FHQELL+L W++C+ NK F+F VLK   +++ILVPILY LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y     +D+PVFTGTHADLL++VFHKIIT+GH RLQPLYDC LT+IVNVSPYLKSLSMV+S K+LHL+EAFSS WFLFSSP NHHL+FFLLEV NNIIQYQFDGNS+++Y++IRKR +F  L+++ +D++SI  AL +K K    I+         NS  G+      P +P                  E G LKASL  TP ++   +KS+ +   T      +   +          S ++   G+             +W PT +W  SWK KLPLQTIMRLLQVLVPQVEKICIDKG TDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLR
Sbjct:    1 MGNTDTKLNFRKAVIQLTTKTQPVEATDDVFWDQFWTDSSTSVQDVFALIPAAEIRAVREESPSNLATLCYKAVEKLVAGADNGCHSDKQKQVVLNCARLLTRVLPYIFEDPDWRGFFWSSVPGAGRSQEDEEEEEDGSRPLAESLLLAIADLLFCPEFTVQSHRKSGTDTTEDIHTLDSCEYIWEAGVGFAHSPPLNQTHDLNRTELLKLLLTCFSEAMYLPPSPESSNTSNPWVQFFCSTENRHALPLFTSLLNVVCAYDPVGYGIPYNHLLFWDSREPLVEVSAQLLIV-----------------------------TLDSDLTVTSSPSMDGTTTSTAMDETESPPPDNLFVNYLSRIHREEDFQFILKGLARLLLNPLSQTYLPNSIKKINFHQELLVLFWKLCDYNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSVPFPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLYDCLLTIIVNVSPYLKSLSMVASNKLLHLLEAFSSTWFLFSSPQNHHLVFFLLEVFNNIIQYQFDGNSSLVYAIIRKRAVFQQLANLPSDTSSIQHALQRKKKPVEPIS-------RTNSQDGASMEGSRPAAP-----------------AEPGTLKASLVATPGIEKLTEKSQVSEDGTLRAVDPEVPLSPGETSPAHPQSDTESHSGENVQKRRRSSSSLSQWNPTTDWVMSWKVKLPLQTIMRLLQVLVPQVEKICIDKGRTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLR 774          
BLAST of Protein HID1 vs. Ensembl Xenopus
Match: p3h4 (prolyl 3-hydroxylase family member 4 (non-enzymatic) [Source:Xenbase;Acc:XB-GENE-1007100])

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 421/842 (50.00%), Postives = 539/842 (64.01%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPD-QGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEG--PENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFN----------SKSQQCIGD-------------EWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ ++KLN+RKAVIQLTTKT+PV+ +++ FWDQFW +                                S ++Q + +L  A+ +    + +  N   +  +                     + E  E+    P+AE L+  I++LLF P+FTV S +KSG D  ED   ++SC+YIWE GVGF+ S       D NRTE+LKLLLTCFS  MY+ P  +  N  NPW+ +F S  N+H LPLFTSLLNVV +YDPVGYG+PYNHL+F D REPLVEV+ Q+L +                             + D + ++    S +   ++T+  + E   P+N F+N++SRIH++ DF FIL+G +RLL NPLS TYLPNS+KKI FHQELL+L W++C+ NK F+F VLK   +++ILVPILY LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y     +D+PVFTGTHADLL++VFHKIIT+GH RLQPLYDC LT+IVNVSPYLKSLSMV+S K+LHL+EAFSS WFLFSSP NHHL+FFLLEV NNIIQYQFDGNS+++Y++IRKR +F  L+++ +D++SI  AL +K K    I+         NS  G+      P +P                  E G LKASL  TP ++   +KS+ +   T      +   +          S ++   G+             +W PT +W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:    1 MGNTDTKLNFRKAVIQLTTKTQPVEATDDVFWDQFWTD-------------------------------SSTSVQDVFALIPAAEIRAVREESPSNLATLCYK---------------------EDEEEEEDGSRPLAESLLLAIADLLFCPEFTVQSHRKSGTDTTEDIHTLDSCEYIWEAGVGFAHSPPLNQTHDLNRTELLKLLLTCFSEAMYLPPSPESSNTSNPWVQFFCSTENRHALPLFTSLLNVVCAYDPVGYGIPYNHLLFWDSREPLVEVSAQLLIV-----------------------------TLDSDLTVTSSPSMDGTTTSTAMDETESPPPDNLFVNYLSRIHREEDFQFILKGLARLLLNPLSQTYLPNSIKKINFHQELLVLFWKLCDYNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSVPFPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLYDCLLTIIVNVSPYLKSLSMVASNKLLHLLEAFSSTWFLFSSPQNHHLVFFLLEVFNNIIQYQFDGNSSLVYAIIRKRAVFQQLANLPSDTSSIQHALQRKKKPVEPIS-------RTNSQDGASMEGSRPAAP-----------------AEPGTLKASLVATPGIEKLTEKSQVSEDGTLRAVDPEVPLSPGETSPAHPQSDTESHSGENVQKRRRSSSSLSQWNPTTDWVMSWKVKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLRNMDPPIWYDTDVKLFEIQRV 737          
BLAST of Protein HID1 vs. Ensembl Mouse
Match: Hid1 (HID1 domain containing [Source:MGI Symbol;Acc:MGI:2445087])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 459/840 (54.64%), Postives = 585/840 (69.64%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFW--FPFNQQCESNEDQDKT--PVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVS-GNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSR----SNLXXXXXXXXXXXXFNSKSQ---------------QCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MGS +SKLN+RKAVIQLTTKT+PV+ ++N FWDQFW +  T++QD+F L+PAAEIRA+REESP+NL+ LC KA++K++  +E  C + KE+  +LNC R+LTR++PYIFED +W  FFW   P   +    E++D+   P+AE L+  I++LLF PDFTV + +++  D+ ED   ++SC+YIWE GVGF+ S     I D NR E+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLN V +YDPVGYG+PYNHL+FSDYREPLVE A Q+L +                       + + + +   + ++D   +     +   ++   GPEN F+N++SRIH++ DF FIL+G +RLL+NPL  TYLPNS KKIQFHQELL+L W++C+ NK F+F VLK   +++ILVPILY LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHADLL++VFHKIIT+GH RLQPL+DC LT++VNVSPYLKSLSMV++ K+LHL+EAFS+ WFLFS+  NHHL+FFLLEV NNIIQYQFDGNSN++Y++IRKR +FH L+++  D  SI +AL ++ +         P P+S   S  G+      P +P                  E G LK SL  TP +    +KS+      LR     S      NS S                     +W PT +W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI++FLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:    1 MGSADSKLNFRKAVIQLTTKTQPVEATDNAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLCYKAVEKLVQGAEGGCHSEKEKQVVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGQGEEEDENARPLAESLLLAIADLLFCPDFTVQNHRRNDVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPSPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIV-----------------------TLDHDSATSTSPTVDGTTT----GTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSVRVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLFDCLLTIVVNVSPYLKSLSMVTANKLLHLLEAFSTTWFLFSASQNHHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRAVFHQLANLPTDPPSIHKALQRRRR--------TPEPLSRTGSQEGTSMEGSRPAAP-----------------AEPGTLKTSLVATPGIDKLTEKSQVSEDGTLRSLEPESQQSSAENSPSDGESSQTWREQRRLSNASASGQWSPTSDWILSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAMWFRTYMWGVIYLRNVDPPIWYDTDVKLFEIQRV 788          
BLAST of Protein HID1 vs. Ensembl Mouse
Match: Hid1 (HID1 domain containing [Source:MGI Symbol;Acc:MGI:2445087])

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 458/839 (54.59%), Postives = 583/839 (69.49%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPF---NQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVS-GNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSR----SNLXXXXXXXXXXXXFNSKSQ---------------QCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MGS +SKLN+RKAVIQLTTKT+PV+ ++N FWDQFW +  T++QD+F L+PAAEIRA+REESP+NL+ LC KA++K++  +E  C + KE+  +LNC R+LTR++PYIFED +W  FFW       +     ED++  P+AE L+  I++LLF PDFTV + +++  D+ ED   ++SC+YIWE GVGF+ S     I D NR E+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLN V +YDPVGYG+PYNHL+FSDYREPLVE A Q+L +                       + + + +   + ++D   +     +   ++   GPEN F+N++SRIH++ DF FIL+G +RLL+NPL  TYLPNS KKIQFHQELL+L W++C+ NK F+F VLK   +++ILVPILY LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHADLL++VFHKIIT+GH RLQPL+DC LT++VNVSPYLKSLSMV++ K+LHL+EAFS+ WFLFS+  NHHL+FFLLEV NNIIQYQFDGNSN++Y++IRKR +FH L+++  D  SI +AL ++ +         P P+S   S  G+      P +P                  E G LK SL  TP +    +KS+      LR     S      NS S                     +W PT +W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI++FLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:    1 MGSADSKLNFRKAVIQLTTKTQPVEATDNAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLCYKAVEKLVQGAEGGCHSEKEKQVVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGGEEEDENARPLAESLLLAIADLLFCPDFTVQNHRRNDVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPSPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIV-----------------------TLDHDSATSTSPTVDGTTT----GTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSVRVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLFDCLLTIVVNVSPYLKSLSMVTANKLLHLLEAFSTTWFLFSASQNHHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRAVFHQLANLPTDPPSIHKALQRRRR--------TPEPLSRTGSQEGTSMEGSRPAAP-----------------AEPGTLKTSLVATPGIDKLTEKSQVSEDGTLRSLEPESQQSSAENSPSDGESSQTWREQRRLSNASASGQWSPTSDWILSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAMWFRTYMWGVIYLRNVDPPIWYDTDVKLFEIQRV 787          
BLAST of Protein HID1 vs. Ensembl Mouse
Match: Hid1 (HID1 domain containing [Source:MGI Symbol;Acc:MGI:2445087])

HSP 1 Score: 237.654 bits (605), Expect = 4.649e-71
Identity = 117/255 (45.88%), Postives = 161/255 (63.14%), Query Frame = 1
Query:  511 EDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNS 1275
            ED++  P+AE L+  I++LLF PDFTV + +++  D+ ED   ++SC+YIWE GVGF+ S     I D NR E+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLN V +YDPVGYG+PYNHL+FSDYREPLVE A Q+L +                       + + + +   + ++D   +     +   ++   GPEN F+N++SRIH++ DF FIL+G +RLL+NPL  TYLPNS
Sbjct:   46 EDENARPLAESLLLAIADLLFCPDFTVQNHRRNDVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPSPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIV-----------------------TLDHDSATSTSPTVDGTTT----GTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPNS 273          
BLAST of Protein HID1 vs. UniProt/SwissProt
Match: sp|Q8R1F6|HID1_MOUSE (Protein HID1 OS=Mus musculus OX=10090 GN=Hid1 PE=1 SV=1)

