LIM domain only protein 3

Overview
NameLIM domain only protein 3
Smed IDSMED30023969
Length (bp)1037
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM domain only protein 3 (SMED30023969) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM domain only protein 3 (SMED30023969) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM domain only protein 3 (SMED30023969) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM domain only protein 3 (SMED30023969) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023969

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30023969h1SMcG0002315 SMED30023969smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermal progenitor cellSMED30023969h1SMcG0002315 SMED30023969smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30023969h1SMcG0002315 SmedASXL_001773SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Category 2 cellSMED30023969h1SMcG0002315 SMED30023969smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30023969h1SMcG0002315 SMED30023969smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30023969h1SMcG0002315 SMED30023969smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30023969h1SMcG0002315 Contig4531GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30023969h1SMcG0002315 dd_Smed_v4_6263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023969h1SMcG0002315 dd_Smed_v4_6263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023969h1SMcG0002315 dd_Smed_v4_6263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023969h1SMcG0002315 dd_Smed_v4_6263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023969h1SMcG0002315 dd_Smed_v4_6263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30023969h1SMcG0002315 dd_Smed_v4_6263_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM domain only protein 3 vs. Ensembl Human
Match: LMO1 (LIM domain only 1 [Source:HGNC Symbol;Acc:HGNC:6641])

HSP 1 Score: 151.369 bits (381), Expect = 1.360e-44
Identity = 81/136 (59.56%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE  L     SQ+
Sbjct:    9 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Human
Match: LMO1 (LIM domain only 1 [Source:HGNC Symbol;Acc:HGNC:6641])

HSP 1 Score: 151.369 bits (381), Expect = 1.828e-44
Identity = 81/136 (59.56%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE  L     SQ+
Sbjct:   20 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQV 155          
BLAST of LIM domain only protein 3 vs. Ensembl Human
Match: LMO1 (LIM domain only 1 [Source:HGNC Symbol;Acc:HGNC:6641])

HSP 1 Score: 151.369 bits (381), Expect = 2.016e-44
Identity = 81/136 (59.56%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE  L     SQ+
Sbjct:   19 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQV 154          
BLAST of LIM domain only protein 3 vs. Ensembl Human
Match: LMO3 (LIM domain only 3 [Source:HGNC Symbol;Acc:HGNC:6643])

HSP 1 Score: 150.599 bits (379), Expect = 2.729e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Human
Match: LMO3 (LIM domain only 3 [Source:HGNC Symbol;Acc:HGNC:6643])

HSP 1 Score: 150.599 bits (379), Expect = 2.729e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 60.077 bits (144), Expect = 7.042e-10
Identity = 39/123 (31.71%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIM 784
            CT CQ  I +   L +D + +HE+CL+C+ C      + +  + +     CK  Y R  G    C +CD+ I A + V RA ++VYHL CF C +C  +   G++  L    +LC+  + E++
Sbjct:   98 CTQCQHQIQDKFFLSIDGRNYHENCLQCSTCE---NPLSNKCFYKDKTFYCKGCYFRELGP--KCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHFLELV 215          
BLAST of LIM domain only protein 3 vs. Ensembl Celegans
Match: lin-11 (pep chromosome:WBcel235:I:10248256:10255327:1 gene:WBGene00003000.1 transcript:ZC247.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-11)

HSP 1 Score: 58.151 bits (139), Expect = 2.857e-9
Identity = 36/121 (29.75%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLY-GNRILCEADYE 775
            C +C + I + ++  V  + WH+    C  C      +  + ++R  L+LCK D+ R +     C  CD  +   +LV RA   V+H+ CF C  C      GD+ Y+  GNR +C++D++
Sbjct:   68 CAACAQPILDRYVFTVLGKCWHQ---SCLRCCDCRAPMSMTCFSRDGLILCKTDFSRRYSQ--RCAGCDGKLEKEDLVRRARDKVFHIRCFQCSVCQRLLDTGDQLYIMEGNRFVCQSDFQ 183          
BLAST of LIM domain only protein 3 vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 57.3806 bits (137), Expect = 5.469e-9
Identity = 38/123 (30.89%), Postives = 63/123 (51.22%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIM 784
            CT CQ  I +   L +D + +HE+CL+C+ C      + +  + +     CK  Y R       C +CD+ I A + V RA ++VYHL CF C +C  +   G++  L    +LC+  + E++
Sbjct:   98 CTQCQHQIQDKFFLSIDGRNYHENCLQCSTCE---NPLSNKCFYKDKTFYCKGCYFRCRELGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHFLELV 217          
BLAST of LIM domain only protein 3 vs. Ensembl Celegans
Match: ceh-14 (Homeobox protein ceh-14 [Source:UniProtKB/Swiss-Prot;Acc:P20271])

