Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30023971
Length (bp)1405
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30023971) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30023971) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30023971) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30023971) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023971

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30023971SMESG000080661.1 SmedASXL_003878SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30023971SMESG000080661.1 Smed-Hox1smed_ncbi_20200123PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30023971SMESG000080661.1 dd_Smed_v4_62255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023971SMESG000080661.1 dd_Smed_v4_62255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023971SMESG000080661.1 dd_Smed_v4_62255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXB1 (homeobox B1 [Source:HGNC Symbol;Acc:HGNC:5111])

HSP 1 Score: 95.5153 bits (236), Expect = 2.831e-21
Identity = 46/90 (51.11%), Postives = 58/90 (64.44%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITG-RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK+ K                    +    S +G RTNFT +QLTELEKEFHFN+YL+RARR+EIA ++ L+ETQVKIWF
Sbjct:  180 FDWMKVKRNPPKTAKV------------------SEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWF 251          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXA1 (homeobox A1 [Source:HGNC Symbol;Acc:HGNC:5099])

HSP 1 Score: 95.9005 bits (237), Expect = 3.260e-21
Identity = 51/89 (57.30%), Postives = 61/89 (68.54%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK+ K     E         Y +  Q   N++  RTNFT KQLTELEKEFHFN+YLTRARR+EIA S+ L+ETQVKIWF
Sbjct:  205 FDWMKVKRNPPKTGK---VGE---------YGYLGQP--NAV--RTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWF 277          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXD1 (homeobox D1 [Source:HGNC Symbol;Acc:HGNC:5132])

HSP 1 Score: 91.2781 bits (225), Expect = 1.302e-19
Identity = 48/89 (53.93%), Postives = 58/89 (65.17%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F+WMK+KR+  K  K            A Y +    S+      RTNF+ KQLTELEKEFHFN+YLTRARRIEIAN + L++TQVKIWF
Sbjct:  205 FEWMKVKRNASKKGK-----------LAEYGAASPSSAI-----RTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWF 277          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXD3 (homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137])

HSP 1 Score: 79.7221 bits (195), Expect = 1.974e-15
Identity = 42/91 (46.15%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGR--TNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK  R + K QKN        C        ED+S     + R  T +T+ QL ELEKEFHFN+YL R RR+E+AN + L+E Q+KIWF
Sbjct:  161 FPWMKESRQNSK-QKNSCATAGESC--------EDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWF 242          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXD3 (homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137])

HSP 1 Score: 79.7221 bits (195), Expect = 1.974e-15
Identity = 42/91 (46.15%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGR--TNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK  R + K QKN        C        ED+S     + R  T +T+ QL ELEKEFHFN+YL R RR+E+AN + L+E Q+KIWF
Sbjct:  161 FPWMKESRQNSK-QKNSCATAGESC--------EDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWF 242          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-13 (Homeobox protein ceh-13 [Source:UniProtKB/Swiss-Prot;Acc:P17488])

HSP 1 Score: 70.4774 bits (171), Expect = 7.691e-14
Identity = 39/90 (43.33%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  943 FQWMKIKR-HHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            ++WM  KR   P + K    +EN                    T RTNFT  QLTELEKEFH  +Y+ R RR EIA+++ L E QVKIWF
Sbjct:   92 YKWMHTKRSQRPAAPKKKVIDEN-------------------GTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWF 162          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-13 (Homeobox protein ceh-13 [Source:UniProtKB/Swiss-Prot;Acc:P17488])

HSP 1 Score: 70.4774 bits (171), Expect = 7.691e-14
Identity = 39/90 (43.33%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  943 FQWMKIKR-HHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            ++WM  KR   P + K    +EN                    T RTNFT  QLTELEKEFH  +Y+ R RR EIA+++ L E QVKIWF
Sbjct:   92 YKWMHTKRSQRPAAPKKKVIDEN-------------------GTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWF 162          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 67.3958 bits (163), Expect = 1.792e-12
Identity = 29/45 (64.44%), Postives = 37/45 (82.22%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RT +T  Q+ ELEKEFH ++YLTR RRIE+A+S+ L+E QVKIWF
Sbjct:  169 RTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWF 213          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 67.3958 bits (163), Expect = 1.792e-12
Identity = 29/45 (64.44%), Postives = 37/45 (82.22%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RT +T  Q+ ELEKEFH ++YLTR RRIE+A+S+ L+E QVKIWF
Sbjct:  169 RTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWF 213          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-12 (Homeobox protein ceh-12 [Source:UniProtKB/Swiss-Prot;Acc:P17487])

HSP 1 Score: 60.077 bits (144), Expect = 1.487e-11
Identity = 25/45 (55.56%), Postives = 36/45 (80.00%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RT F+++QL +LEK+F  N+YL+R RR ++A  + LSETQ+KIWF
Sbjct:    5 RTAFSSEQLVQLEKQFSDNRYLSRPRRYQLAQQLSLSETQIKIWF 49          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: lab (gene:FBgn0002522 transcript:FBtr0308035)

HSP 1 Score: 88.9669 bits (219), Expect = 5.512e-20
Identity = 40/45 (88.89%), Postives = 44/45 (97.78%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RTNFTNKQLTELEKEFHFN+YLTRARRIEIAN++ L+ETQVKIWF
Sbjct:   89 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWF 133          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: lab (gene:FBgn0002522 transcript:FBtr0081696)

HSP 1 Score: 91.2781 bits (225), Expect = 2.865e-19
Identity = 40/45 (88.89%), Postives = 44/45 (97.78%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RTNFTNKQLTELEKEFHFN+YLTRARRIEIAN++ L+ETQVKIWF
Sbjct:  505 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWF 549          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Antp (gene:FBgn0260642 transcript:FBtr0081648)

HSP 1 Score: 77.0258 bits (188), Expect = 5.916e-15
Identity = 47/115 (40.87%), Postives = 62/115 (53.91%), Query Frame = 1
Query:  892 MYNESSFSGNPVQNTPPFQWM-------KIKRHHPKSQKNFSTNENPQC--LQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            MY + S  G P    PP   M       ++ + HP      S N N Q   + +  Y +  +S F    GR  +T  Q  ELEKEFHFN+YLTR RRIEIA+++ L+E Q+KIWF
Sbjct:  230 MYQQQS--GVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWM-RSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWF 341          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Antp (gene:FBgn0260642 transcript:FBtr0081651)