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 459/840 (54.64%), Postives = 585/840 (69.64%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFW--FPFNQQCESNEDQDKT--PVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVS-GNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSR----SNLXXXXXXXXXXXXFNSKSQ---------------QCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MGS +SKLN+RKAVIQLTTKT+PV+ ++N FWDQFW +  T++QD+F L+PAAEIRA+REESP+NL+ LC KA++K++  +E  C + KE+  +LNC R+LTR++PYIFED +W  FFW   P   +    E++D+   P+AE L+  I++LLF PDFTV + +++  D+ ED   ++SC+YIWE GVGF+ S     I D NR E+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLN V +YDPVGYG+PYNHL+FSDYREPLVE A Q+L +                       + + + +   + ++D   +     +   ++   GPEN F+N++SRIH++ DF FIL+G +RLL+NPL  TYLPNS KKIQFHQELL+L W++C+ NK F+F VLK   +++ILVPILY LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHADLL++VFHKIIT+GH RLQPL+DC LT++VNVSPYLKSLSMV++ K+LHL+EAFS+ WFLFS+  NHHL+FFLLEV NNIIQYQFDGNSN++Y++IRKR +FH L+++  D  SI +AL ++ +         P P+S   S  G+      P +P                  E G LK SL  TP +    +KS+      LR     S      NS S                     +W PT +W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI++FLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:    1 MGSADSKLNFRKAVIQLTTKTQPVEATDNAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLCYKAVEKLVQGAEGGCHSEKEKQVVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGQGEEEDENARPLAESLLLAIADLLFCPDFTVQNHRRNDVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPSPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIV-----------------------TLDHDSATSTSPTVDGTTT----GTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSVRVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLFDCLLTIVVNVSPYLKSLSMVTANKLLHLLEAFSTTWFLFSASQNHHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRAVFHQLANLPTDPPSIHKALQRRRR--------TPEPLSRTGSQEGTSMEGSRPAAP-----------------AEPGTLKTSLVATPGIDKLTEKSQVSEDGTLRSLEPESQQSSAENSPSDGESSQTWREQRRLSNASASGQWSPTSDWILSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAMWFRTYMWGVIYLRNVDPPIWYDTDVKLFEIQRV 788          
BLAST of Protein HID1 vs. UniProt/SwissProt
Match: sp|Q8IV36|HID1_HUMAN (Protein HID1 OS=Homo sapiens OX=9606 GN=HID1 PE=1 SV=1)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 457/846 (54.02%), Postives = 588/846 (69.50%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFW--FPFNQQCESNEDQDK--TPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVS-GNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGD-------------------------EWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MGS +SKLN+RKAVIQLTTKT+PV+ +++ FWDQFW +  T++QD+F L+PAAEIRA+REESP+NL+ LC KA++K++  +E+ C + KE+  +LNC R+LTR++PYIFED +W  FFW   P   +    E+ D+   P+AE L+  I++LLF PDFTV S ++S  D+ ED   ++SC+YIWE GVGF+ S     I D NR E+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLN V +YDPVGYG+PYNHL+FSDYREPLVE A Q+L +                       + + + +   + ++D   +     +   ++   GPEN F+N++SRIH++ DF FIL+G +RLL+NPL  TYLPNS KKIQFHQELL+L W++C+ NK F+F VLK   +++ILVPIL+ LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHADLL++VFHKIIT+GH RLQPL+DC LT++VNVSPYLKSLSMV++ K+LHL+EAFS+ WFLFS+  NHHL+FFLLEV NNIIQYQFDGNSN++Y++IRKR IFH L+++  D  +I +AL ++ +         P P+S   S  G+      P +P                  E G LK SL  TP +    +KS+ +         +  +   + QQ + D                         +W PTPEW  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI++FLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPP+WYDT+++LFEIQRV
Sbjct:    1 MGSTDSKLNFRKAVIQLTTKTQPVEATDDAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLCYKAVEKLVQGAESGCHSEKEKQIVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGQGEEDDEHARPLAESLLLAIADLLFCPDFTVQSHRRSTVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPAPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIV-----------------------TLDHDSASSASPTVDGTTT----GTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILFFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSIRVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLFDCLLTIVVNVSPYLKSLSMVTANKLLHLLEAFSTTWFLFSAAQNHHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRSIFHQLANLPTDPPTIHKALQRRRR--------TPEPLSRTGSQEGTSMEGSRPAAP-----------------AEPGTLKTSLVATPGIDKLTEKSQVS------EDGTLRSLEPEPQQSLEDGSPAKGEPSQAWREQRRPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAMWFRTYMWGVIYLRNVDPPVWYDTDVKLFEIQRV 788          
BLAST of Protein HID1 vs. UniProt/SwissProt
Match: sp|Q54JJ6|HID1_DICDI (Protein HID1 OS=Dictyostelium discoideum OX=44689 GN=hid1 PE=3 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.600e-71
Identity = 156/500 (31.20%), Postives = 264/500 (52.80%), Query Frame = 1
Query:  520 DKTPVAEQLMNCISNLLFYPDFTVS---SLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQD-SNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGP------ENFFINFMSRIHKDNDFDFILRGFSRLLNNPL--SHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVS 1983
            D TP+A +LM+ + +LLF+P FTV+    LK     +P+    +    + W  G G        + Q   NR  +L+ L+TC S  +Y+  D      + W+ + T     +   L  SL+N   ++DP+G+G+PYNHLM+SD  E   +++IQIL + L                          Y   ENN    +      +      Q +         N FI ++  + +  DF F    F R++N PL  SHT LPNS KKI+ HQ+L   +W     N +F+  ++  ++  E L+P+L ++++ R      G++ IG FILLLLSGER+F + LNK +  R++ID+      ++D ++ V ++++     RL+ +Y+C LT++ N+SPY+K+LSMV+  K++ L E  S+P FLF++  N+  + FLLE LNN++Q+Q++ N+ +IY+++R +  F  L+ +K    + S+ + +         +  P+P+S
Sbjct:  217 DTTPLAVKLMDSLLDLLFFPGFTVTESLGLKSPKEASPDAIPVL----FSWAGGFGVDSVPTVHNKQFWINRLSVLQCLITCLSEQLYVPQDSVSTFKSKWLDWITHTQEYYTEALLFSLINTFATFDPIGWGIPYNHLMYSDDHEICSKLSIQILNVLLT-------------------------YDPIENNDQQPQQQHHHHQQQHHQQQQQQQQSTIECRNKFIQYIKTLKRVRDFKFFFNAFERIMNVPLIASHTKLPNSTKKIELHQDLTYTMWLFLSYNHDFLRSIVNYENSPEFLIPLLQYMDEGRKSQTTHGIVQIGTFILLLLSGERDFSISLNKPFVGRIHIDIQQ-PQVYSDFVITVMYRLLVDTPDRLESIYECVLTILSNLSPYMKNLSMVTCVKLMKLFEYLSTPRFLFATNHNYRYVGFLLESLNNLLQHQYESNTRLIYAILRCQNQFSKLAYLKISPVTPSKPMEQ---------ITQPSPIS 677          

HSP 2 Score: 108.227 bits (269), Expect = 1.231e-22
Identity = 47/110 (42.73%), Postives = 74/110 (67.27%), Query Frame = 1
Query: 2239 WMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQR 2568
            +MPT EW Q  K++LPL  I++++  L PQ++ +C   G +DE +I+ +L+  T+VG+   P PI+ R+Y SN  T  WF  YMW +IYL N  PP++  TNI+LF++++
Sbjct:  797 FMPTDEWLQDIKKQLPLDNILKVITHLSPQIQGLCTGSG-SDEQKIMDYLKMSTIVGIFHNPGPIMTRRYHSNAITKSWFIAYMWCIIYLENHSPPLFLHTNIKLFQVKQ 905          
BLAST of Protein HID1 vs. UniProt/SwissProt
Match: sp|Q9P7M6|YIOC_SCHPO (Hid-1 family protein P27G11.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAP27G11.12 PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.467e-42
Identity = 150/608 (24.67%), Postives = 281/608 (46.22%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCS------KAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEI----NKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHR----VNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADS 1905
            MGS+ SKL++R AV++L    E   P  +  W++ W   ETT +D+F L+   ++  +++ +P NL  + +      + +QK     + +  TTK     LNC+R+LTR++P IFED   +   WF +       +    TP     +N + + LF  +FT+       P + + T  ++ C  IWE GV +  ++      + +R E+L+LLL+ FS  +Y R D   +    ++    +R    CL   +SL+N    ++ + +   +  L  S     L+E    +L I +                           S++ NN     N+   +K+T        P+N+F   +S++   +DF  IL G SRLL  P+  T +P     I F    L+L++  C++    N+ F  +++  D  +++ + +LY   +   DP+    + + V +L  L+ E+ F  +LNK +Q +    +++ VP   GT+AD  ++    ++         +       +  +  Y ++L+  SS  +  L ++ S P FL S+  NH ++ +++  +NN IQY    N+ ++Y     +     +S++  D+
Sbjct:    1 MGSQQSKLDFRNAVLRL--HEERNIPKFDLIWERLWTLPETT-EDVFHLMSIDDLTKVKDNAPENLQTIIAVLWDKLEDLQKETLFDDPAAPTTK---CALNCMRLLTRLMPIIFEDK--SMLEWFDYFAWTVPKDPNINTPRGASFLNTVVDYLFLINFTI-------PAHNDLTHGVHYC--IWETGVVYHPTMLKERSYELHRVEVLRLLLSLFSEEIY-RTDGNGSSCCAYVASIANRRLVLCL--LSSLINTAMRFNTMFWKPEFLPLDNSVAHMSLIEYCFSVLLILM---------------------------SEENNNGTPCYNNYRSSKNTL-------PKNYFSILLSKLQPYSDFQIILDGMSRLLYPPMQST-IPKRSSLIMFDYYPLVLIF--CKLFIHYNERFFHYLIDTDRAIDLFIFLLYLSFEYLGDPSTYNHLKLCVILLKRLTAEKYFCKRLNKPFQQQTALPISMPVPFEGGTYADFTIIAISLLVQYTKDYHSEIAQMLCCSLCYLCLYAQNLNSHSSQSLFELFQSASYPGFLISNDVNHKILKYVIGAINNAIQYAQKYNAPLLYFFSMHKDYIEAVSALSFDA 551          
BLAST of Protein HID1 vs. UniProt/SwissProt
Match: sp|O13776|FT105_SCHPO (Ubp5-interacting protein ftp105 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ftp105 PE=1 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 1.550e-31
Identity = 121/466 (25.97%), Postives = 214/466 (45.92%), Query Frame = 1
Query:  532 VAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDS-NRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFT-SLLNVVFSYDPVGYGMPYNHLM-FSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLS--HTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNK------VYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIK 1896
            + E+L++ +  LLF   FT+         +PE   +I     IWENG+G + +   T+ + + NR E+L+LLL   S  +Y   +   +     + Y T   NK  + +F  SL+N      P  +   Y+ L+ ++D    L ++  QIL + L                                +    E + E  +   + S     EN +  + SR+    D++F++    RLLN P+S    Y+    K      E+++ LW+    NK F   ++   +  E L  I ++    R D    G++ I +FI+  LS E+    KLN+           +   VP  +  +A+ L++    I     +    L    L  I N++P++++LS V+  K++ L  + SSP FLF +P NH L+ +LL+ +++I++ +F  N N+ YS+IR +Q+F +L+S+K
Sbjct:  216 LMEELLDTVFRLLFCRGFTLPL------SSPEQYAYI-----IWENGIGTTETQEKTTKELAFNRIEVLRLLLVLISKRLYRSSEVASHT----LTYLTCVANKQLILVFLYSLINTTLRLRPDSWKASYSTLVPYNDSSIALSKLTSQILLLFL--------------------------------DHTPHETTVEYFRQRLNLSPGAAIENQYRLYFSRLQLQADYEFLVNELYRLLNAPVSAISAYISIVQKPNIAFPEIILFLWQAILYNKRFRAFLITSPYATEFLTSIQFYALRYREDNEHSGLVRICLFIVHYLSCEKVLCEKLNRNCMNAQSLMSSLGFSVPPMS--YAEFLIISSFHISAVKRSPFSSLSPVILLTICNIAPFVENLSFVTCAKLMQLCSSLSSPRFLFRNPRNHLLLEYLLQAISSIVENKFSQNPNLSYSIIRLQQVFLNLNSMK 632          