HSP 1 Score: 55.0694 bits (131), Expect = 2.450e-8
Identity = 39/136 (28.68%), Postives = 76/136 (55.88%), Query Frame = 2
Query:  377 MNSSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGN--RILCEADYEE 778
            +N+ + N E++  C+ C + I +  + KV+ + +H     C  C+    E+G++ + R D + C+  + + FG+   C++C++ I    +V +A + VYH+ECF C  C      G++ YL  +  R++C+ DYE+
Sbjct:   36 VNAGHPNNEEA-ICSLCDKKIRDRFVSKVNGRCYH---SSCLRCSTCKDELGATCFLREDSMYCRAHFYKKFGT--KCSSCNEGIVPDHVVRKASNHVYHVECFQCFICKRSLETGEEFYLIADDARLVCKDDYEQ 165          
BLAST of LIM domain only protein 3 vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 53.5286 bits (127), Expect = 9.239e-8
Identity = 39/132 (29.55%), Postives = 66/132 (50.00%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGS--------IG-YCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIM 784
            CT CQ  I +   L +D + +HE+CL+C+ C      + +  + +     CK  Y R   +        +G  C +CD+ I A + V RA ++VYHL CF C +C  +   G++  L    +LC+  + E++
Sbjct:   98 CTQCQHQIQDKFFLSIDGRNYHENCLQCSTCE---NPLSNKCFYKDKTFYCKGCYFRTHVTSTASSCRELGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHFLELV 226          
BLAST of LIM domain only protein 3 vs. Ensembl Fly
Match: Bx (gene:FBgn0265598 transcript:FBtr0340364)

HSP 1 Score: 156.377 bits (394), Expect = 9.154e-45
Identity = 83/137 (60.58%), Postives = 106/137 (77.37%), Query Frame = 2
Query:  407 SPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPL 817
            S  C  C + I + +LL+  +  WHEDCL+C CC+CRLGEVGS+LY + +L+LCKRDYLR+FG+ GYC AC KVIPAFE+VMRA + VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE +++  +A+   L
Sbjct:   89 SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMANHPML 225          
BLAST of LIM domain only protein 3 vs. Ensembl Fly
Match: Bx (gene:FBgn0265598 transcript:FBtr0340366)

HSP 1 Score: 156.377 bits (394), Expect = 9.154e-45
Identity = 83/137 (60.58%), Postives = 106/137 (77.37%), Query Frame = 2
Query:  407 SPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPL 817
            S  C  C + I + +LL+  +  WHEDCL+C CC+CRLGEVGS+LY + +L+LCKRDYLR+FG+ GYC AC KVIPAFE+VMRA + VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE +++  +A+   L
Sbjct:   89 SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMANHPML 225          
BLAST of LIM domain only protein 3 vs. Ensembl Fly
Match: Bx (gene:FBgn0265598 transcript:FBtr0340363)

HSP 1 Score: 157.147 bits (396), Expect = 2.304e-44
Identity = 81/131 (61.83%), Postives = 104/131 (79.39%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQ 808
            C  C + I + +LL+  +  WHEDCL+C CC+CRLGEVGS+LY + +L+LCKRDYLR+FG+ GYC AC KVIPAFE+VMRA + VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE +++  +A+ 
Sbjct:  162 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMANH 292          
BLAST of LIM domain only protein 3 vs. Ensembl Fly
Match: Bx (gene:FBgn0265598 transcript:FBtr0340365)

HSP 1 Score: 155.606 bits (392), Expect = 8.277e-44
Identity = 83/137 (60.58%), Postives = 106/137 (77.37%), Query Frame = 2
Query:  407 SPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPL 817
            S  C  C + I + +LL+  +  WHEDCL+C CC+CRLGEVGS+LY + +L+LCKRDYLR+FG+ GYC AC KVIPAFE+VMRA + VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE +++  +A+   L
Sbjct:  160 SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMANHPML 296          
BLAST of LIM domain only protein 3 vs. Ensembl Fly
Match: Bx (gene:FBgn0265598 transcript:FBtr0340367)

HSP 1 Score: 156.377 bits (394), Expect = 8.495e-44
Identity = 83/137 (60.58%), Postives = 106/137 (77.37%), Query Frame = 2
Query:  407 SPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPL 817
            S  C  C + I + +LL+  +  WHEDCL+C CC+CRLGEVGS+LY + +L+LCKRDYLR+FG+ GYC AC KVIPAFE+VMRA + VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE +++  +A+   L
Sbjct:   89 SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMANHPML 225          
BLAST of LIM domain only protein 3 vs. Ensembl Zebrafish
Match: lmo3 (LIM domain only 3 [Source:NCBI gene;Acc:553774])

HSP 1 Score: 150.599 bits (379), Expect = 1.774e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Zebrafish
Match: lmo3 (LIM domain only 3 [Source:NCBI gene;Acc:553774])

HSP 1 Score: 150.599 bits (379), Expect = 1.774e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Zebrafish
Match: lmo3 (LIM domain only 3 [Source:NCBI gene;Acc:553774])

HSP 1 Score: 150.599 bits (379), Expect = 2.235e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:   20 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 155          
BLAST of LIM domain only protein 3 vs. Ensembl Zebrafish
Match: lmo1 (LIM domain only 1 [Source:NCBI gene;Acc:280646])

HSP 1 Score: 150.599 bits (379), Expect = 2.656e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE  L     +Q+
Sbjct:   19 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGSFETQV 154          
BLAST of LIM domain only protein 3 vs. Ensembl Zebrafish
Match: lmo3 (LIM domain only 3 [Source:NCBI gene;Acc:553774])

HSP 1 Score: 150.984 bits (380), Expect = 2.720e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:   31 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 166          
BLAST of LIM domain only protein 3 vs. Ensembl Xenopus
Match: lmo2 (LIM domain only 2 [Source:NCBI gene;Acc:496679])