HSP 1 Score: 77.0258 bits (188), Expect = 5.916e-15
Identity = 47/115 (40.87%), Postives = 62/115 (53.91%), Query Frame = 1
Query:  892 MYNESSFSGNPVQNTPPFQWM-------KIKRHHPKSQKNFSTNENPQC--LQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            MY + S  G P    PP   M       ++ + HP      S N N Q   + +  Y +  +S F    GR  +T  Q  ELEKEFHFN+YLTR RRIEIA+++ L+E Q+KIWF
Sbjct:  230 MYQQQS--GVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWM-RSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWF 341          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Antp (gene:FBgn0260642 transcript:FBtr0081649)

HSP 1 Score: 76.2554 bits (186), Expect = 7.349e-15
Identity = 47/115 (40.87%), Postives = 62/115 (53.91%), Query Frame = 1
Query:  892 MYNESSFSGNPVQNTPPFQWM-------KIKRHHPKSQKNFSTNENPQC--LQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            MY + S  G P    PP   M       ++ + HP      S N N Q   + +  Y +  +S F    GR  +T  Q  ELEKEFHFN+YLTR RRIEIA+++ L+E Q+KIWF
Sbjct:  217 MYQQQS--GVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWM-RSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWF 328          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxa1a (homeobox A1a [Source:NCBI gene;Acc:58051])

HSP 1 Score: 100.908 bits (250), Expect = 2.226e-23
Identity = 55/105 (52.38%), Postives = 67/105 (63.81%), Query Frame = 1
Query:  895 YNESSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            Y  +++ G P   T  F WMK+KR+ PK+ K            A  Y F  Q +    T RTNF+ KQLTELEKEFHFN+YLTRARR+EIA S+ L+ETQVKIWF
Sbjct:  152 YGSATYDGVPTGQT--FDWMKVKRNPPKTGK------------AGEYGFGGQPN----TVRTNFSTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWF 238          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxb1b (homeobox B1b [Source:NCBI gene;Acc:30374])

HSP 1 Score: 96.6709 bits (239), Expect = 1.862e-22
Identity = 49/95 (51.58%), Postives = 62/95 (65.26%), Query Frame = 1
Query:  925 VQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            ++  P F WMK+KR+ PK+            ++   Y    Q   N I  RTNFT KQLTELEKEFHFN+YLTRARR+E+A ++ L+ETQVKIWF
Sbjct:  100 IKQAPTFDWMKVKRNPPKT------------VKVAEYGIHGQQ--NII--RTNFTTKQLTELEKEFHFNKYLTRARRVEVAATLELNETQVKIWF 178          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxa1a (homeobox A1a [Source:NCBI gene;Acc:58051])

HSP 1 Score: 97.4413 bits (241), Expect = 6.056e-22
Identity = 54/98 (55.10%), Postives = 63/98 (64.29%), Query Frame = 1
Query:  916 GNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            G P   T  F WMK+KR+ PK+ K            A  Y F  Q +    T RTNF+ KQLTELEKEFHFN+YLTRARR+EIA S+ L+ETQVKIWF
Sbjct:  194 GVPTGQT--FDWMKVKRNPPKTGK------------AGEYGFGGQPN----TVRTNFSTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWF 273          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxb1b (homeobox B1b [Source:NCBI gene;Acc:30374])

HSP 1 Score: 96.6709 bits (239), Expect = 6.946e-22
Identity = 49/95 (51.58%), Postives = 62/95 (65.26%), Query Frame = 1
Query:  925 VQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            ++  P F WMK+KR+ PK+            ++   Y    Q   N I  RTNFT KQLTELEKEFHFN+YLTRARR+E+A ++ L+ETQVKIWF
Sbjct:  178 IKQAPTFDWMKVKRNPPKT------------VKVAEYGIHGQQ--NII--RTNFTTKQLTELEKEFHFNKYLTRARRVEVAATLELNETQVKIWF 256          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxb1a (homeobox B1a [Source:NCBI gene;Acc:30337])

HSP 1 Score: 95.5153 bits (236), Expect = 2.500e-21
Identity = 51/94 (54.26%), Postives = 61/94 (64.89%), Query Frame = 1
Query:  937 PP---FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            PP   F WMK+KR+ PK+ K       PQ               N+I  RTNFT KQLTELEKEFHF++YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  194 PPGKTFDWMKVKRNPPKTGKVAEYGLGPQ---------------NTI--RTNFTTKQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKIWF 270          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: hoxa1 (homeobox A1 [Source:NCBI gene;Acc:493379])

HSP 1 Score: 100.908 bits (250), Expect = 5.138e-23
Identity = 55/102 (53.92%), Postives = 64/102 (62.75%), Query Frame = 1
Query:  904 SSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            S  S  P Q    F WMK+KR+ PK+ K            A  Y F  Q +    T RTNFT KQLTELEKEFHFN+YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  183 SETSPGPAQT---FDWMKVKRNPPKTGK------------AGEYGFAGQPN----TARTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWF 265          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: anxa11 (annexin A11 [Source:Xenbase;Acc:XB-GENE-958577])

HSP 1 Score: 97.4413 bits (241), Expect = 4.989e-22
Identity = 51/89 (57.30%), Postives = 60/89 (67.42%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK           + LQ+ Y       +    T RTNFT KQLTELEKEFHFN+YLTRARRIEIANS+ L++TQVKIWF
Sbjct:  179 FDWMKVKRNPPK-----------KSLQSEY-----GVASPPCTVRTNFTTKQLTELEKEFHFNKYLTRARRIEIANSLQLNDTQVKIWF 251          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: dhrs7 (dehydrogenase/reductase (SDR family) member 7 [Source:Xenbase;Acc:XB-GENE-5838792])