HSP 2 Score: 60.077 bits (144), Expect = 1.085e-7
Identity = 36/131 (27.48%), Postives = 65/131 (49.62%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCL---TTKEQHTILNCVRMLTRIIPYIFED---SEWNSFFWFPFNQQ 498
            MG + SKL +++ + +L +  +P  P ++E W   W+  E+   +++   P   IR +R+ +  NL  L      ++ +L          T      LNC+R+LTRIIP++ E     EW+  FW+   ++
Sbjct:    1 MGGQESKLAFQRGIARLAS--QPDIPLDDEVWVSLWSVPESC-PEVYDFFPPGLIREMRDHAFVNLEKLLLVLTSRLFALKNDKKFPNPETAPASEALNCIRLLTRIIPFLNEKLDLEEWHQKFWWSLRKK 128          
BLAST of Protein HID1 vs. TrEMBL
Match: A0A2T7PW10 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00210 PE=4 SV=1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 484/849 (57.01%), Postives = 615/849 (72.44%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRP-DQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAK--IAVMIPAPVSGNSPSGSF----------YTPQTPNSPVXXXXXXXXXXXXX-----------XXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIG---------DEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ ++KLN+RKAVIQLTTKT+P++P++  FW+QFW+E  T +QD+F LIPAAEIRALREESP+NL+ LC KA+++++  +E+ C + +EQ T+LNCVR+LTRI+PYIFED +W  FFW     Q E  E++   P+A+ L+N +S+LLF PDFTV+S +KSGPDNPED   I+SC+YIWE GVGF+ S   +SI D NRTE+LKL LTCFS TMY+ P    H  PN WI YFTS  N+H LPLFTSLLN + SYDPVGYG+PYNHLMFSD REPLVEVA+Q+LC+T+                             D ++S    + T    +   +S   G +N F+N++SRIH++ DF FIL+G +RLLNNPL  TYLP S K+IQFHQELL+L W+MC+INK FMF VLK   +++ILVPILY+LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHAD L++VFHKIITTGH RLQPL+DC LT+IVNVSPYLK+LSMV+STK+LHL+EAFS+PWFLF+SPTNHHL+FFLLEV NNIIQYQFDGNSN++Y++IRKR +FH L+++  D +SI++AL+K+ K+ A   +    P  + G +P+              TP   + P + +  +  + +               D   G   +S +  P L+ +      +     +TS S  + NS S++ +            W+ TPEW QSWKQKLPLQTIMR+LQVLVPQVEKICIDKGLTDE+EI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTY+WGVIYLRN+DPPIWYDTN++LFEIQRV
Sbjct:    1 MGNTDTKLNFRKAVIQLTTKTQPIEPNDEAFWEQFWSESVTCVQDVFTLIPAAEIRALREESPSNLATLCYKAVERLVLAAESGCPSQREQQTVLNCVRLLTRILPYIFEDPDWRGFFWSTLPGQSEEGENESP-PLAQSLLNAVSDLLFCPDFTVTSARKSGPDNPEDMGTIDSCEYIWEAGVGFAHSPSHSSIHDQNRTELLKLCLTCFSETMYLPPVADAHVSPNQWIQYFTSTENRHALPLFTSLLNCLCSYDPVGYGVPYNHLMFSDSREPLVEVALQVLCVTM---------------------------ENDNSSSTVTVDGTSTGTAMDQSSDAGGSDNLFLNYLSRIHREEDFAFILKGITRLLNNPLMQTYLPGSCKRIQFHQELLVLFWKMCDINKKFMFFVLKSSDVLDILVPILYYLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYTVRVPMDIPVFTGTHADFLIIVFHKIITTGHQRLQPLFDCLLTIIVNVSPYLKTLSMVASTKLLHLLEAFSTPWFLFASPTNHHLVFFLLEVFNNIIQYQFDGNSNLVYTIIRKRNVFHQLANLPIDHSSIARALTKRGKKFAPPPMDTREPQTMEGATPAAEAEPGTLKASLAATPHEGHKPPTLKEIAEATGTHSIQPANEIQDPMAPDTAAGGDSSSYK-RPPLEKSNSMPSESPVSPTSTSDSALSENSSSKRLLSRGGSITSQTSSWVATPEWVQSWKQKLPLQTIMRMLQVLVPQVEKICIDKGLTDETEILKFLQHGTLVGLLPVPHPILIRKYQANSGTTMWFRTYLWGVIYLRNVDPPIWYDTNVKLFEIQRV 820          
BLAST of Protein HID1 vs. TrEMBL
Match: A0A267FCG7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014572g1 PE=4 SV=1)

HSP 1 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 493/892 (55.27%), Postives = 622/892 (69.73%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYE------GPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMI----------------------------PAPVSGN---SPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGD---------------------------------------EWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+EN+KLNYRKAVIQLTT+T+PV+ S+N+FWDQFW+E+ETT+QDIFILIPAAEIRALREESP+NL+ LC KA++K++S++E S  T KEQ T LNC+R+LTRI+PYIFE+ +W +FFW P +Q  E +E  +  P+A+ L+  + +LLF PDFTV S KK GP+NPED   I+SC+YIW+ GVGF+ +    +I DS+RTEILKLLLTCFS TMY+   + H +PN WI YFTS  N+H LPLFTSLLN V +YDP+GYG+PYNHLMF+D  EPLVEVA+Q+LC+TL++   S + S  T +   +  +     +   + +     +   A S   ++  +      GP+N F+N+MSR+H++ DF FILRG +RLLNNPL  TYLP S K+I F+QELLIL W+MC+INK FMF+VLK   ++++LVP+LY+LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK YQ RV +D+PVFTGTHADLL++VFHKIITTGH RLQPL+DC LT++VNVSPYLKSLSMVS+ K+LHL+EAFS+PWFLFS+P NHHL+FFLLEV NNIIQYQFDGNS+++Y +IRKR +FH L+S+ +D ASI+ AL+KK+   A +                                PA V  N   S  GS  TP  P  P                    G LK SLE TP+L    ++S ++       ++     +  +     D                                        W+ TP+W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTD+SEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:    1 MGNENTKLNYRKAVIQLTTRTQPVEASDNDFWDQFWSEFETTVQDIFILIPAAEIRALREESPSNLATLCYKAVEKLVSIAETSYHTQKEQQTALNCIRLLTRILPYIFEEPDWITFFWSPQHQSGERDE-ANSPPLAQTLVAALCDLLFCPDFTVQSAKKQGPENPEDLNTIDSCEYIWQAGVGFASTPVRNAIYDSHRTEILKLLLTCFSETMYLPSSEAHTQPNRWIAYFTSTENRHALPLFTSLLNTVCAYDPIGYGVPYNHLMFNDSLEPLVEVALQVLCVTLDSDGSSVTPSPETAAAAASAAAAAAAAATVPSPTSPTPAAAAAAASLLGSTGADLGDLEAGPDNLFVNYMSRVHREEDFAFILRGIARLLNNPLVQTYLPGSCKRIHFYQELLILFWKMCDINKKFMFYVLKSSDILDLLVPVLYYLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYQIRVPMDIPVFTGTHADLLIIVFHKIITTGHQRLQPLFDCLLTIVVNVSPYLKSLSMVSANKLLHLLEAFSTPWFLFSTPGNHHLVFFLLEVFNNIIQYQFDGNSSLVYCIIRKRAVFHQLASLASDHASIAGALAKKATAGASVRKQQQQQQQQQQQQQQQQQQQQQQQQQNSQQHPASVQSNANDSQEGS--TPAAPAEP--------------------GTLKTSLEATPALTNMTERSPADAGADADANSGAAAVDGSTPTASSDGAIATTSATVPKTKPVQQAPPPPATPTPSVTSTASSSTVGWVATPDWVSSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDDSEILKFLQHGTLVGLLPVPHPILIRKYQANAGTTIWFRTYMWGVIYLRNVDPPIWYDTDVRLFEIQRV 869          
BLAST of Protein HID1 vs. TrEMBL
Match: A0A267EC05 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014572g4 PE=4 SV=1)