HSP 1 Score: 117.087 bits (292), Expect = 2.692e-31
Identity = 66/128 (51.56%), Postives = 81/128 (63.28%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKI 799
            C  CQ+ I + + LK  +QYWHEDCL C+ C CRLGEVG  LY +    LC+RDYLR+FG  G C +CDK I AFE+ MR    VYHLECF C  C   FCVGD+  L  + I+CE D  E    N++
Sbjct:   27 CGGCQQSIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAFEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKLNEM 154          
BLAST of LIM domain only protein 3 vs. Ensembl Xenopus
Match: lmo2 (LIM domain only 2 [Source:NCBI gene;Acc:496679])

HSP 1 Score: 116.316 bits (290), Expect = 3.805e-31
Identity = 66/128 (51.56%), Postives = 81/128 (63.28%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKI 799
            C  CQ+ I + + LK  +QYWHEDCL C+ C CRLGEVG  LY +    LC+RDYLR+FG  G C +CDK I AFE+ MR    VYHLECF C  C   FCVGD+  L  + I+CE D  E    N++
Sbjct:   24 CGGCQQSIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAFEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKLNEM 151          
BLAST of LIM domain only protein 3 vs. Ensembl Xenopus
Match: lmo2 (LIM domain only 2 [Source:NCBI gene;Acc:496679])

HSP 1 Score: 116.316 bits (290), Expect = 4.464e-31
Identity = 66/128 (51.56%), Postives = 81/128 (63.28%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKI 799
            C  CQ+ I + + LK  +QYWHEDCL C+ C CRLGEVG  LY +    LC+RDYLR+FG  G C +CDK I AFE+ MR    VYHLECF C  C   FCVGD+  L  + I+CE D  E    N++
Sbjct:   30 CGGCQQSIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAFEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKLNEM 157          
BLAST of LIM domain only protein 3 vs. Ensembl Xenopus
Match: lmo4.2 (LIM domain only 4, gene 2 [Source:NCBI gene;Acc:548539])

HSP 1 Score: 105.916 bits (263), Expect = 5.553e-27
Identity = 62/150 (41.33%), Postives = 89/150 (59.33%), Query Frame = 2
Query:  377 MNSSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIML---YNKIASQIPL 817
            ++ SN    K+  C  C   IA+  LL    +YWH  CL+C+CC  +LGE+G+S Y ++ ++LC+ DY+R+FGS G C+AC + IPA E+VMRA   VYHL+CF C  C +R   GD+ +     I CE D    +L    N + S  P+
Sbjct:   13 LSLSNGGPPKA--CAGCGGKIADRFLLYSMERYWHTRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYIRLFGSSGACSACGQSIPASEMVMRAQGSVYHLKCFTCATCRNRLVPGDRFHYVNGAIFCEHDRPTGLLSGHLNPLQSNPPM 160          
BLAST of LIM domain only protein 3 vs. Ensembl Xenopus
Match: lmo4.2 (LIM domain only 4, gene 2 [Source:NCBI gene;Acc:548539])

HSP 1 Score: 106.686 bits (265), Expect = 1.499e-26
Identity = 63/148 (42.57%), Postives = 88/148 (59.46%), Query Frame = 2
Query:  383 SSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIML---YNKIASQIPL 817
            SSN    K+  C  C   IA+  LL    +YWH  CL+C+CC  +LGE+G+S Y ++ ++LC+ DY+R+FGS G C+AC + IPA E+VMRA   VYHL+CF C  C +R   GD+ +     I CE D    +L    N + S  P+
Sbjct:   85 SSNGGPPKA--CAGCGGKIADRFLLYSMERYWHTRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYIRLFGSSGACSACGQSIPASEMVMRAQGSVYHLKCFTCATCRNRLVPGDRFHYVNGAIFCEHDRPTGLLSGHLNPLQSNPPM 230          
BLAST of LIM domain only protein 3 vs. Ensembl Mouse
Match: Lmo1 (LIM domain only 1 [Source:MGI Symbol;Acc:MGI:102812])

HSP 1 Score: 150.984 bits (380), Expect = 1.260e-44
Identity = 81/136 (59.56%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE  L     SQ+
Sbjct:    9 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQVDYEEGHLNGTFESQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Mouse
Match: Lmo3 (LIM domain only 3 [Source:MGI Symbol;Acc:MGI:102810])

HSP 1 Score: 150.599 bits (379), Expect = 1.874e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Mouse
Match: Lmo3 (LIM domain only 3 [Source:MGI Symbol;Acc:MGI:102810])

HSP 1 Score: 150.599 bits (379), Expect = 1.874e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Mouse
Match: Lmo3 (LIM domain only 3 [Source:MGI Symbol;Acc:MGI:102810])

HSP 1 Score: 150.599 bits (379), Expect = 1.874e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Mouse
Match: Lmo3 (LIM domain only 3 [Source:MGI Symbol;Acc:MGI:102810])