HSP 1 Score: 93.2041 bits (230), Expect = 1.527e-20
Identity = 49/89 (55.06%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK+              A    F   +  N+I  RTNFT KQLTELEKEFHFN+YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  185 FDWMKVKRNPPKTT-------------AKPVDFGLSTQQNTI--RTNFTTKQLTELEKEFHFNKYLTRARRVEIAATLELNETQVKIWF 258          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: pbx2 (pre-B-cell leukemia homeobox 2 [Source:Xenbase;Acc:XB-GENE-484669])

HSP 1 Score: 84.3445 bits (207), Expect = 4.948e-17
Identity = 45/89 (50.56%), Postives = 56/89 (62.92%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK  R + K QK  S++    C  A   S   QSS  S   RT +T+ QL ELEKEFHFN+YL R RR+E+AN + L+E Q+KIWF
Sbjct:  128 FPWMKESRQNTKQQKAGSSSSGESC--AGDKSPPGQSS--SKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWF 212          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: HOXD4 (homeobox D4 [Source:HGNC Symbol;Acc:HGNC:5138])

HSP 1 Score: 75.8702 bits (185), Expect = 5.605e-15
Identity = 44/93 (47.31%), Postives = 58/93 (62.37%), Query Frame = 1
Query:  961 KRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSI----TG------RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            ++ HPK   N S  + P    A+ Y +  +   NS+    TG      RT +T +Q+ ELEKEFHFN+YLTR RRIEIA+S+ LSE Q+KIWF
Sbjct:  110 QQQHPK---NGSLGKPP----AIVYPWMKKVHCNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHSLCLSERQIKIWF 195          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxd1 (homeobox D1 [Source:MGI Symbol;Acc:MGI:96201])

HSP 1 Score: 97.0561 bits (240), Expect = 8.029e-22
Identity = 47/91 (51.65%), Postives = 57/91 (62.64%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQK--NFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F+WMK+KR+ PK  K   +     P  +                  RTNF+ KQLTELEKEFHFN+YLTRARRIEIAN + L++TQVKIWF
Sbjct:  205 FEWMKVKRNAPKKSKLSEYGATSPPSAI------------------RTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWF 277          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxa1 (homeobox A1 [Source:MGI Symbol;Acc:MGI:96170])

HSP 1 Score: 96.6709 bits (239), Expect = 1.330e-21
Identity = 51/89 (57.30%), Postives = 61/89 (68.54%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK+ K     E         Y +  Q   N++  RTNFT KQLTELEKEFHFN+YLTRARR+EIA S+ L+ETQVKIWF
Sbjct:  206 FDWMKVKRNPPKTGK---VGE---------YGYVGQP--NAV--RTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWF 278          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxb1 (homeobox B1 [Source:MGI Symbol;Acc:MGI:96182])

HSP 1 Score: 93.9745 bits (232), Expect = 6.800e-21
Identity = 51/106 (48.11%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  898 NESSFSGNPVQNTP-PFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITG-RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
             ES  S  P   TP  F WMK+KR+ PK+ K                    +    +  G RTNFT +QLTELEKEFHFN+YL+RARR+EIA ++ L+ETQVKIWF
Sbjct:  160 KESPCSSEPSTLTPRTFDWMKVKRNPPKTAKV------------------SELGLGAPGGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWF 247          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxd3 (homeobox D3 [Source:MGI Symbol;Acc:MGI:96207])

HSP 1 Score: 78.9518 bits (193), Expect = 2.297e-15
Identity = 42/91 (46.15%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGR--TNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK  R + K QKN        C        ED+S     + R  T +T+ QL ELEKEFHFN+YL R RR+E+AN + L+E Q+KIWF
Sbjct:  162 FPWMKESRQNSK-QKNSCATSGENC--------EDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWF 243          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxd3 (homeobox D3 [Source:MGI Symbol;Acc:MGI:96207])