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 493/892 (55.27%), Postives = 622/892 (69.73%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYE------GPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMI----------------------------PAPVSGN---SPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGD---------------------------------------EWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+EN+KLNYRKAVIQLTT+T+PV+ S+N+FWDQFW+E+ETT+QDIFILIPAAEIRALREESP+NL+ LC KA++K++S++E S  T KEQ T LNC+R+LTRI+PYIFE+ +W +FFW P +Q  E +E  +  P+A+ L+  + +LLF PDFTV S KK GP+NPED   I+SC+YIW+ GVGF+ +    +I DS+RTEILKLLLTCFS TMY+   + H +PN WI YFTS  N+H LPLFTSLLN V +YDP+GYG+PYNHLMF+D  EPLVEVA+Q+LC+TL++   S + S  T +   +  +     +   + +     +   A S   ++  +      GP+N F+N+MSR+H++ DF FILRG +RLLNNPL  TYLP S K+I F+QELLIL W+MC+INK FMF+VLK   ++++LVP+LY+LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK YQ RV +D+PVFTGTHADLL++VFHKIITTGH RLQPL+DC LT++VNVSPYLKSLSMVS+ K+LHL+EAFS+PWFLFS+P NHHL+FFLLEV NNIIQYQFDGNS+++Y +IRKR +FH L+S+ +D ASI+ AL+KK+   A +                                PA V  N   S  GS  TP  P  P                    G LK SLE TP+L    ++S ++       ++     +  +     D                                        W+ TP+W  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTD+SEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:    1 MGNENTKLNYRKAVIQLTTRTQPVEASDNDFWDQFWSEFETTVQDIFILIPAAEIRALREESPSNLATLCYKAVEKLVSIAETSYHTQKEQQTALNCIRLLTRILPYIFEEPDWITFFWSPQHQSGERDE-ANSPPLAQTLVAALCDLLFCPDFTVQSAKKQGPENPEDLNTIDSCEYIWQAGVGFASTPVRNAIYDSHRTEILKLLLTCFSETMYLPSSEAHTQPNRWIAYFTSTENRHALPLFTSLLNTVCAYDPIGYGVPYNHLMFNDSLEPLVEVALQVLCVTLDSDGSSVTPSPETAAAAASAAAAAAAAATVPSPTSPTPAAAAAAASLLGSTGADLGDLEAGPDNLFVNYMSRVHREEDFAFILRGIARLLNNPLVQTYLPGSCKRIHFYQELLILFWKMCDINKKFMFYVLKSSDILDLLVPVLYYLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYQIRVPMDIPVFTGTHADLLIIVFHKIITTGHQRLQPLFDCLLTIVVNVSPYLKSLSMVSANKLLHLLEAFSTPWFLFSTPGNHHLVFFLLEVFNNIIQYQFDGNSSLVYCIIRKRAVFHQLASLASDHASIAGALAKKATAGASVRKQQQQQQQQQQQQQQQQQQQQQQQQQNSQQHPASVQSNANDSQEGS--TPAAPAEP--------------------GTLKTSLEATPALTNMTERSLADAGADADANSGAAAVDGSTPTASSDGAIATTSATVPKTKPVQQAPPPPATPTPSVTSTASSSTVGWVATPDWVSSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDDSEILKFLQHGTLVGLLPVPHPILIRKYQANAGTTIWFRTYMWGVIYLRNVDPPIWYDTDVRLFEIQRV 869          
BLAST of Protein HID1 vs. TrEMBL
Match: R7VDZ0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_157409 PE=4 SV=1)

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 488/853 (57.21%), Postives = 609/853 (71.40%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESN-----EDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRP-DQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAK--------IAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNS------KSQQCIGDE-----------------WMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ ++KLN+RKAVIQLTT+T+PV+P+++ FW+QFW+E  TT+QD+F LIPAAEIRALREESP+NL+ LC KA++K++  +E+ C T +E+ T++NCVR+L RI+PYIFE+ +W  FFW     Q +          D  P+A+ L+N +++LLF P+FTVS  KKSGPDNPED Q I+SC+YIWE GVGF+ S   + I D NRTEILKLLLTCFS TMY+ P    H+  N WI +FTS  N+H LPLFTSLLN+V +YDPVGYG+PYNHLMF+D REPLVE A+Q+LC+TL+                  G     E S   N+SI+             +S   GP+N F+N+MSR+H++ DF FIL+G +RLLNNPL  TYLP S KKI FHQELL+L W+MC+INK FMF+VLK   +++ILVPILY LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y  RV +DVPVFTGTHAD LV+VFHKIITTGH RLQPL+DC LT+IVNVSPYLK+LSMV+STK+LHL+EAFS+PWFL++SPTNHHLIFFLLEV NNIIQYQFDGN+N+IY++IRKR IFH L+++  D  SI++AL+K+ ++ +         I+  +   + G++P+                            + E G LKA+L  TP        SR +   TP   T  D FNS             DE                 ++P+PEW  SWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIY+RN+DPP+WYDT+++LFEIQRV
Sbjct:    1 MGNADTKLNFRKAVIQLTTQTQPVEPNDDSFWNQFWSESVTTVQDVFTLIPAAEIRALREESPSNLATLCYKAVEKLVEAAESGCRTEREKQTVMNCVRLLMRILPYIFEEPDWRGFFWSTLPGQADDGGSAEVSSSDFPPLAQSLVNALTDLLFCPEFTVSPNKKSGPDNPEDVQTIDSCEYIWEAGVGFAHSPPHSHIYDQNRTEILKLLLTCFSETMYLPPIADAHSGRNQWIAFFTSTENRHALPLFTSLLNMVCAYDPVGYGVPYNHLMFADSREPLVECALQVLCVTLDNEP---------------GSGNNPEESPQVNHSIE------------PDSDMGGPDNLFVNYMSRVHREEDFYFILKGLTRLLNNPLMQTYLPGSCKKIHFHQELLVLFWKMCDINKKFMFYVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYTVRVPMDVPVFTGTHADFLVIVFHKIITTGHQRLQPLFDCLLTIIVNVSPYLKTLSMVASTKMLHLLEAFSTPWFLYASPTNHHLIFFLLEVFNNIIQYQFDGNANLIYTIIRKRNIFHQLANVPIDHGSITKALTKRGRKLSSHPAASSLDISSEVQQSMEGSTPAA---------------------------EAEPGTLKATLAATPGKNHL---SRLSCLITPCLLTLFDLFNSGPTPPASPTSSTADESSRPPLRKGMSVSASGGFVPSPEWVSSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANSGTTMWFRTYMWGVIYIRNVDPPVWYDTDVKLFEIQRV 796          
BLAST of Protein HID1 vs. TrEMBL
Match: A0A1B6CIT1 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.42606 PE=4 SV=1)

HSP 1 Score: 969.918 bits (2506), Expect = 0.000e+0
Identity = 470/847 (55.49%), Postives = 592/847 (69.89%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQC------------------------------IG-DEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ ++KLN+RKAV+QLT+KT+P+D SN+ FWDQFW+E  T +QD+F L+PAAEIRALREE+P+NL+ LC KA++K++   ++SC T  EQ T+LNCVR+LTR++PYIFED EW  FFW     Q +S + ++  P+A  L+N I +LLF PDFTV++ KKSGPD  ED Q I+SC+YIWE+GVGF+ S       D+ RTE+LKLLLTCFS TMY  P   H  PN WI Y TS  N+H LP+FTSLLN V +YDPVG G+PYNHL+FSD  EPLV+ A+QIL +                             + D + S+ +E++T              P+N FIN++SR+H+D DF F+LRGF+RLLNNPL  TYLPNS KK+QFHQELL+  W+MC+ NK F+++VLK   ++E+LVPILYHLND+R D +R+G+MHIGVFILLLLSGERNFGV+LNK Y   + +D+PVFTGTHADLL+ VFHKIITTGH RLQPL+DC LT++VNVSPYLK+LSMV+STK+LHL+EAFS+PWFLFSS TNHHL+FFLLE+ NNIIQYQFDGNSN++Y++IRKRQ+FH L+S+  D  +I+++L+K++++       I  P    S  GS   P  P  P                    G LKA+L  TP +     K   ++       T+  + N +S+                                +G   W PT EW  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+++LFEIQRV
Sbjct:    1 MGNADTKLNFRKAVVQLTSKTQPIDASNDSFWDQFWSENVTNVQDVFTLVPAAEIRALREEAPSNLATLCYKAVEKLVKAVDSSCRTQHEQQTVLNCVRLLTRVLPYIFEDPEWRGFFWSSLPDQSQSEDKEESLPLAHSLLNAICDLLFCPDFTVAANKKSGPDKAEDLQAIDSCEYIWESGVGFANSPPHYPAHDTARTELLKLLLTCFSETMYQPPVDLHTAPNKWIQYLTSAENRHALPMFTSLLNTVCAYDPVGLGVPYNHLLFSDSTEPLVDAALQILIV-----------------------------TLDHDTSLGEESAT--------------PDNLFINYLSRVHRDEDFSFVLRGFTRLLNNPLVQTYLPNSTKKVQFHQELLVFFWKMCDYNKKFLYYVLKSSDVLEVLVPILYHLNDSRADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYTATIPMDIPVFTGTHADLLITVFHKIITTGHQRLQPLFDCLLTILVNVSPYLKTLSMVASTKLLHLLEAFSTPWFLFSSQTNHHLVFFLLEIFNNIIQYQFDGNSNLVYTIIRKRQVFHGLASLPCDYGTITKSLTKRTRKHLTSTSSIENPPETPSMEGS--KPALPAEP--------------------GTLKATLPDTPGIDKMTGKESGHVMVDLAEITTPASINGESKSVEEVKPEVSPPVSPQTHKPVLNRANSIPRSPVGPTHWAPTSEWVSSWKTKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANTGTTTWFRTYMWGVIYLRNVDPPIWYDTDVKLFEIQRV 782          
BLAST of Protein HID1 vs. Ensembl Cavefish
Match: HID1 (HID1 domain containing [Source:HGNC Symbol;Acc:HGNC:15736])