HSP 1 Score: 150.599 bits (379), Expect = 1.874e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. UniProt/SwissProt
Match: sp|Q99MB5|LMO3_RAT (LIM domain only protein 3 OS=Rattus norvegicus OX=10116 GN=Lmo3 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 5.681e-44
Identity = 80/136 (58.82%), Postives = 101/136 (74.26%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. UniProt/SwissProt
Match: sp|P25800|RBTN1_HUMAN (Rhombotin-1 OS=Homo sapiens OX=9606 GN=LMO1 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 8.779e-44
Identity = 81/136 (59.56%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE  L     SQ+
Sbjct:   20 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQV 155          
BLAST of LIM domain only protein 3 vs. UniProt/SwissProt
Match: sp|Q3B8H4|RBTN1_XENLA (Rhombotin-1 OS=Xenopus laevis OX=8355 GN=lmo1 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.172e-43
Identity = 81/136 (59.56%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE  L     SQ+
Sbjct:   20 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGSFDSQV 155          
BLAST of LIM domain only protein 3 vs. UniProt/SwissProt
Match: sp|Q5RBW7|LMO3_PONAB (LIM domain only protein 3 OS=Pongo abelii OX=9601 GN=LMO3 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.311e-43
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. UniProt/SwissProt
Match: sp|Q8BZL8|LMO3_MOUSE (LIM domain only protein 3 OS=Mus musculus OX=10090 GN=Lmo3 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.311e-43
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. TrEMBL
Match: H9IV77 (Uncharacterized protein OS=Bombyx mori OX=7091 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 7.932e-48
Identity = 90/144 (62.50%), Postives = 111/144 (77.08%), Query Frame = 2
Query:  383 SSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIP 814
            +S  N  +   C  C +VI E +LLK  +Q WHEDCL+C CC+CRLGEVG +LY RA+L+LCKRDYLR+FG+ GYC AC+KVIPAFE+VMRA S VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE +++  +A   P
Sbjct:   25 TSAQNPPQPQICAGCSKVITERYLLKALDQLWHEDCLKCGCCDCRLGEVGHTLYTRANLILCKRDYLRLFGNTGYCAACNKVIPAFEMVMRARSNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFANMAYNPP 168          
BLAST of LIM domain only protein 3 vs. TrEMBL
Match: A0A194QA69 (Rhombotin-1 OS=Papilio xuthus OX=66420 GN=RR46_05099 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.363e-47
Identity = 93/155 (60.00%), Postives = 114/155 (73.55%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIP----LTGSFVF*SSDPTISVLS 868
            C  C +VI E +LLK  +Q WHEDCL+C CC+CRLGEVG +LY RA+L+LCKRDYLR+FG+ GYC AC+KVIPAFE+VMRA S VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE +++  +A   P    L       S  PT + +S
Sbjct:   32 CAGCSKVITERYLLKALDQLWHEDCLKCGCCDCRLGEVGHTLYTRANLILCKRDYLRLFGNTGYCAACNKVIPAFEMVMRARSNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFANMAYNPPPLAHLKRQTTHLSPPPTSNAMS 186          
BLAST of LIM domain only protein 3 vs. TrEMBL
Match: Q2F5Q2 (Beadex/dLMO protein OS=Bombyx mori OX=7091 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.885e-47
Identity = 90/144 (62.50%), Postives = 111/144 (77.08%), Query Frame = 2
Query:  383 SSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIP 814
            +S  N  +   C  C +VI E +LLK  +Q WHEDCL+C CC+CRLGEVG +LY RA+L+LCKRDYLR+FG+ GYC AC+KVIPAFE+VMRA S VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE +++  +A   P
Sbjct:   45 TSAQNPPQPQICAGCSKVITERYLLKALDQLWHEDCLKCGCCDCRLGEVGHTLYTRANLILCKRDYLRLFGNTGYCAACNKVIPAFEMVMRARSNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFANMAYNPP 188          
BLAST of LIM domain only protein 3 vs. TrEMBL
Match: A0A0L8HLK7 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22011880mg PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 2.793e-47
Identity = 88/140 (62.86%), Postives = 112/140 (80.00%), Query Frame = 2
Query:  383 SSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIA 802
            S+     K   C  C++ I E +LLK  +QYWHEDCL+C+CC+CRLGEVGS+LY +A+LLLC+RDYLR+FG+ GYC+AC K+IPAFELVMRA + VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE M++  ++
Sbjct:    7 SATGMANKRQECAGCKKKITERYLLKALDQYWHEDCLKCSCCDCRLGEVGSTLYTKANLLLCRRDYLRLFGTTGYCSACSKMIPAFELVMRAKTNVYHLECFACQQCNHRFCVGDRFYLCDNKILCEYDYEERMVFANMS 146          
BLAST of LIM domain only protein 3 vs. TrEMBL
Match: A0A2A4JYF4 (Uncharacterized protein OS=Heliothis virescens OX=7102 GN=B5V51_8588 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.980e-47
Identity = 88/133 (66.17%), Postives = 107/133 (80.45%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIP 814
            C  C +VI E +LLK  +Q WHEDCL+C CC+CRLGEVG +LY RA+L+LCKRDYLR+FG+ GYC AC+KVIPAFE+VMRA S VYHLECF CQ+CNHRFCVGD+ YL  N+ILCE DYEE +++  +A   P
Sbjct:   57 CAGCSKVITERYLLKALDQLWHEDCLKCGCCDCRLGEVGHTLYTRANLILCKRDYLRLFGNTGYCAACNKVIPAFEMVMRARSNVYHLECFACQQCNHRFCVGDRFYLCDNKILCEYDYEERLVFANMAYNPP 189          
BLAST of LIM domain only protein 3 vs. Ensembl Cavefish
Match: lmo3 (LIM domain only 3 [Source:NCBI gene;Acc:103033888])