HSP 1 Score: 78.9518 bits (193), Expect = 2.297e-15
Identity = 42/91 (46.15%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGR--TNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK  R + K QKN        C        ED+S     + R  T +T+ QL ELEKEFHFN+YL R RR+E+AN + L+E Q+KIWF
Sbjct:  162 FPWMKESRQNSK-QKNSCATSGENC--------EDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWF 243          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9IA19|HXA1_HETFR (Homeobox protein Hox-A1 OS=Heterodontus francisci OX=7792 GN=HOXA1 PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 4.456e-23
Identity = 55/100 (55.00%), Postives = 64/100 (64.00%), Query Frame = 1
Query:  922 PVQNTPP----FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            P   TPP    F WMK+KR+ PK+ K            A  Y F  Q +    T RTNFT KQLTELEKEFHFN+YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  186 PSAETPPPAQTFDWMKVKRNPPKTGK------------AGEYGFAGQPN----TVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWF 269          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q08821|HXA1_XENLA (Homeobox protein Hox-A1 (Fragment) OS=Xenopus laevis OX=8355 GN=hoxa1 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.040e-22
Identity = 54/102 (52.94%), Postives = 64/102 (62.75%), Query Frame = 1
Query:  904 SSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            S  S  P Q    F WMK+KR+ PK+ K            A  Y +  Q +    T RTNFT KQLTELEKEFHFN+YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  100 SETSPGPTQT---FDWMKVKRNPPKTGK------------AGEYGYAGQPN----TARTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWF 182          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q90346|HXB1_CYPCA (Homeobox protein Hox-B1 OS=Cyprinus carpio OX=7962 GN=hoxb1 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.124e-21
Identity = 69/183 (37.70%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  670 NNSNYCYYYDQGRNIYCLNDNSNGTISSLPNLLHDYEMSLSRNHEIDYDYFNKAFLRIPSENTTDRRDTSIINEMYNESSFSGNPVQNTPP---FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            +NSN   +Y      YC    + G + + P   H  E    ++H+  Y     A L   S +    RDT                   +PP   F WMK+KR+ PK+ K       PQ               N+I  RTNFT KQLTELEKEFHF++YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  130 SNSNLGPHYGSMAGAYC---GAQGAVPAAPYQHHGCE---GQDHQRGYSQGTYADL---SRSQGRERDTD-----------------QSPPGKTFDWMKVKRNPPKTAKVADYGLGPQ---------------NTI--RTNFTTKQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKIWF 269          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28IU6|HXD1_XENTR (Homeobox protein Hox-D1 OS=Xenopus tropicalis OX=8364 GN=hoxd1 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.643e-21
Identity = 51/89 (57.30%), Postives = 60/89 (67.42%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK           + LQ+ Y       +    T RTNFT KQLTELEKEFHFN+YLTRARRIEIANS+ L++TQVKIWF
Sbjct:  179 FDWMKVKRNPPK-----------KSLQSEY-----GVASPPCTVRTNFTTKQLTELEKEFHFNKYLTRARRIEIANSLQLNDTQVKIWF 251          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q98SI1|HXA1A_DANRE (Homeobox protein Hox-A1a OS=Danio rerio OX=7955 GN=hoxa1a PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.571e-21
Identity = 54/98 (55.10%), Postives = 63/98 (64.29%), Query Frame = 1
Query:  916 GNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            G P   T  F WMK+KR+ PK+ K            A  Y F  Q +    T RTNF+ KQLTELEKEFHFN+YLTRARR+EIA S+ L+ETQVKIWF
Sbjct:  194 GVPTGQT--FDWMKVKRNPPKTGK------------AGEYGFGGQPN----TVRTNFSTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWF 273          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1S6KMH9 (Homeobox domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 3.334e-77
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 1
Query:  892 MYNESSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWFXXXXXXXXXXXXXXXVDLCSSEDSRK 1287
            MYNESSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWFQNRRMKQKRRQKARKVDLCSSEDSRK
Sbjct:    1 MYNESSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWFQNRRMKQKRRQKARKVDLCSSEDSRK 132          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: Q26084 (Homeodomain protein (Fragment) OS=Polycelis nigra OX=39786 GN=Pnox3 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.852e-28
Identity = 56/65 (86.15%), Postives = 61/65 (93.85%), Query Frame = 1
Query: 1018 LQALYYSFEDQSSFNS-ITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            LQA YYSF+DQ+S+N+ ITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIA SM LSETQ+KIWF
Sbjct:    7 LQAFYYSFDDQASYNNNITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIAKSMTLSETQIKIWF 71          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A4D6QHH5 (Hox1 OS=Lottia goshimai OX=1824450 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.124e-22
Identity = 65/136 (47.79%), Postives = 80/136 (58.82%), Query Frame = 1
Query:  835 LRIPSENTTDRRDTSIINE-MYNESSFSGNPVQN---------TPPFQWMKIKRHHPK-SQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            +R P  ++ D     II    Y   S  G+P+++         + PF+WM IKR+  K + K       P    A       Q+  NS  GRTNFTNKQLTELEKEFHFN+YLTRARRIEIA S+GL+ETQVKIWF
Sbjct:  119 VRTPYNSSPDHMRGGIIGSNGYTHQSPGGSPIKSDQSSTSGYSSKPFRWMTIKRNGMKPAGKPGEYGYTPPSTAA------PQTGPNS--GRTNFTNKQLTELEKEFHFNKYLTRARRIEIAASLGLNETQVKIWF 246          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: F7J6K0 (Hox1 (Fragment) OS=Nipponacmea fuscoviridis OX=225302 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.659e-22
Identity = 64/136 (47.06%), Postives = 79/136 (58.09%), Query Frame = 1
Query:  835 LRIPSENTTDRRDTSIINE-MYNESSFSGNPVQN---------TPPFQWMKIKRHHPK-SQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            +R P  ++ +     II    Y   S  G+P+++         + PF+WM IKR   K + K       P    A       Q+  NS  GRTNFTNKQLTELEKEFHFN+YLTRARRIEIA S+GL+ETQVKIWF
Sbjct:  107 VRTPYNSSPEHMRGGIIGSNGYTHQSPGGSPIKSDQSSTSGYSSKPFRWMTIKRDGMKPAGKPGEYGYTPPSTAA------PQTGPNS--GRTNFTNKQLTELEKEFHFNKYLTRARRIEIAASLGLNETQVKIWF 234          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: R7TLA0 (Labial hox protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_219807 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 4.503e-22
Identity = 53/90 (58.89%), Postives = 64/90 (71.11%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYS-FEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            ++WM +KR  PK+      + N +   A  +S F  Q +     GRTNFTNKQLTELEKEFHFN+YLTRARRIEIA S+GL+ETQVKIWF
Sbjct:  183 YKWMTVKRGTPKTSNTAYNHPNAKAPGAGDFSVFAGQPNM----GRTNFTNKQLTELEKEFHFNKYLTRARRIEIAASLGLNETQVKIWF 268          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxb1b (homeobox B1b [Source:NCBI gene;Acc:30374])

HSP 1 Score: 97.8265 bits (242), Expect = 2.521e-22
Identity = 52/106 (49.06%), Postives = 67/106 (63.21%), Query Frame = 1
Query:  892 MYNESSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            M+ ++    +P    P F WMK+KR+ PK+            ++A  Y    Q   N I  RTNFT KQLTELEKEFHFN+YLTRARR+E+A ++ L+ETQVKIWF
Sbjct:  167 MHTDNDSRKSPNNQAPTFDWMKVKRNPPKT------------VKAAEYGIHGQQ--NMI--RTNFTTKQLTELEKEFHFNKYLTRARRVEVAATLELNETQVKIWF 256          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032778.1 (homeobox protein Hox-C1a-like [Source:NCBI gene;Acc:103035191])

HSP 1 Score: 95.9005 bits (237), Expect = 1.103e-21
Identity = 50/97 (51.55%), Postives = 62/97 (63.92%), Query Frame = 1
Query:  925 VQNTPPFQWMKIKRHHPKSQKNFSTNEN--PQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            +Q+   F+WMK+KR  P+             Q       S  D SS    + RTNF+ KQLTELEKEFHF++YLTRARR+EIA+S+ LSETQVKIWF
Sbjct:  164 IQSGKTFEWMKVKRRQPRGVGASVCGHGLLGQVFCGGKSSSNDFSSGQPGSPRTNFSTKQLTELEKEFHFSRYLTRARRVEIASSLQLSETQVKIWF 260          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxb1a (homeobox B1 [Source:NCBI gene;Acc:103047504])