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 442/821 (53.84%), Postives = 569/821 (69.31%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGDEWMPTPEWAQ-----SWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ +SKL +RKAVIQLTTKT+PV+ +++ FWDQFW +  TT+QD F L+PAAEIRA+REESP+NL+ LC KA++K++  +E+ C + +E+  +LNC R+LT  +          S  W   +     ++D+   P+AE L+  I++LLF PDFTV S ++ GP++ ED Q ++SC+YIWE GVGF+ S     I D NRTE+L+LLLTCFS  MY+ P    N  NPW+ +F S  N+H LPLFTSL+NVV +YDPVGYG+PYNHL+FSDYRE LVE A+QIL +TL                         E+  ++ +     +S +E  S        GP+N F+N++SRIH++ D+DF+L+G +RLL NPL+ TYLPNS KKIQFHQELL+L W++C+ NK F+F VLK   ++++LVPILY+LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK +   V +D+PVFTGTHADLL++VFHKIIT+GH RLQPLYDC LT++VNVSPYLKSLSMV++ K+LHL+EAFS+ WFLFS+  NHHL+FFLLE  NNIIQYQFDGN N++Y++IRKR +FH L+++  D ASI +AL +K K    I+      +   S  GS   P  P  P                    G LKASL   P +    +KS+ +   T       +T  S     +           +     SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGV+YLRN+DPPIWYDT+++LFEIQR+
Sbjct:    1 MGNTDSKLKFRKAVIQLTTKTQPVEATDDAFWDQFWADTATTVQDTFALVPAAEIRAVREESPSNLATLCYKAVEKLVQAAESGCPSEREKQVVLNCTRILTPGV----------SDGWILMD-----DDDEGARPLAESLLLAIADLLFCPDFTVQSHRRGGPESVEDMQSLDSCEYIWEAGVGFAQSPPLNYIHDLNRTELLRLLLTCFSEAMYLPPSPDGNILNPWVTFFCSTENRHALPLFTSLINVVCAYDPVGYGIPYNHLLFSDYREQLVEQAVQILIVTL-------------------------EHEGNQPHRAPSPSSMDEQDSA-------GPDNLFVNYLSRIHREEDYDFVLKGLARLLTNPLTQTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDVLVPILYYLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPFSLHVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPLYDCLLTIVVNVSPYLKSLSMVAANKLLHLLEAFSTNWFLFSAAQNHHLVFFLLEAFNNIIQYQFDGNCNLVYAIIRKRSVFHQLANLPTDPASIQKALQRKKKSPDAISRT--NSLETVSMEGS--RPAVPAEP--------------------GTLKASLVAIPGIDKLTEKSQVSEDGTMVAVAQTETQRSPEHSGLAGASDTESNSGRDTEVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVVYLRNVDPPIWYDTDVRLFEIQRM 750          
BLAST of Protein HID1 vs. Ensembl Sea Lamprey
Match: hid1b (HID1 domain containing b [Source:ZFIN;Acc:ZDB-GENE-040718-239])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 345/808 (42.70%), Postives = 497/808 (61.51%), Query Frame = 1
Query:  202 SNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWF--PFNQQCESNEDQDKT--PVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEP---NPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENN----SIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKS----------KRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCI-GDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFE 2559
             +  FW  F  E +   QD F+ + A ++RALR+E P+ L  L  KA++K+   +E+ C   +E   +L C+R+LTR++P++FED++W  FFW   P +      ED  K   P+AE L+  I+ LLF P FTV+  ++ GPD PEDT  ++SC++IWE GVG + S   + + D+NR EILKLLLTCFS  +Y    Q  N+P   N W+  F S+ N+H L LFTSLLNVVF+YDPVGYG+PYN+L+  D+REPLVEVA Q+L                         + + E+S   +     SI D  + +++++     ++    N F+ ++S+IH D DF+FIL G  RLLNNPL  TYLP S K+I FHQELL+L W +C+ NKNF+  VLK + ++ I+VPILY+LNDAR D +++G++ IGVFILL+LSGERNFG+ LN     RV + + VF GTHADLL++VFH++IT    +LQ L+DC +T++ NVSP+LKS+S+VS+TK++ L+E FSSP FLF+SP N  L+  LLEV NN+IQYQF+GN +++Y+M+ KR +F+ L+++  D   I     K            ++    A+  P    GNS + +    Q P                    ++T  L +   ++ S+   +  S  +           ++    +  C+    W PTP+W  SWK KLPL TIM+LL VLVPQV+ +C+ +GL DE+EI+++L++G++VGLLPVPH I+  + Q N  T  WF TY W VI  RNIDPPIW D+ I++F+
Sbjct:    8 GDEAFWRPFLGESDAAGQDAFLYVTAGDVRALRDELPSGLCTLIHKAVEKLRVAAESGCADDQEPVVVLTCIRLLTRLLPFVFEDAQWKDFFWAHAPTHHNVNVEEDTSKVTPPLAETLLLAIAELLFCPGFTVAPHRQPGPDTPEDTWPLDSCEFIWEAGVGVNISPPQSYVHDTNRLEILKLLLTCFSEVIY----QSENDPRSCNSWVKLFCSKENRHTLALFTSLLNVVFAYDPVGYGVPYNYLLVRDHREPLVEVACQVLI-----------------------AALDGEHSLPGSPFFGFSIGDIENPQQSRT----QKHLNCSNLFVTYLSKIHNDEDFEFILSGLVRLLNNPLQQTYLPYSTKRIHFHQELLVLFWILCQQNKNFLSFVLKTNDMLGIVVPILYYLNDARDDDSQMGLLSIGVFILLILSGERNFGIHLNNSLSIRVPLGIRVFNGTHADLLIIVFHQMITRSQQKLQNLFDCLMTIVANVSPFLKSMSLVSATKLVQLLEIFSSPHFLFASPHNPKLLLLLLEVFNNVIQYQFNGNCHLVYAMLCKRSVFNRLANLPVDKEFIENTTRKTEAPHGVKKYGFRKFGPKAIFRPKDRPGNSDTLTLNRMQVPT-------------------IKTVHLLSMKSLSGSIVNLVQLSIESKSVENEMKWRVESKFCGTPDCLESTSWKPTPKWVCSWKSKLPLNTIMKLLHVLVPQVKMLCLKRGLEDETEILRYLRQGSMVGLLPVPHRIITHRCQPNKDTAHWFSTYFWSVICNRNIDPPIWLDSKIKMFK 765          
BLAST of Protein HID1 vs. Ensembl Nematostella
Match: EDO48052 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKV1])

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 444/819 (54.21%), Postives = 543/819 (66.30%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPD-QGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGP--ENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG   SKLN+RKAV+QLTTK    +P+++ FWDQFW+E   TI D+F LIPAAEIR LR+E+P+NL+ L                         + CVR+LTR IPYIFED +W  FFW        S E + +TP+A+ L++ +++L F P+FTV   KK+GP+  ED   I+SC+YIWE GVGF+ S  S +  D NR E+LKLLLTCFS  MY+ P  + H  PN W+ YF S  N+H LPLFTS+LN V SYDP+GYG+P      +D++EP+VEVA Q+L + L                        +    D  N I+D+          +N   E P  +N F N++SRIH++ DF FIL G + LLNNPL  TYLPNS KKI FHQELLIL W+MC+ NK F+F+VLK   +++ILVPILYHLNDAR D +RLG+MHIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHAD LV+VFHKIITTGH RLQPL+DC LT+IVNVSPYLKSLSMV++ K+LHL+EAFS+PWFLF++PTNHHL+FFLLE+ NNIIQYQFDGNS ++Y++IRKR IFH L+++  D A+I     +K KR   I  M     S           ++P  PVS                           TP    T  K+                  S S    G  ++ TPEW QSWKQKLPLQTIMR+LQVLVPQVEKICIDKGLTDESEIIKFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWG+IYLRNIDPPIWYDT+++LFEIQRV
Sbjct:    1 MGGTESKLNFRKAVVQLTTKKSAAEPNDDAFWDQFWSESAATISDVFTLIPAAEIRNLRDENPSNLATLSR-----------------------VFCVRLLTRFIPYIFEDPDWRGFFW----STIPSQEPEGQTPLAQTLLDALADLCFCPEFTVHPNKKAGPEQHEDLSSIDSCEYIWEAGVGFATSPPSNAQFDCNRAELLKLLLTCFSEAMYLPPTPENHTRPNKWLCYFASSENRHALPLFTSILNTVCSYDPLGYGVP------TDFKEPMVEVAAQLLVVLL------------------------DHDGGDGQNPINDD---------LANDMMEPPPMDNLFCNYLSRIHREEDFHFILHGLANLLNNPLIQTYLPNSCKKISFHQELLILFWKMCDQNKKFLFYVLKSSDVLDILVPILYHLNDARSDQSRLGLMHIGVFILLLLSGERNFGVRLNKPYAVRVPMDIPVFTGTHADFLVVVFHKIITTGHQRLQPLFDCLLTIIVNVSPYLKSLSMVAANKLLHLLEAFSTPWFLFANPTNHHLVFFLLEIFNNIIQYQFDGNSQLVYAIIRKRNIFHQLANLPTDPATI-----QKPKRKEHIPNMREGEHS-----------RSPEDPVS-------------------------RATPGPSHTQKKAIG---------------RSASVSSTG-AFIATPEWVQSWKQKLPLQTIMRMLQVLVPQVEKICIDKGLTDESEIIKFLQHGTLVGLLPVPHPILIRKYQANSGTQMWFRTYMWGIIYLRNIDPPIWYDTDVKLFEIQRV 696          
BLAST of Protein HID1 vs. Ensembl Nematostella
Match: EDO28151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7A1])

HSP 1 Score: 296.204 bits (757), Expect = 2.150e-90
Identity = 162/351 (46.15%), Postives = 202/351 (57.55%), Query Frame = 1
Query:  913 YNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVM 1965
            YNHLMF+D++EP+VEVA Q+L + L                        +    D  N I+D+ + +  +                          DF FIL G + LLNNPL  TYLPNS KKI FHQELLIL W+MC+ NK       +G  L     P                                  GV+LNK Y  RV +D+PVFTGTHAD LV+VFHKI TTGH RLQPL+DC LT+IVNVSPYLKSLSMV++ K+LHL+EAFS+PWFLF++PTNHHL+FFLLE+ NNIIQYQFDGNS ++Y++IRKR IFH L+++  D A+I     +K KR   I  M
Sbjct:    1 YNHLMFTDFKEPMVEVAAQLLVVLL------------------------DHDGGDGQNPINDDLAHDMME--------------------------DFHFILHGLANLLNNPLIQTYLPNSCKKISFHQELLILFWKMCDQNKALCSQHEQGSALTLFHCP----------------------------------GVRLNKPYAVRVPMDIPVFTGTHADFLVVVFHKITTTGHQRLQPLFDCLLTIIVNVSPYLKSLSMVAANKLLHLLEAFSTPWFLFANPTNHHLVFFLLEIFNNIIQYQFDGNSQLVYAIIRKRNIFHQLANLPTDPATI-----QKPKRKENIPNM 262          
BLAST of Protein HID1 vs. Ensembl Medaka
Match: hid1b (protein HID1 [Source:NCBI gene;Acc:101175356])