HSP 1 Score: 150.599 bits (379), Expect = 1.503e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:    9 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 144          
BLAST of LIM domain only protein 3 vs. Ensembl Cavefish
Match: lmo3 (LIM domain only 3 [Source:NCBI gene;Acc:103033888])

HSP 1 Score: 150.599 bits (379), Expect = 1.894e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:   20 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 155          
BLAST of LIM domain only protein 3 vs. Ensembl Cavefish
Match: lmo1 (LIM domain only 1 [Source:NCBI gene;Acc:280646])

HSP 1 Score: 150.984 bits (380), Expect = 2.201e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE  L     +Q+
Sbjct:   33 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGSFETQV 168          
BLAST of LIM domain only protein 3 vs. Ensembl Cavefish
Match: lmo3 (LIM domain only 3 [Source:NCBI gene;Acc:103033888])

HSP 1 Score: 150.599 bits (379), Expect = 1.434e-43
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++    A Q+
Sbjct:   85 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQV 220          
BLAST of LIM domain only protein 3 vs. Ensembl Cavefish
Match: lmo2 (LIM domain only 2 [Source:NCBI gene;Acc:111190647])

HSP 1 Score: 109.383 bits (272), Expect = 1.341e-28
Identity = 64/126 (50.79%), Postives = 76/126 (60.32%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYN 793
            C  C + I +   LK   QYWHEDCL C+ C CRLGEVG  LY +    LC+RDYLR+FG  G C +C+K I AFE+ MR    VYHLECF C  C   FCVGD+  L  + I+CE D  E    N
Sbjct:   30 CGGCHQSIGDRFFLKAIEQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCEKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIFEWTKLN 155          
BLAST of LIM domain only protein 3 vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 112.079 bits (279), Expect = 2.591e-30
Identity = 63/121 (52.07%), Postives = 79/121 (65.29%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEE 778
            C  C++ I++ +LLK   Q+WHEDCL C+ C CRLGEVG  LY +    LC+RDYLR+FG  G+C +C K I AFE+ MR    VYHLECF C  C   FCVGD+  L  + I+CE D  E
Sbjct:   30 CGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNSDIICEQDIYE 150          
BLAST of LIM domain only protein 3 vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 111.309 bits (277), Expect = 4.022e-30
Identity = 64/130 (49.23%), Postives = 82/130 (63.08%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIAS 805
            C  C++ I++ +LLK   Q+WHEDCL C+ C CRLGEVG  LY +    LC+RDYLR+FG  G+C +C K I AFE+ MR    VYHLECF C  C   FCVGD+  L  + I+CE D  E    N + +
Sbjct:   29 CGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNSDIICEQDIYEWSKINIMMT 158          
BLAST of LIM domain only protein 3 vs. Ensembl Sea Lamprey
Match: lmo4b (LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-030131-3570])

HSP 1 Score: 98.9821 bits (245), Expect = 3.124e-25
Identity = 59/135 (43.70%), Postives = 78/135 (57.78%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPLT 820
            C  C   IA+  LL   + YWH  CL+C+CC  +LG++G+S Y R  ++LC+ DY+RMFGS G CNAC + IPA ELVM+    VYHL+CF C  C  R   GD+ +     + CE D        + A   PLT
Sbjct:   18 CAGCGGKIADRFLLYSMDCYWHSRCLKCSCCQAQLGDLGTSCYTRQGMILCRDDYIRMFGSSGACNACGQSIPASELVMKTQGNVYHLKCFACATCRTRLVPGDRFHYVNGSLFCEHD--------RPAGPGPLT 144          
BLAST of LIM domain only protein 3 vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 48.1358 bits (113), Expect = 8.273e-7
Identity = 40/140 (28.57%), Postives = 62/140 (44.29%), Query Frame = 2
Query:  407 SPCCTSCQEVIAESH-LLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPLTG 823
            SP C  C E + ++  ++   ++ WH +   C  C    GE G   + R     C++DY  MF     CN C + I   +  + A + V+H ECF C+EC   F +    + +  +  CE  Y E         Q P+TG
Sbjct:   47 SPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEG--FHERDGKPYCRQDYYGMFAPK--CNGCSRAI--MQNYLSALNTVWHPECFICRECFTPF-INGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITG 179          
BLAST of LIM domain only protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002189.1 (pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gene:ENSPMAG00000001979.1 transcript:ENSPMAT00000002189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 1.956e-6
Identity = 25/63 (39.68%), Postives = 35/63 (55.56%), Query Frame = 2
Query:  584 RMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLY-GNRILCEAD 769
            R+FG    C  C+      + VMRA S +YH+ECF C+ C+ +   GD+  L  G  +LC AD
Sbjct:    1 RLFGI--KCAKCNASFSKTDFVMRARSHIYHMECFRCETCSRQLLPGDEFALRDGGGLLCRAD 61          
BLAST of LIM domain only protein 3 vs. Ensembl Nematostella
Match: EDO48809 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIH4])