HSP 1 Score: 95.5153 bits (236), Expect = 1.905e-21
Identity = 49/89 (55.06%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK+ K       PQ               N+I  RTNFT KQLTELEKEFHF++YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  197 FDWMKVKRNPPKTAKVAEFGLGPQ---------------NTI--RTNFTTKQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKIWF 268          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxa1a (homeobox A1a [Source:NCBI gene;Acc:58051])

HSP 1 Score: 95.5153 bits (236), Expect = 2.511e-21
Identity = 49/89 (55.06%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK+ K               Y +  Q +    T RTNFT KQLTELEKEFHFN+YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  212 FDWMKVKRNPPKTGK------------VGEYGYGGQPN----TVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWF 284          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000057732.1 (homeobox protein Hox-A5 [Source:NCBI gene;Acc:103047329])

HSP 1 Score: 92.0485 bits (227), Expect = 1.539e-20
Identity = 59/113 (52.21%), Postives = 72/113 (63.72%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWFXXXXXXXXXXXXXXXVDLCSSEDS 1281
            F WM+IKR  P+S                  S     +   +T RT+FTN+QLTELEKEFHFN+Y++R RR EIA S+ LSETQVKIWFQNRRMKQK+R+K   +  CS  DS
Sbjct:  155 FDWMRIKRKLPQS-----------------CSLPCGITRADVTARTSFTNQQLTELEKEFHFNKYISRCRRAEIAKSVCLSETQVKIWFQNRRMKQKKREKEGLMPCCSRPDS 250          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007188.1 (pep scaffold:Pmarinus_7.0:GL477571:301368:307708:1 gene:ENSPMAG00000006495.1 transcript:ENSPMAT00000007188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 3.695e-19
Identity = 51/122 (41.80%), Postives = 66/122 (54.10%), Query Frame = 1
Query:  913 SGNPVQNTPP----FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNS-------------------ITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            S N  + TPP    F+WM++KR+ PK+ +    +    C Q          +                       T RTNF+ KQLTELEKEFHFN+YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  228 SPNASEPTPPSHCTFEWMRVKRNPPKTARIGDMS----CAQVGALPCGSGGAGGGGVGLSIGGGNNGLAMGGGIATQRTNFSTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWF 345          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: hoxd4a (homeobox D4a [Source:NCBI gene;Acc:30329])

HSP 1 Score: 73.1738 bits (178), Expect = 1.872e-16
Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 1
Query: 1063 SITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            S   RT +T +Q+ ELEKEFHFN+YLTR RRIEIA+S+ LSE Q+KIWF
Sbjct:    2 SKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHSLCLSERQIKIWF 50          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011116.1 (pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 gene:ENSPMAG00000010089.1 transcript:ENSPMAT00000011116.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.691e-14
Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 1
Query: 1072 GRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            GR +++  Q  ELEKEFHFN+YL R RR+EIA+S+ LSE QVKIWF
Sbjct:    4 GRRSYSRHQSLELEKEFHFNRYLARRRRVEIAHSLCLSERQVKIWF 49          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: hoxb7a (homeobox B7a [Source:NCBI gene;Acc:58044])

HSP 1 Score: 67.0106 bits (162), Expect = 1.826e-14
Identity = 29/46 (63.04%), Postives = 37/46 (80.43%), Query Frame = 1
Query: 1072 GRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            GR  ++  Q  ELEKEFHFN+YLTR RR+EIA+S+ L+E Q+KIWF
Sbjct:    7 GRQTYSRYQTLELEKEFHFNRYLTRRRRVEIAHSLCLTERQIKIWF 52          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005057.1 (pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 gene:ENSPMAG00000004598.1 transcript:ENSPMAT00000005057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 4.985e-13
Identity = 29/46 (63.04%), Postives = 35/46 (76.09%), Query Frame = 1
Query: 1072 GRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            GR  ++  Q  ELEKEF FN YLTR RRIE+++ +GLSE QVKIWF
Sbjct:   30 GRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHVLGLSERQVKIWF 75          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO45896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW6])

HSP 1 Score: 68.5514 bits (166), Expect = 7.916e-15
Identity = 30/45 (66.67%), Postives = 37/45 (82.22%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RT ++ +QL ELEKEFH+N+YL R RRIEIA S+ L+E QVKIWF
Sbjct:    5 RTIYSTRQLVELEKEFHYNRYLCRPRRIEIAQSLELTEKQVKIWF 49          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO42187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S274])

HSP 1 Score: 67.781 bits (164), Expect = 1.518e-14
Identity = 30/45 (66.67%), Postives = 38/45 (84.44%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RT++TNKQL ELEKEFHFN+YL  +RR EI+ ++ L+E QVKIWF
Sbjct:    5 RTSYTNKQLLELEKEFHFNKYLCSSRRREISKALQLTERQVKIWF 49          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: HOX6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S277])

HSP 1 Score: 72.0182 bits (175), Expect = 3.488e-14
Identity = 32/56 (57.14%), Postives = 42/56 (75.00%), Query Frame = 1
Query: 1042 EDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            ++Q+   S   R  FT +QL ELEKEFHF++YLTR RRIEIA ++ L+E Q+KIWF
Sbjct:  146 KEQNPSPSQKKRFTFTQRQLVELEKEFHFSKYLTRTRRIEIATTLKLTEMQIKIWF 201          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: ANTHOX7 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S272])

HSP 1 Score: 68.9366 bits (167), Expect = 2.051e-13
Identity = 29/45 (64.44%), Postives = 38/45 (84.44%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RT++TN+QL ELEKEFH+N+YL   RR E+AN+M L+E QVK+WF
Sbjct:  103 RTSYTNRQLLELEKEFHYNKYLCGTRRRELANAMKLTERQVKVWF 147          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO32495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX2])