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 443/847 (52.30%), Postives = 578/847 (68.24%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCES---NEDQDKT---PVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSR----SNLXXXXXXXXXXXXFNSKSQQCIGDEWMP---------------------TPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ ++KL++RKAVIQLTTKT+PV+ +++ FWDQFW     ++QD+F L+PAAEIRA+REESP+NL+ LC KA+++++  +++ C + KE+  ++NC R+LTRI+PYIFED++W  FFW            +ED D+    P+AE L+  +++LLF PDFTV S KKSG D  E+ + I+SC+YIWE GVGF+ S     + D +RTE+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLNVV  YDPVGYG+PYNHL+FSD RE LVE A+Q+L +                       + E E     ++++   +++    +        GP+N F+N++SRIH++ D  FILRG ++LLNNPL  TYLP S KKIQFHQELLIL W+ C+ NK F+F VLK   ++E+LVPIL++LNDAR D +R+G++HIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHADLL+++FHK+IT+GH RL PL+DC LT+IVN+SPYLKSLSMV++ K+LHL+EAFS+PWFL S+  +HHL+FFLLEV NNIIQYQFDGNSN++Y++IRKR +FH L+++  D  SI  AL +K    +++        S +S +     P  P  P                    G LKASLE TP +    +K++      +   P +       +  S      E  P                     +P+W  SWK +LPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+I+LFEIQR+
Sbjct:    1 MGNSDTKLHFRKAVIQLTTKTQPVEATDDAFWDQFWTS-AISVQDVFALVPAAEIRAVREESPSNLATLCFKAVERLVQAADSGCPSEKERRIVVNCTRLLTRILPYIFEDADWRGFFWSTIPGASRGGCLDEDVDENEARPLAESLLLAVADLLFCPDFTVQSHKKSGTDPAEEIRSIDSCEYIWEAGVGFAQSPPLNYVHDLHRTELLKLLLTCFSEAMYLPPSSDSKVINPWVAFFCSAENRHTLPLFTSLLNVVCGYDPVGYGVPYNHLLFSDSREQLVEQALQVLVV-----------------------ALEHEAGSAASSALQALDASASPTADEEEKGPAGPDNLFVNYLSRIHREEDLSFILRGLTQLLNNPLIQTYLPRSTKKIQFHQELLILFWKFCDFNKKFLFFVLKSSDVLEMLVPILFYLNDARADQSRVGLVHIGVFILLLLSGERNFGVRLNKPYTLRVPMDIPVFTGTHADLLIVIFHKVITSGHQRLHPLFDCLLTIIVNISPYLKSLSMVAANKLLHLLEAFSAPWFLLSAQRHHHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRNVFHQLANLPTDKESIQNALQRKKPGVSRVN-------SADSEATEDSKPAEPAEP--------------------GALKASLEATPGIDKITEKAQVSKDGTMVTVPHSPCDGSAIDGASDTESNSERDPEAHRSSRSRMSSVSSVSVWSASPDWLLSWKTRLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLRNVDPPIWYDTDIRLFEIQRI 796          
BLAST of Protein HID1 vs. Ensembl Medaka
Match: HID1 (protein HID1 [Source:NCBI gene;Acc:101169784])

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 474/859 (55.18%), Postives = 591/859 (68.80%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFW--FPFNQQCESNE---DQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYE--GPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKS--------------------RSNLXXXXXXXXXXXXFNSKSQQCIGDE----------------WMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MGS +SKLN+RKAVIQLTTKT+PV+ +++ FWDQFW +  TT+QD+F L+PAAEIRA+REESP+NL+ LC KA++K++  +E+ C + +E+  +LNC R+LTRI+PYIFED +W  FFW   P   +   NE   D    P+AE L+  +++LLF PDFTV S K+ GPD+ E  Q I+SC+YIWE GVGF+ S     I D NRTE+L+LLLTCFS TMY+ P   +   NPW+ +F S  N+H LPLFTSLLNVV +YDPVGYG+PYNHL+FSDYRE LVE A+QIL +TLE                                   D  + +   ST+S  + E  GPEN F+N++SRIH++ DFDF+L+G +RLL NPL+ TYLPNS KKIQFHQELL+L W++C+ NK F+F VLK   +++ILVPILY+LNDAR D +R+G+MHIGVFILLLLSGERNFGV+LNK Y   V +D+PVFTGTHADLL++VFHKIITTGH RLQPLYDC LT+IVNVSPYLKSLSMV++ K+LHL+EAFS+ W+LFS+  NHHL+FFLLE  NNIIQYQFDGN N++Y++IRKR +FH L+++ +D ASI +AL KK K       +I    S  + S     P  P  P                    G LKASL   P++    +KS                    +S+L     TS ++       +     E                W PTPEW  SWK KLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGV+YLRN+DPPIWYDT+++LFEIQR+
Sbjct:    1 MGSSDSKLNFRKAVIQLTTKTQPVEATDDAFWDQFWTDATTTVQDVFALVPAAEIRAVREESPSNLATLCYKAVEKLVQAAESGCPSERERQVVLNCTRILTRILPYIFEDQDWRGFFWSTVPGAGRAGMNELEEDDGARPLAELLLLAVADLLFCPDFTVHSHKR-GPDSVESMQSIDSCEYIWEAGVGFAQSPPLNYIHDLNRTELLRLLLTCFSETMYLPPASDNTVLNPWVTFFCSAENRHALPLFTSLLNVVCAYDPVGYGIPYNHLLFSDYREQLVEQAVQILIVTLE----------------------------------HDAGAPQPPASTSSIEEQEPTGPENLFVNYLSRIHREEDFDFVLKGLARLLTNPLTQTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILYYLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSLHVPMDIPVFTGTHADLLIVVFHKIITTGHQRLQPLYDCLLTIIVNVSPYLKSLSMVAANKLLHLLEAFSTSWYLFSTAQNHHLVFFLLETFNNIIQYQFDGNCNLVYAIIRKRNVFHQLANLASDPASIQKALQKKKKSPD----LISRTNSQETVSMEGSRPAVPAEP--------------------GTLKASLVAIPAIDKLTEKSQVSEDGTMVSVPKTDSPQPVQSDLSAAAGTSDTESNSGRDMEDVFYTEAEMQRRRLSSASSASLWAPTPEWVLSWKCKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVVYLRNVDPPIWYDTDVRLFEIQRM 800          
BLAST of Protein HID1 vs. Ensembl Medaka
Match: hid1b (protein HID1 [Source:NCBI gene;Acc:101175356])

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 443/828 (53.50%), Postives = 569/828 (68.72%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCES---NEDQDKT---PVAEQLMNCISNLLFYPDFTVSSLKKSG--PDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSR----SNLXXXXXXXXXXXXFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ ++KL++RKAVIQLTTKT+PV+ +++ FWDQFW     ++QD+F L+PAAEIRA+REESP+NL+ LC KA+++++  +++ C + KE+  ++NC R+LTRI+PYIFED++W  FFW            +ED D+    P+AE L+  +++LLF PDFTV S KKSG   D  E+ + I+SC+YIWE GVGF+ S     + D +RTE+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLNVV  YDPVGYG+PYNHL+FSD RE LVE A+Q+L + L                                         E   + +S  Q  GP+N F+N++SRIH++ D  FILRG ++LLNNPL  TYLP S KKIQFHQELLIL W+ C+ NK F+F VLK   ++E+LVPIL++LNDAR D +R+G++HIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHADLL+++FHK+IT+GH RL PL+DC LT+IVN+SPYLKSLSMV++ K+LHL+EAFS+PWFL S+  +HHL+FFLLEV NNIIQYQFDGNSN++Y++IRKR +FH L+++  D  SI  AL +K    +++        S +S +     P  P  P                    G LKASLE TP +    +K++      +   P +       +  S      E  P      SWK +LPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+I+LFEIQR+
Sbjct:    1 MGNSDTKLHFRKAVIQLTTKTQPVEATDDAFWDQFWTS-AISVQDVFALVPAAEIRAVREESPSNLATLCFKAVERLVQAADSGCPSEKERRIVVNCTRLLTRILPYIFEDADWRGFFWSTIPGASRGGCLDEDVDENEARPLAESLLLAVADLLFCPDFTVQSHKKSGTVSDPAEEIRSIDSCEYIWEAGVGFAQSPPLNYVHDLHRTELLKLLLTCFSEAMYLPPSSDSKVINPWVAFFCSAENRHTLPLFTSLLNVVCGYDPVGYGVPYNHLLFSDSREQLVEQALQVLVVAL---------------------------------------EHEAGSAASSALQPAGPDNLFVNYLSRIHREEDLSFILRGLTQLLNNPLIQTYLPRSTKKIQFHQELLILFWKFCDFNKKFLFFVLKSSDVLEMLVPILFYLNDARADQSRVGLVHIGVFILLLLSGERNFGVRLNKPYTLRVPMDIPVFTGTHADLLIVIFHKVITSGHQRLHPLFDCLLTIIVNISPYLKSLSMVAANKLLHLLEAFSAPWFLLSAQRHHHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRNVFHQLANLPTDKESIQNALQRKKPGVSRVN-------SADSEATEDSKPAEPAEP--------------------GALKASLEATPGIDKITEKAQVSKDGTMVTVPHSPCDGSAIDGASDTESNSERDPE---LLSWKTRLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLRNVDPPIWYDTDIRLFEIQRI 758          
BLAST of Protein HID1 vs. Ensembl Medaka
Match: hid1b (protein HID1 [Source:NCBI gene;Acc:101175356])