HSP 1 Score: 154.836 bits (390), Expect = 1.871e-46
Identity = 83/128 (64.84%), Postives = 100/128 (78.12%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKI 799
            C  C  +I E  LLK  ++YWHEDCL+C+CC CRLGEVGS+LY +A+L+LCKRDYLR+FG+ G+C+ C K IPAFE+VMRA   VYHLECF CQ CN RFCVGDK YL+ NRILC  DYEE+M Y  +
Sbjct:   20 CGGCGVLINERFLLKALDRYWHEDCLKCSCCECRLGEVGSTLYTKANLILCKRDYLRLFGTRGFCSVCCKTIPAFEMVMRARDNVYHLECFSCQRCNQRFCVGDKFYLFNNRILCVDDYEEMMSYRNM 147          
BLAST of LIM domain only protein 3 vs. Ensembl Nematostella
Match: EDO37872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEJ4])

HSP 1 Score: 131.724 bits (330), Expect = 6.148e-38
Identity = 66/124 (53.23%), Postives = 85/124 (68.55%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIML 787
            C  C   I    LL+  +Q+WHE+CL+C+ C   L E+G   Y R DL+LCKRDY+R+FG+ G C+ C K IP  E+VMRA   VYHL+CF CQ C HRFCVGDK YL+ N +LCE DY ++M+
Sbjct:    2 CAQCGNGIQSQFLLRALDQFWHEECLKCSYCCGMLSEMGPKFYFRGDLILCKRDYIRIFGTTGICSFCFKTIPPLEMVMRARQHVYHLDCFACQVCRHRFCVGDKFYLHQNTVLCEDDYGDLMM 125          
BLAST of LIM domain only protein 3 vs. Ensembl Nematostella
Match: EDO37316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG43])

HSP 1 Score: 101.293 bits (251), Expect = 4.650e-26
Identity = 54/123 (43.90%), Postives = 80/123 (65.04%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIM 784
            C  C E I +  LL   +QYWH +CL+C+CC  RLGE+G+S Y++  ++LCK DY+R++G+ G C  C K+IPA ELVM+    VYHL CF C  C+++   GD+ ++   R+ CE D   ++
Sbjct:   19 CAGCGEKIIDRFLLLALDQYWHVNCLKCSCCEARLGEIGTSCYSKGGMILCKTDYVRLYGNSGACAVCAKLIPATELVMKVLGKVYHLHCFTCTTCHNQLVPGDRFHVVNGRLFCENDDPNLL 141          
BLAST of LIM domain only protein 3 vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 71.2478 bits (173), Expect = 2.288e-14
Identity = 45/129 (34.88%), Postives = 69/129 (53.49%), Query Frame = 2
Query:  401 EKSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXX-XXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIM 784
            ++   C  C   I E   L   +Q WH DCL+C+        E+  + +++  ++LC+ DY R F S+  C++C + I + ELVMRA   VYH+ CF C  C      G+   + G RI C+ DYEE++
Sbjct:    4 KQQAVCAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNEL--TCFSKDGVILCREDYYRRF-SVKKCSSCSQAISSKELVMRARDQVYHVNCFACDRCKRMLATGEYFGMRGIRIYCKEDYEELL 129          
BLAST of LIM domain only protein 3 vs. Ensembl Nematostella
Match: LHX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E9])

HSP 1 Score: 63.5438 bits (153), Expect = 8.161e-12
Identity = 44/120 (36.67%), Postives = 65/120 (54.17%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGN-RILCEADY 772
            C  CQ  IA+  LLKV +  WH  C++C+ C C L E     ++R   L CK D+ R +G+   C+ CD+ I   ++V RA   V+H++CF C  C  +   GD+ Y  G+   +C  DY
Sbjct:    5 CAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLTE---RCFSREGKLFCKTDFYRRYGT--KCSGCDQGISPNDMVRRAKHLVFHVDCFVCSYCKRQITTGDELYYIGDGSFICRDDY 119          
BLAST of LIM domain only protein 3 vs. Ensembl Medaka
Match: lmo3 (LIM domain only 3 [Source:NCBI gene;Acc:101154994])

HSP 1 Score: 151.369 bits (381), Expect = 9.284e-45
Identity = 80/136 (58.82%), Postives = 101/136 (74.26%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE ++ +  A Q+
Sbjct:   20 KPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKDGYAPQV 155          
BLAST of LIM domain only protein 3 vs. Ensembl Medaka
Match: lmo1 (rhombotin-1 [Source:NCBI gene;Acc:101162198])

HSP 1 Score: 150.599 bits (379), Expect = 2.237e-44
Identity = 80/136 (58.82%), Postives = 100/136 (73.53%), Query Frame = 2
Query:  404 KSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQI 811
            K   C  C   I + +LLK  ++YWHEDCL+C CC+CRLGEVGS+LY +A+L+LC+RDYLR+FG+ G C AC K+IPAFE+VMRA   VYHL+CF CQ CN RFCVGDK +L  N ILC+ DYEE  L     +Q+
Sbjct:   19 KQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGSFETQV 154          
BLAST of LIM domain only protein 3 vs. Ensembl Medaka
Match: ENSORLT00000030604.1 (rhombotin-1 [Source:NCBI gene;Acc:101174827])

HSP 1 Score: 136.346 bits (342), Expect = 5.247e-39
Identity = 73/126 (57.94%), Postives = 93/126 (73.81%), Query Frame = 2
Query:  401 EKSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEE 778
            EK   C  C   I +  +L+  +++WHEDCL+C CC+CRLG VGS+LY R++L+LC+RDYLR+FG  G C AC K+IPAFE+VMRA   VYHL+CF CQ C  RFCVGDK +L  N ILC+ DYE+
Sbjct:   18 EKPRGCAGCNGKILDRFMLQALDRFWHEDCLKCACCDCRLGRVGSTLYTRSNLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCRQRFCVGDKFFLKNNMILCQLDYEK 143          
BLAST of LIM domain only protein 3 vs. Ensembl Medaka
Match: lmo2 (LIM domain only 2 [Source:NCBI gene;Acc:101169199])