HSP 1 Score: 61.2326 bits (147), Expect = 2.582e-12
Identity = 26/45 (57.78%), Postives = 38/45 (84.44%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RT FTN+Q+ +LE EF  ++YL+ +RR+E+ANS+ L+ETQ+KIWF
Sbjct:    5 RTAFTNEQIKDLEAEFQKSKYLSVSRRMELANSLSLTETQIKIWF 49          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxb1b (homeobox B1 [Source:NCBI gene;Acc:101156205])

HSP 1 Score: 95.9005 bits (237), Expect = 6.278e-22
Identity = 50/89 (56.18%), Postives = 58/89 (65.17%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK+              A+   F      N I  RTNFT KQLTELEKEFHFN+YLTRARRIE+A S+ L+ETQVKIWF
Sbjct:  163 FDWMKVKRNPPKT--------------AVQSEFGVPGQINVI--RTNFTTKQLTELEKEFHFNKYLTRARRIEVAASLDLNETQVKIWF 235          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxa1a (homeobox protein Hox-A1a [Source:NCBI gene;Acc:101160743])

HSP 1 Score: 96.2857 bits (238), Expect = 1.229e-21
Identity = 48/89 (53.93%), Postives = 60/89 (67.42%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK+KR+ PK+ ++              Y +  Q +    T RTNFT KQLTELEKEFHFN+YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  189 FDWMKVKRNPPKTGRSGE------------YGYSGQPN----TVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWF 261          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxb1a (homeobox protein Hox-B1a [Source:NCBI gene;Acc:101170520])

HSP 1 Score: 93.9745 bits (232), Expect = 1.598e-20
Identity = 47/89 (52.81%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F+WMK+KR+ PK+ K                   D  + NS   RTNFT +QLTELEKEFHF++YLTRARR+EIA ++ L+ETQVKIWF
Sbjct:  268 FEWMKVKRNPPKTVK-----------------VSDFGAHNSAM-RTNFTTRQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKIWF 338          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxd3a (homeobox D3 [Source:NCBI gene;Acc:101164107])

HSP 1 Score: 77.7962 bits (190), Expect = 4.014e-15
Identity = 40/92 (43.48%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  943 FQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITG---RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            F WMK  R + K + N        C+ A      D+ S         RT +T+ QL ELEKEFHFN+YL R RR+E+AN + L+E Q+KIWF
Sbjct:  129 FPWMKETRQNSKQKSN-------NCVAAGSGEVSDEKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWF 213          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxa5a (homeobox A5a [Source:NCBI gene;Acc:58055])

HSP 1 Score: 76.2554 bits (186), Expect = 5.379e-15
Identity = 43/98 (43.88%), Postives = 56/98 (57.14%), Query Frame = 1
Query:  925 VQNTPPFQWMKIKRHHPKSQKNFSTNENPQC---LQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            V    P +  K     P + +N S +  PQ    ++ L+ S  D S       RT +T  Q  ELEKEFHFN+YLTR RRIEIA+++ LSE Q+KIWF
Sbjct:  178 VSKASPLEDEKAAGSAPSTPQNASDSAQPQIYPWMRKLHIS-HDISGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWF 274          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000080661.1 (SMESG000080661.1)

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 377/378 (99.74%), Postives = 377/378 (99.74%), Query Frame = 1
Query:  154 MINIAPQELTNGYFIDNNKSNCLHNCCWSRRSIFNNKSSYPEININDVYFNKQALVNQKSTSEGNDSQIFGAKFLDIPLNMETVESIYNYSNSETTFDGSFSKLLNSNDCSIGSLDRNGSGEILLNQSSDLTNNLYNDNELVYTSISSNDLKPNIHQTIAFCKDPNVGNSITNNSNYCYYYDQGRNIYCLNDNSNGTISSLPNLLHDYEMSLSRNHEIDYDYFNKAFLRIPSENTTDRRDTSIINEMYNESSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWFXXXXXXXXXXXXXXXVDLCSSEDSRK 1287
            MINIAPQELTNGYFIDNNKSNCLHNCCWSRRSIFNNKSSYPEININDVY NKQALVNQKSTSEGNDSQIFGAKFLDIPLNMETVESIYNYSNSETTFDGSFSKLLNSNDCSIGSLDRNGSGEILLNQSSDLTNNLYNDNELVYTSISSNDLKPNIHQTIAFCKDPNVGNSITNNSNYCYYYDQGRNIYCLNDNSNGTISSLPNLLHDYEMSLSRNHEIDYDYFNKAFLRIPSENTTDRRDTSIINEMYNESSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWFQNRRMKQKRRQKARKVDLCSSEDSRK
Sbjct:    1 MINIAPQELTNGYFIDNNKSNCLHNCCWSRRSIFNNKSSYPEININDVYVNKQALVNQKSTSEGNDSQIFGAKFLDIPLNMETVESIYNYSNSETTFDGSFSKLLNSNDCSIGSLDRNGSGEILLNQSSDLTNNLYNDNELVYTSISSNDLKPNIHQTIAFCKDPNVGNSITNNSNYCYYYDQGRNIYCLNDNSNGTISSLPNLLHDYEMSLSRNHEIDYDYFNKAFLRIPSENTTDRRDTSIINEMYNESSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQSSFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWFQNRRMKQKRRQKARKVDLCSSEDSRK 378          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000071019.1 (SMESG000071019.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.455e-14
Identity = 33/45 (73.33%), Postives = 38/45 (84.44%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            RT +T +Q+ ELEKEFHFN+YLTR RRIEIA S+ LSE QVKIWF
Sbjct:  229 RTAYTRQQILELEKEFHFNKYLTRKRRIEIAQSLQLSERQVKIWF 273          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000044469.1 (SMESG000044469.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.425e-13
Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 1
Query: 1072 GRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
             R  ++ +Q  ELEKEF++NQYLTR RRIEIANS+ LSE Q+KIWF
Sbjct:  108 SRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWF 153          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000029666.1 (SMESG000029666.1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.383e-13
Identity = 39/109 (35.78%), Postives = 59/109 (54.13%), Query Frame = 1
Query:  919 NPVQNTPPFQWM--------KIKRHHPKSQKNFSTNENPQCLQALYYSFEDQS----SFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            N +   P ++WM        +  +   + +KN + +EN        Y+++D +    S  S   R+ +TN QL ELEKEFH+N YL R RR E++  + L+E QVKIWF
Sbjct:   21 NGIHAYPIYRWMIDTRTLSSRTAKAKKQDKKNSNESENA-------YNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWF 122          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000022667.1 (SMESG000022667.1)