HSP 1 Score: 859.751 bits (2220), Expect = 0.000e+0
Identity = 426/841 (50.65%), Postives = 555/841 (65.99%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSR----SNLXXXXXXXXXXXXFNSKSQQCIGDEWMP---------------------TPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRV 2571
            MG+ ++KL++RKAVIQLTTKT+PV+ +++ FWDQFW     ++QD+F L+PAAEIRA+REESP+NL+ LC KA+++++  +++ C + KE+  ++NC R+LTRI+PYIFED++W  FFW                P A +                      G D  E+ + I+SC+YIWE GVGF+ S     + D +RTE+LKLLLTCFS  MY+ P       NPW+ +F S  N+H LPLFTSLLNVV  YDPVGYG+PYNHL+FSD RE LVE A+Q+L +                       + E E     ++++   +++    +        GP+N F+N++SRIH++ D  FILRG ++LLNNPL  TYLP S KKIQFHQELLIL W+ C+ NK F+F VLK   ++E+LVPIL++LNDAR D +R+G++HIGVFILLLLSGERNFGV+LNK Y  RV +D+PVFTGTHADLL+++FHK+IT+GH RL PL+DC LT+IVN+SPYLKSLSMV++ K+LHL+EAFS+PWFL S+  +HHL+FFLLEV NNIIQYQFDGNSN++Y++IRKR +FH L+++  D  SI  AL +K    +++        S +S +     P  P  P                    G LKASLE TP +    +K++      +   P +       +  S      E  P                     +P+W  SWK +LPLQTIMRLLQVLVPQVEKICIDKGLTDESEI+KFLQ GTLVGLLPVPHPILIRKYQ+N GT  WFRTYMWGVIYLRN+DPPIWYDT+I+LFEIQR+
Sbjct:    1 MGNSDTKLHFRKAVIQLTTKTQPVEATDDAFWDQFWTS-AISVQDVFALVPAAEIRAVREESPSNLATLCFKAVERLVQAADSGCPSEKERRIVVNCTRLLTRILPYIFEDADWRGFFW-------------STIPGASR----------------------GGDPAEEIRSIDSCEYIWEAGVGFAQSPPLNYVHDLHRTELLKLLLTCFSEAMYLPPSSDSKVINPWVAFFCSAENRHTLPLFTSLLNVVCGYDPVGYGVPYNHLLFSDSREQLVEQALQVLVV-----------------------ALEHEAGSAASSALQALDASASPTADEEEKGPAGPDNLFVNYLSRIHREEDLSFILRGLTQLLNNPLIQTYLPRSTKKIQFHQELLILFWKFCDFNKKFLFFVLKSSDVLEMLVPILFYLNDARADQSRVGLVHIGVFILLLLSGERNFGVRLNKPYTLRVPMDIPVFTGTHADLLIVIFHKVITSGHQRLHPLFDCLLTIIVNISPYLKSLSMVAANKLLHLLEAFSAPWFLLSAQRHHHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRNVFHQLANLPTDKESIQNALQRKKPGVSRVN-------SADSEATEDSKPAEPAEP--------------------GALKASLEATPGIDKITEKAQVSKDGTMVTVPHSPCDGSAIDGASDTESNSERDPEAHRSSRSRMSSVSSVSVWSASPDWLLSWKTRLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQHGTLVGLLPVPHPILIRKYQANAGTAMWFRTYMWGVIYLRNVDPPIWYDTDIRLFEIQRI 755          
BLAST of Protein HID1 vs. Planmine SMEST
Match: SMESG000034495.1 (SMESG000034495.1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 458/846 (54.14%), Postives = 607/846 (71.75%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCE-SNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKS----GPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRP-DQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSI--DDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSL-QFTIDKSRS----------NLXXXXXXXXXXXXFNSKSQQCIGD------------EWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQR 2568
            MG+ENSK+N+RK+VIQL  KT+PVD +++ FW QFW+EY+T +QD+F+LIP+ EI+ LREESP N++ LC KA++K+   SE+  L+ K++   LNC+R+LTR++PY+FEDS+W SFFW     Q + S E  +  P+A  L++ +++LLF+PDFTVS  KK       +NP + + I+SC+YIW++GVGF+ +   +   D NRTEILKLLLTCFS TMY+   +      N WI + T   N+H LP FTSLLN VF+YDPVGYG+PYNHLMFSD  EPL+EVA+QILC+TLET  E+S +         N K K + Y+     S   ++ NS      +T + Q  G  N F+N+MSRIH+D DF FIL+GF RLLNNPL+ TY P S KK+  HQELLILLWRMC+IN+ F+F++LK  H++EI VPIL+HLN++R D +++G++H+GVFILL+LSGERNFGV+LNK Y++RV++D+PVFTGTHADLL++VFHKIITTGH  LQPL+DC LTVIVNVSPYLKSLSMV+++K++HL+EAF++PWFLFS+ +NHHL+FFLLE+LNNI+QYQFDGNSN++YS+IRKR +F+ L ++K D   +S+     + +       + + ++ +S      T Q  N                 S+ E G +K +L+ TPS+ + T D  RS          NL R   +  S     SK ++ + +            EW PT +W  +WKQKLPLQTIMRLLQVLVPQVEK+CI+KGLTDESEI+ FLQRGTLVGLLPVPHPILIRKYQ+N GT+ WFRTYMWGVIYLRN DP IW+DTN++LFEIQ+
Sbjct:    1 MGNENSKINFRKSVIQLLKKTQPVDINDDVFWSQFWSEYDTNLQDVFLLIPSDEIKILREESPNNMATLCYKAVEKLTQFSESCSLSAKDKEIALNCIRILTRLLPYLFEDSDWRSFFWSSVPTQPDPSGEQIENAPLAAALLSSLTDLLFFPDFTVSCPKKVHEEVSDENPGN-KVIDSCEYIWQSGVGFTATPHHSPNFDRNRTEILKLLLTCFSETMYIESIELDAPYENLWIKFCTGTENRHALPFFTSLLNTVFAYDPVGYGVPYNHLMFSDTIEPLMEVALQILCVTLETIDEASLK---------NSKRKMDLYTSFTTASYISNNANSIHSENESTKDIQSSG--NLFVNYMSRIHRDEDFSFILKGFIRLLNNPLTQTYFPGSCKKVNCHQELLILLWRMCDINRRFLFYLLKSSHILEIFVPILFHLNNSRADQSKIGLVHLGVFILLMLSGERNFGVRLNKPYENRVSMDIPVFTGTHADLLIIVFHKIITTGHHLLQPLFDCLLTVIVNVSPYLKSLSMVTASKLVHLLEAFTTPWFLFSNSSNHHLVFFLLEILNNIVQYQFDGNSNLVYSIIRKRSVFYHLVNLKTDQDYLSET---LNNKTKLNKNKVASQINEDSVEN---TVQKSN----------------LSEGEDGNVKTTLKETPSISKMTSDYERSVNNDDQSDEENLDRQKISCVS----ESKEEKSVKEKPKHKKSDNLLVEWTPTSKWVINWKQKLPLQTIMRLLQVLVPQVEKLCIEKGLTDESEILNFLQRGTLVGLLPVPHPILIRKYQANMGTNLWFRTYMWGVIYLRNSDPAIWHDTNVRLFEIQK 808          
BLAST of Protein HID1 vs. Planmine SMEST
Match: SMESG000005161.1 (SMESG000005161.1)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 434/436 (99.54%), Postives = 434/436 (99.54%), Query Frame = 1
Query: 1276 MKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRVIGCN 2583
            MKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGH RLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVSQRSASIESSSQINSDVETGQLKASLEITP LQFTIDKSRSNLRRTPTTSTSDDTFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRVIGCN
Sbjct:    1 MKKIQFHQELLILLWRMCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHNRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVSQRSASIESSSQINSDVETGQLKASLEITPFLQFTIDKSRSNLRRTPTTSTSDDTFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRVIGCN 436          
BLAST of Protein HID1 vs. Planmine SMEST
Match: SMESG000005161.1 (SMESG000005161.1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 418/420 (99.52%), Postives = 418/420 (99.52%), Query Frame = 1
Query: 1324 MCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRVIGCN 2583
            MCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGH RLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVSQRSASIESSSQINSDVETGQLKASLEITP LQFTIDKSRSNLRRTPTTSTSDDTFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRVIGCN
Sbjct:    1 MCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHNRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVSQRSASIESSSQINSDVETGQLKASLEITPFLQFTIDKSRSNLRRTPTTSTSDDTFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRVIGCN 420          
BLAST of Protein HID1 vs. Planmine SMEST
Match: SMESG000005161.1 (SMESG000005161.1)

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 410/412 (99.51%), Postives = 410/412 (99.51%), Query Frame = 1
Query: 1348 MFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVXXXXXXXXXXXXXXXDVETGQLKASLEITPSLQFTIDKSRSNLXXXXXXXXXXXXFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRVIGCN 2583
            MFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGH RLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVSQRSASIESSSQINSDVETGQLKASLEITP LQFTIDKSRSNLRRTPTTSTSDDTFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRVIGCN
Sbjct:    1 MFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILLLLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHNRLQPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHHLIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQALSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVSQRSASIESSSQINSDVETGQLKASLEITPFLQFTIDKSRSNLRRTPTTSTSDDTFNSKSQQCIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEIIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDPPIWYDTNIQLFEIQRVIGCN 412          
BLAST of Protein HID1 vs. Planmine SMEST
Match: SMESG000005164.1 (SMESG000005164.1)