HSP 1 Score: 110.923 bits (276), Expect = 3.069e-29
Identity = 65/126 (51.59%), Postives = 77/126 (61.11%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYN 793
            C  CQ+ I +   LK   QYWHEDCL C+ C CRLGEVG  LY +    LC+RDYLR+FG  G C +C+K I AFE+ MR    VYHLECF C  C   FCVGD+  L  + I+CE D  E    N
Sbjct:   30 CGGCQQNIGDRFFLKAIEQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCEKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIFEWTKLN 155          
BLAST of LIM domain only protein 3 vs. Ensembl Medaka
Match: lmo4b (LIM domain only 4 [Source:NCBI gene;Acc:101173927])

HSP 1 Score: 104.76 bits (260), Expect = 7.988e-27
Identity = 55/130 (42.31%), Postives = 81/130 (62.31%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIAS 805
            C  C   IA+  LL   + YWH  CL+C+CC  +LGE+G+S Y ++ ++LC+ DY+R+FG+ G C+AC + IPA ELVMRA   VYHL+CF C  C +R   GD+ +     + CE D    ++   ++S
Sbjct:   23 CAGCGGKIADRFLLYTMDTYWHSRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLSS 152          
BLAST of LIM domain only protein 3 vs. Planmine SMEST
Match: SMESG000037556.1 (SMESG000037556.1)

HSP 1 Score: 291.582 bits (745), Expect = 8.949e-100
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 2
Query:  377 MNSSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPLTGSFVF 835
            MNSSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDCLRCNCCNCRLGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPLTGSFVF
Sbjct:    1 MNSSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDCLRCNCCNCRLGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPLTGSFVF 153          
BLAST of LIM domain only protein 3 vs. Planmine SMEST
Match: SMESG000028893.1 (SMESG000028893.1)

HSP 1 Score: 119.783 bits (299), Expect = 1.766e-31
Identity = 73/150 (48.67%), Postives = 103/150 (68.67%), Query Frame = 2
Query:  416 CTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLY-GNRILCEADYEEIMLYNKIASQIPLTGSFVF*SSDPTISV 862
            C+ CQ  I E ++L VD + +HEDCLRC+CC+ RL E+    Y +A+++LCKRDYLR++G+ G C+ACD  I AFE VMRA + +YHL+CF C  C  RFCVGDK YL+  N+ILCE D+  I+L ++  S +  + S++     PT S+
Sbjct:   33 CSICQRPIREMYILIVDQKMYHEDCLRCSCCDARLAELDKFCYMKANMMLCKRDYLRLYGNTGLCSACDLKIQAFEYVMRAKNNIYHLDCFTCHLCKMRFCVGDKFYLHETNKILCEKDH-NIILCSQTHSIVNNSNSWII----PTNSI 177          
BLAST of LIM domain only protein 3 vs. Planmine SMEST
Match: SMESG000071273.1 (SMESG000071273.1)

HSP 1 Score: 72.4034 bits (176), Expect = 7.172e-14
Identity = 31/79 (39.24%), Postives = 53/79 (67.09%), Query Frame = 2
Query:  542 YARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYHLECFGCQECNHRFCVGDKCYLYGNR-ILCEADYE 775
            Y+++D + CK D+ R +G+   C ACD+VIPA E++ +A + +YHLECF C  C+ +   G++ +L  +R ++C  D+E
Sbjct:   85 YSKSDEIFCKEDFFRRYGT--RCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFE 161          
BLAST of LIM domain only protein 3 vs. Planmine SMEST
Match: SMESG000043039.1 (SMESG000043039.1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.531e-10
Identity = 53/169 (31.36%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  329 HLLNVFKFFSFKICNRMNSSNANFEKS-----PCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRA-GSFVYHLECFGCQECNHRFCVGDK-CYLYGNRILCEADYEEIMLYNKIASQIP 814
            HLLN        I  ++ SS  NF K      P CTSC   I + +L  + +++WH  CLRC  C+  L E     + R   L C +DY +   +   C+ C  +I   +LV  +  S V+HL+CF C  C+ +   GD+ C L   R +C  D++ I  + ++++ +P
Sbjct:   11 HLLNS------PIPVKLTSSIHNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSE---RCFERDGKLFCSKDYRKRVSA--KCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHI--FKEMSNILP 166          
BLAST of LIM domain only protein 3 vs. Planmine SMEST
Match: SMESG000043039.1 (SMESG000043039.1)