HSP 1 Score: 68.9366 bits (167), Expect = 6.734e-13
Identity = 30/45 (66.67%), Postives = 36/45 (80.00%), Query Frame = 1
Query: 1075 RTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKIWF 1209
            R  +T  Q  ELEKEFHFN+YLTR RRIEIA+S+ L+E Q+KIWF
Sbjct:  167 RQTYTRHQTLELEKEFHFNKYLTRRRRIEIAHSLILTERQIKIWF 211          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXB12.831e-2151.11homeobox B1 [Source:HGNC Symbol;Acc:HGNC:5111][more]
HOXA13.260e-2157.30homeobox A1 [Source:HGNC Symbol;Acc:HGNC:5099][more]
HOXD11.302e-1953.93homeobox D1 [Source:HGNC Symbol;Acc:HGNC:5132][more]
HOXD31.974e-1546.15homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137][more]
HOXD31.974e-1546.15homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-137.691e-1443.33Homeobox protein ceh-13 [Source:UniProtKB/Swiss-P... [more]
ceh-137.691e-1443.33Homeobox protein ceh-13 [Source:UniProtKB/Swiss-P... [more]
lin-391.792e-1264.44Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
lin-391.792e-1264.44Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
ceh-121.487e-1155.56Homeobox protein ceh-12 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lab5.512e-2088.89gene:FBgn0002522 transcript:FBtr0308035[more]
lab2.865e-1988.89gene:FBgn0002522 transcript:FBtr0081696[more]
Antp5.916e-1540.87gene:FBgn0260642 transcript:FBtr0081648[more]
Antp5.916e-1540.87gene:FBgn0260642 transcript:FBtr0081651[more]
Antp7.349e-1540.87gene:FBgn0260642 transcript:FBtr0081649[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxa1a2.226e-2352.38homeobox A1a [Source:NCBI gene;Acc:58051][more]
hoxb1b1.862e-2251.58homeobox B1b [Source:NCBI gene;Acc:30374][more]
hoxa1a6.056e-2255.10homeobox A1a [Source:NCBI gene;Acc:58051][more]
hoxb1b6.946e-2251.58homeobox B1b [Source:NCBI gene;Acc:30374][more]
hoxb1a2.500e-2154.26homeobox B1a [Source:NCBI gene;Acc:30337][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxa15.138e-2353.92homeobox A1 [Source:NCBI gene;Acc:493379][more]
anxa114.989e-2257.30annexin A11 [Source:Xenbase;Acc:XB-GENE-958577][more]
dhrs71.527e-2055.06dehydrogenase/reductase (SDR family) member 7 [Sou... [more]
pbx24.948e-1750.56pre-B-cell leukemia homeobox 2 [Source:Xenbase;Acc... [more]
HOXD45.605e-1547.31homeobox D4 [Source:HGNC Symbol;Acc:HGNC:5138][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxd18.029e-2251.65homeobox D1 [Source:MGI Symbol;Acc:MGI:96201][more]
Hoxa11.330e-2157.30homeobox A1 [Source:MGI Symbol;Acc:MGI:96170][more]
Hoxb16.800e-2148.11homeobox B1 [Source:MGI Symbol;Acc:MGI:96182][more]
Hoxd32.297e-1546.15homeobox D3 [Source:MGI Symbol;Acc:MGI:96207][more]
Hoxd32.297e-1546.15homeobox D3 [Source:MGI Symbol;Acc:MGI:96207][more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9IA19|HXA1_HETFR4.456e-2355.00Homeobox protein Hox-A1 OS=Heterodontus francisci ... [more]
sp|Q08821|HXA1_XENLA3.040e-2252.94Homeobox protein Hox-A1 (Fragment) OS=Xenopus laev... [more]
sp|Q90346|HXB1_CYPCA1.124e-2137.70Homeobox protein Hox-B1 OS=Cyprinus carpio OX=7962... [more]
sp|Q28IU6|HXD1_XENTR2.643e-2157.30Homeobox protein Hox-D1 OS=Xenopus tropicalis OX=8... [more]
sp|Q98SI1|HXA1A_DANRE4.571e-2155.10Homeobox protein Hox-A1a OS=Danio rerio OX=7955 GN... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMH93.334e-77100.00Homeobox domain-containing protein OS=Schmidtea me... [more]
Q260841.852e-2886.15Homeodomain protein (Fragment) OS=Polycelis nigra ... [more]
A0A4D6QHH52.124e-2247.79Hox1 OS=Lottia goshimai OX=1824450 PE=2 SV=1[more]
F7J6K02.659e-2247.06Hox1 (Fragment) OS=Nipponacmea fuscoviridis OX=225... [more]
R7TLA04.503e-2258.89Labial hox protein OS=Capitella teleta OX=283909 G... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxb1b2.521e-2249.06homeobox B1b [Source:NCBI gene;Acc:30374][more]
ENSAMXT00000032778.11.103e-2151.55homeobox protein Hox-C1a-like [Source:NCBI gene;Ac... [more]
hoxb1a1.905e-2155.06homeobox B1 [Source:NCBI gene;Acc:103047504][more]
hoxa1a2.511e-2155.06homeobox A1a [Source:NCBI gene;Acc:58051][more]
ENSAMXT00000057732.11.539e-2052.21homeobox protein Hox-A5 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007188.13.695e-1941.80pep scaffold:Pmarinus_7.0:GL477571:301368:307708:1... [more]
hoxd4a1.872e-1667.35homeobox D4a [Source:NCBI gene;Acc:30329][more]
ENSPMAT00000011116.11.691e-1465.22pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 ge... [more]
hoxb7a1.826e-1463.04homeobox B7a [Source:NCBI gene;Acc:58044][more]
ENSPMAT00000005057.14.985e-1363.04pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 g... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458967.916e-1566.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421871.518e-1466.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HOX63.488e-1457.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTHOX72.051e-1364.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324952.582e-1257.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxb1b6.278e-2256.18homeobox B1 [Source:NCBI gene;Acc:101156205][more]
hoxa1a1.229e-2153.93homeobox protein Hox-A1a [Source:NCBI gene;Acc:101... [more]
hoxb1a1.598e-2052.81homeobox protein Hox-B1a [Source:NCBI gene;Acc:101... [more]
hoxd3a4.014e-1543.48homeobox D3 [Source:NCBI gene;Acc:101164107][more]
hoxa5a5.379e-1543.88homeobox A5a [Source:NCBI gene;Acc:58055][more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080661.10.000e+099.74SMESG000080661.1[more]
SMESG000071019.11.455e-1473.33SMESG000071019.1[more]
SMESG000044469.11.425e-1365.22SMESG000044469.1[more]
SMESG000029666.14.383e-1335.78SMESG000029666.1[more]
SMESG000022667.16.734e-1366.67SMESG000022667.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023971 ID=SMED30023971|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1405bp
GTCTTTGCAACCCACTCCCCATTTGTTGTTATCACCAATCGACAAAGAGT
TGATTATAAACAAAAGATGTGCCAGAGAAAAGTCTGTGGCAAAAATCAAG
TTAGAAAGTCATTTGTAAACAACAGTTAATAAATTGTATTCCTTAACAAA
AAAATGATTAATATAGCCCCCCAGGAATTGACGAATGGATATTTCATTGA
TAATAATAAATCAAATTGTCTCCACAATTGCTGTTGGAGCCGCCGATCGA
TTTTCAACAATAAATCGTCATATCCAGAGATAAATATCAACGATGTATAT
TTCAACAAACAAGCATTGGTCAACCAAAAATCGACCTCAGAAGGCAATGA
TTCGCAAATATTTGGTGCTAAATTTCTTGATATTCCATTGAATATGGAAA
CTGTTGAGTCAATTTATAATTATTCCAACAGCGAAACAACTTTTGATGGT
AGCTTTAGTAAATTGCTTAACAGTAACGATTGCAGCATTGGATCTCTAGA
TAGAAATGGTTCTGGAGAGATTTTATTAAATCAGTCCTCGGATTTAACAA
ATAATCTGTATAACGATAATGAATTGGTTTATACGTCGATTTCTAGTAAC
GATTTAAAACCGAATATCCATCAAACAATAGCTTTCTGTAAAGATCCAAA
TGTTGGCAACAGTATAACAAATAATTCAAATTATTGTTATTACTATGACC
AAGGTCGAAACATTTATTGTTTGAATGATAACTCAAACGGGACTATTTCA
AGTTTACCGAATCTTTTACACGACTATGAAATGTCTTTATCAAGAAATCA
TGAAATAGATTATGATTATTTTAATAAAGCATTCTTGAGAATACCTTCAG
AGAATACAACCGACAGACGAGATACGAGTATTATCAATGAAATGTACAAT
GAATCAAGTTTTAGTGGCAATCCTGTACAAAATACACCTCCATTTCAATG
GATGAAAATAAAAAGACATCATCCAAAATCTCAAAAAAATTTTTCAACGA
ATGAAAATCCACAATGTTTACAAGCATTATATTACTCTTTCGAAGATCAA
AGCTCATTCAATAGCATAACAGGTCGGACAAATTTCACTAACAAACAGCT
GACTGAATTAGAAAAAGAATTTCATTTCAACCAGTATTTGACCAGAGCAA
GAAGAATAGAAATAGCAAACTCGATGGGATTAAGTGAAACCCAAGTCAAA
ATATGGTTTCAAAATCGACGAATGAAGCAAAAACGTCGTCAAAAGGCCAG
GAAAGTTGATTTGTGTTCATCTGAAGATTCAAGAAAATGACTATAAATTT
TGAGAATGTGAATTTACATATCACGTTATCTTAAGTGTACATAAGGGTGA
TAATGTATTTTTGCTGTGTATCAAGTATAACTTGAATATTTTGTATAATT
ATTAT
back to top