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 358/359 (99.72%), Postives = 359/359 (100.00%), Query Frame = 1
Query:  124 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCIXXXXXXXXXXXXXXXXXXXXNGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDN 1200
            MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDT+FINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCITLETSFESSSQSKSTQSLEENGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDN
Sbjct:    1 MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILIPAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRMLTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLFYPDFTVSSLKKSGPDNPEDTRFINSCDYIWENGVGFSGSLGSTSIQDSNRTEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLNVVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCITLETSFESSSQSKSTQSLEENGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFINFMSRIHKDN 359          
The following BLAST results are available for this feature:
BLAST of Protein HID1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HID10.000e+054.02HID1 domain containing [Source:HGNC Symbol;Acc:HGN... [more]
HID12.293e-8269.59HID1 domain containing [Source:HGNC Symbol;Acc:HGN... [more]
HID11.109e-7146.27HID1 domain containing [Source:HGNC Symbol;Acc:HGN... [more]
HID14.180e-4759.32HID1 domain containing [Source:HGNC Symbol;Acc:HGN... [more]
HID15.391e-2535.37HID1 domain containing [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protein HID1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hid-10.000e+048.41HID-1; High temperature-Induced Dauer formation [... [more]
hid-10.000e+048.12HID-1; High temperature-Induced Dauer formation [... [more]
back to top
BLAST of Protein HID1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG88411.064e-5654.05gene:FBgn0033713 transcript:FBtr0087966[more]
CG88411.064e-5654.05gene:FBgn0033713 transcript:FBtr0087965[more]
CG88411.064e-5654.05gene:FBgn0033713 transcript:FBtr0087964[more]
back to top
BLAST of Protein HID1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hid1b0.000e+054.58HID1 domain containing b [Source:ZFIN;Acc:ZDB-GENE... [more]
hid1a7.274e-6284.68HID1 domain containing a [Source:ZFIN;Acc:ZDB-GENE... [more]
hid1a2.897e-5888.24HID1 domain containing a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Protein HID1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p3h40.000e+054.43prolyl 3-hydroxylase family member 4 (non-enzymati... [more]
p3h40.000e+054.00prolyl 3-hydroxylase family member 4 (non-enzymati... [more]
p3h40.000e+053.87prolyl 3-hydroxylase family member 4 (non-enzymati... [more]
p3h40.000e+053.69prolyl 3-hydroxylase family member 4 (non-enzymati... [more]
p3h40.000e+050.00prolyl 3-hydroxylase family member 4 (non-enzymati... [more]
back to top
BLAST of Protein HID1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Hid10.000e+054.64HID1 domain containing [Source:MGI Symbol;Acc:MGI:... [more]
Hid10.000e+054.59HID1 domain containing [Source:MGI Symbol;Acc:MGI:... [more]
Hid14.649e-7145.88HID1 domain containing [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Protein HID1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R1F6|HID1_MOUSE0.000e+054.64Protein HID1 OS=Mus musculus OX=10090 GN=Hid1 PE=1... [more]
sp|Q8IV36|HID1_HUMAN0.000e+054.02Protein HID1 OS=Homo sapiens OX=9606 GN=HID1 PE=1 ... [more]
sp|Q54JJ6|HID1_DICDI1.600e-7131.20Protein HID1 OS=Dictyostelium discoideum OX=44689 ... [more]
sp|Q9P7M6|YIOC_SCHPO1.467e-4224.67Hid-1 family protein P27G11.12 OS=Schizosaccharomy... [more]
sp|O13776|FT105_SCHPO1.550e-3125.97Ubp5-interacting protein ftp105 OS=Schizosaccharom... [more]
back to top
BLAST of Protein HID1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PW100.000e+057.01Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A267FCG70.000e+055.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EC050.000e+055.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
R7VDZ00.000e+057.21Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1B6CIT10.000e+055.49Uncharacterized protein OS=Clastoptera arizonana O... [more]
back to top
BLAST of Protein HID1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
HID10.000e+053.84HID1 domain containing [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protein HID1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hid1b0.000e+042.70HID1 domain containing b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Protein HID1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein HID1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO480520.000e+054.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281512.150e-9046.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein HID1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hid1b0.000e+052.30protein HID1 [Source:NCBI gene;Acc:101175356][more]
HID10.000e+055.18protein HID1 [Source:NCBI gene;Acc:101169784][more]
hid1b0.000e+053.50protein HID1 [Source:NCBI gene;Acc:101175356][more]
hid1b0.000e+050.65protein HID1 [Source:NCBI gene;Acc:101175356][more]
back to top
BLAST of Protein HID1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034495.10.000e+054.14SMESG000034495.1[more]
SMESG000005161.10.000e+099.54SMESG000005161.1[more]
SMESG000005161.10.000e+099.52SMESG000005161.1[more]
SMESG000005161.10.000e+099.51SMESG000005161.1[more]
SMESG000005164.10.000e+099.72SMESG000005164.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023973 ID=SMED30023973|Name=Protein HID1|organism=Schmidtea mediterranea sexual|type=transcript|length=2816bp
CACATTTCTAAAAGCACATTTTGAATTGAGAAAATTAATAATTTATTGAA
TAATAATATTAATTATTAAATTTACTAAAATTGATTTAGTTTTATACAAT
TATTTCGATTGATTCTTTAATTAATGGGTAGTGAAAATTCAAAATTGAAC
TATAGAAAAGCAGTTATACAGTTGACTACAAAAACTGAACCAGTAGATCC
AAGTAATAACGAATTTTGGGATCAATTCTGGAACGAATATGAAACAACGA
TTCAGGATATTTTCATTTTAATCCCGGCTGCAGAAATACGGGCACTCCGA
GAAGAATCACCAACAAATCTTTCAATTCTTTGTTCAAAAGCGATACAGAA
AATCATTAGTTTATCTGAAGCGTCATGTCTAACAACAAAAGAACAGCATA
CGATTTTAAATTGTGTTCGTATGTTAACAAGAATCATTCCATATATATTC
GAAGATTCAGAATGGAATTCTTTTTTCTGGTTTCCTTTCAATCAACAGTG
CGAGTCCAATGAAGATCAGGACAAAACCCCAGTAGCAGAGCAGCTTATGA
ATTGCATATCGAATTTATTATTCTACCCTGATTTCACGGTGTCCTCACTT
AAAAAATCAGGACCGGACAATCCAGAGGATACACAATTCATCAATAGTTG
TGACTATATTTGGGAAAATGGTGTCGGATTTTCAGGTTCGTTGGGTTCAA
CATCGATCCAAGATTCGAATCGAACCGAGATATTGAAACTGCTCTTGACA
TGTTTCTCTATCACAATGTACATGCGCCCCGATCAAGGTCACAATGAGCC
GAATCCGTGGATTGTTTACTTTACATCTCGCAACAACAAACATTGCTTGC
CACTATTCACATCTCTCCTCAATGTTGTATTTTCATACGACCCAGTCGGG
TACGGGATGCCATACAATCATCTTATGTTCAGTGATTATCGGGAGCCTTT
GGTAGAGGTTGCTATTCAGATTTTATGCATAACACTGGAAACGAGTTTCG
AAAGTTCTAGTCAGTCTAAATCAACTCAGTCATTGGAAGAAAATGGTAAA
AGTAAAGAGGAAGAGTATTCAAAAGACGAAAATAATTCCATTGACGACGA
AAATTCTACAGAAGAGGCTAAATCTACCACGTCAAACAGTCAATACGAAG
GCCCAGAAAACTTCTTCATTAATTTTATGTCTAGAATACACAAAGATAAT
GATTTTGATTTTATTTTGCGCGGCTTTTCTCGACTTCTCAATAATCCATT
ATCACATACGTACTTACCAAACTCGATGAAAAAAATTCAATTTCACCAGG
AATTACTCATTTTACTGTGGAGAATGTGTGAAATAAATAAGAATTTTATG
TTCCACGTGTTGAAAGGCGATCATCTCATGGAAATTCTCGTGCCTATATT
GTATCATCTAAATGATGCGAGATGTGACCCAGCTCGATTGGGCGTGATGC
ACATTGGGGTTTTTATTTTGCTGCTACTCAGTGGAGAGAGAAATTTCGGA
GTCAAGCTCAACAAAGTCTATCAACACCGGGTTAACATTGATGTGCCTGT
GTTCACTGGAACTCATGCAGATCTACTTGTTCTGGTTTTTCATAAAATAA
TTACCACGGGGCATACCCGTTTACAACCTCTTTATGATTGCTTTCTTACA
GTCATAGTCAATGTGTCTCCATACCTGAAGTCTTTATCAATGGTGTCATC
AACTAAGATTCTACACTTAATCGAAGCTTTCAGTAGTCCATGGTTTCTAT
TTTCTAGCCCAACAAATCATCATCTCATATTCTTCCTATTGGAAGTTCTA
AATAACATCATTCAATATCAATTTGACGGCAATAGTAATATTATTTATTC
AATGATCCGTAAACGGCAAATATTTCATGATCTTAGCAGCATAAAGGCAG
ACTCGGCAAGCATTTCCCAAGCTCTAAGTAAGAAGTCAAAAAGAGCAGCC
AAAATAGCTGTGATGATTCCAGCTCCAGTCTCTGGAAATAGTCCATCAGG
AAGTTTTTATACTCCTCAGACTCCAAATTCACCCGTCAGTCAAAGAAGTG
CCAGTATTGAGAGTTCGAGTCAGATTAATTCAGATGTTGAAACTGGACAG
TTGAAAGCCAGCTTAGAAATTACTCCATCTTTACAATTTACAATAGATAA
AAGTCGATCTAATCTCAGAAGAACTCCAACGACAAGTACATCTGATGATA
CTTTTAATTCAAAATCTCAGCAATGCATTGGGGATGAATGGATGCCAACT
CCCGAATGGGCACAAAGCTGGAAACAAAAATTACCTTTACAAACCATTAT
GCGACTTCTTCAAGTATTAGTGCCACAGGTGGAAAAGATCTGCATAGATA
AAGGTCTGACAGATGAATCAGAAATTATAAAATTCCTCCAAAGAGGAACA
CTTGTTGGTTTATTACCGGTTCCTCATCCGATCTTAATAAGGAAATATCA
GAGCAACCCAGGAACGGATAAATGGTTCAGAACTTACATGTGGGGAGTTA
TTTACTTAAGAAACATTGATCCACCCATTTGGTATGATACAAATATTCAA
CTTTTTGAAATTCAAAGGGTCATTGGATGTAACTGAAAAACTAAATGTTT
TTATTTATTTCGCAAGATCCCATTTGATTGTCTTTTGTTCTTTGTAATGT
CTTAACTTTATTGTTTCTCTCATTTGTCGTAAATGGTTGATATAGAAATA
AATTTGGAAATCTGCTGGAAGAGATCTTTTGAAGAATGTTGGATTTCCTT
TGTTTCATCGAAACGTTTTTGTAATTAAAAAAAGTGACCAAGGTCCTTTT
TTAAAAAATGAGATAT
back to top

protein sequence of SMED30023973-orf-1

>SMED30023973-orf-1 ID=SMED30023973-orf-1|Name=SMED30023973-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=821bp
MGSENSKLNYRKAVIQLTTKTEPVDPSNNEFWDQFWNEYETTIQDIFILI
PAAEIRALREESPTNLSILCSKAIQKIISLSEASCLTTKEQHTILNCVRM
LTRIIPYIFEDSEWNSFFWFPFNQQCESNEDQDKTPVAEQLMNCISNLLF
YPDFTVSSLKKSGPDNPEDTQFINSCDYIWENGVGFSGSLGSTSIQDSNR
TEILKLLLTCFSITMYMRPDQGHNEPNPWIVYFTSRNNKHCLPLFTSLLN
VVFSYDPVGYGMPYNHLMFSDYREPLVEVAIQILCITLETSFESSSQSKS
TQSLEENGKSKEEEYSKDENNSIDDENSTEEAKSTTSNSQYEGPENFFIN
FMSRIHKDNDFDFILRGFSRLLNNPLSHTYLPNSMKKIQFHQELLILLWR
MCEINKNFMFHVLKGDHLMEILVPILYHLNDARCDPARLGVMHIGVFILL
LLSGERNFGVKLNKVYQHRVNIDVPVFTGTHADLLVLVFHKIITTGHTRL
QPLYDCFLTVIVNVSPYLKSLSMVSSTKILHLIEAFSSPWFLFSSPTNHH
LIFFLLEVLNNIIQYQFDGNSNIIYSMIRKRQIFHDLSSIKADSASISQA
LSKKSKRAAKIAVMIPAPVSGNSPSGSFYTPQTPNSPVSQRSASIESSSQ
INSDVETGQLKASLEITPSLQFTIDKSRSNLRRTPTTSTSDDTFNSKSQQ
CIGDEWMPTPEWAQSWKQKLPLQTIMRLLQVLVPQVEKICIDKGLTDESE
IIKFLQRGTLVGLLPVPHPILIRKYQSNPGTDKWFRTYMWGVIYLRNIDP
PIWYDTNIQLFEIQRVIGCN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR026705Hid-1/Ecm30
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026705Hid-1/Ecm30PFAMPF12722Hid1coord: 1..813
e-value: 1.1E-260
score: 867.3
IPR026705Hid-1/Ecm30PANTHERPTHR21575FAMILY NOT NAMEDcoord: 1..816
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 296..339
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 624..650
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 305..331