protein sequence of SMED30023971-orf-1

>SMED30023971-orf-1 ID=SMED30023971-orf-1|Name=SMED30023971-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=379bp
MINIAPQELTNGYFIDNNKSNCLHNCCWSRRSIFNNKSSYPEININDVYF
NKQALVNQKSTSEGNDSQIFGAKFLDIPLNMETVESIYNYSNSETTFDGS
FSKLLNSNDCSIGSLDRNGSGEILLNQSSDLTNNLYNDNELVYTSISSND
LKPNIHQTIAFCKDPNVGNSITNNSNYCYYYDQGRNIYCLNDNSNGTISS
LPNLLHDYEMSLSRNHEIDYDYFNKAFLRIPSENTTDRRDTSIINEMYNE
SSFSGNPVQNTPPFQWMKIKRHHPKSQKNFSTNENPQCLQALYYSFEDQS
SFNSITGRTNFTNKQLTELEKEFHFNQYLTRARRIEIANSMGLSETQVKI
WFQNRRMKQKRRQKARKVDLCSSEDSRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR000047HTH_motif
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000047Helix-turn-helix motifPRINTSPR00031HTHREPRESSRcoord: 342..358
score: 66.36
coord: 333..342
score: 38.25
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 326..337
score: 49.27
coord: 351..360
score: 80.35
coord: 341..351
score: 58.99
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 304..366
e-value: 4.2E-27
score: 106.0
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 307..361
e-value: 8.8E-23
score: 79.9
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 308..362
score: 20.568
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 308..363
e-value: 2.04438E-24
score: 92.6916
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 256..366
e-value: 4.6E-32
score: 112.0
NoneNo IPR availablePANTHERPTHR45946FAMILY NOT NAMEDcoord: 249..366
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 337..360
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 296..364