HSP 1 Score: 54.299 bits (129), Expect = 8.814e-8
Identity = 52/158 (32.91%), Postives = 76/158 (48.10%), Query Frame = 2
Query:  329 HLLNVFKFFSFKICNRMNSSNANFEKS-----PCCTSCQEVIAESHLLKVDNQYWHEDXXXXXXXXXXXGEVGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRA-GSFVYHLECFGCQECNHRFCVGDK-CYLYGNRILCEADYEEI 781
            HLLN        I  ++ SS  NF K      P CTSC   I + +L  + +++WH  CLRC  C+  L E     + R   L C +DY +       C+ C  +I   +LV  +  S V+HL+CF C  C+ +   GD+ C L   R +C  D++ I
Sbjct:   11 HLLNS------PIPVKLTSSIHNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSE---RCFERDGKLFCSKDYRKRVS--AKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHI 157          
The following BLAST results are available for this feature:
BLAST of LIM domain only protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMO11.360e-4459.56LIM domain only 1 [Source:HGNC Symbol;Acc:HGNC:664... [more]
LMO11.828e-4459.56LIM domain only 1 [Source:HGNC Symbol;Acc:HGNC:664... [more]
LMO12.016e-4459.56LIM domain only 1 [Source:HGNC Symbol;Acc:HGNC:664... [more]
LMO32.729e-4458.82LIM domain only 3 [Source:HGNC Symbol;Acc:HGNC:664... [more]
LMO32.729e-4458.82LIM domain only 3 [Source:HGNC Symbol;Acc:HGNC:664... [more]
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lim-47.042e-1031.71LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
lin-112.857e-929.75pep chromosome:WBcel235:I:10248256:10255327:1 gene... [more]
lim-45.469e-930.89LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
ceh-142.450e-828.68Homeobox protein ceh-14 [Source:UniProtKB/Swiss-P... [more]
lim-49.239e-829.55LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Bx9.154e-4560.58gene:FBgn0265598 transcript:FBtr0340364[more]
Bx9.154e-4560.58gene:FBgn0265598 transcript:FBtr0340366[more]
Bx2.304e-4461.83gene:FBgn0265598 transcript:FBtr0340363[more]
Bx8.277e-4460.58gene:FBgn0265598 transcript:FBtr0340365[more]
Bx8.495e-4460.58gene:FBgn0265598 transcript:FBtr0340367[more]
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo31.774e-4458.82LIM domain only 3 [Source:NCBI gene;Acc:553774][more]
lmo31.774e-4458.82LIM domain only 3 [Source:NCBI gene;Acc:553774][more]
lmo32.235e-4458.82LIM domain only 3 [Source:NCBI gene;Acc:553774][more]
lmo12.656e-4458.82LIM domain only 1 [Source:NCBI gene;Acc:280646][more]
lmo32.720e-4458.82LIM domain only 3 [Source:NCBI gene;Acc:553774][more]
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo22.692e-3151.56LIM domain only 2 [Source:NCBI gene;Acc:496679][more]
lmo23.805e-3151.56LIM domain only 2 [Source:NCBI gene;Acc:496679][more]
lmo24.464e-3151.56LIM domain only 2 [Source:NCBI gene;Acc:496679][more]
lmo4.25.553e-2741.33LIM domain only 4, gene 2 [Source:NCBI gene;Acc:54... [more]
lmo4.21.499e-2642.57LIM domain only 4, gene 2 [Source:NCBI gene;Acc:54... [more]
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmo11.260e-4459.56LIM domain only 1 [Source:MGI Symbol;Acc:MGI:10281... [more]
Lmo31.874e-4458.82LIM domain only 3 [Source:MGI Symbol;Acc:MGI:10281... [more]
Lmo31.874e-4458.82LIM domain only 3 [Source:MGI Symbol;Acc:MGI:10281... [more]
Lmo31.874e-4458.82LIM domain only 3 [Source:MGI Symbol;Acc:MGI:10281... [more]
Lmo31.874e-4458.82LIM domain only 3 [Source:MGI Symbol;Acc:MGI:10281... [more]
back to top
BLAST of LIM domain only protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99MB5|LMO3_RAT5.681e-4458.82LIM domain only protein 3 OS=Rattus norvegicus OX=... [more]
sp|P25800|RBTN1_HUMAN8.779e-4459.56Rhombotin-1 OS=Homo sapiens OX=9606 GN=LMO1 PE=1 S... [more]
sp|Q3B8H4|RBTN1_XENLA1.172e-4359.56Rhombotin-1 OS=Xenopus laevis OX=8355 GN=lmo1 PE=2... [more]
sp|Q5RBW7|LMO3_PONAB1.311e-4358.82LIM domain only protein 3 OS=Pongo abelii OX=9601 ... [more]
sp|Q8BZL8|LMO3_MOUSE1.311e-4358.82LIM domain only protein 3 OS=Mus musculus OX=10090... [more]
back to top
BLAST of LIM domain only protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9IV777.932e-4862.50Uncharacterized protein OS=Bombyx mori OX=7091 PE=... [more]
A0A194QA691.363e-4760.00Rhombotin-1 OS=Papilio xuthus OX=66420 GN=RR46_050... [more]
Q2F5Q21.885e-4762.50Beadex/dLMO protein OS=Bombyx mori OX=7091 PE=2 SV... [more]
A0A0L8HLK72.793e-4762.86Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2A4JYF44.980e-4766.17Uncharacterized protein OS=Heliothis virescens OX=... [more]
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo31.503e-4458.82LIM domain only 3 [Source:NCBI gene;Acc:103033888][more]
lmo31.894e-4458.82LIM domain only 3 [Source:NCBI gene;Acc:103033888][more]
lmo12.201e-4458.82LIM domain only 1 [Source:NCBI gene;Acc:280646][more]
lmo31.434e-4358.82LIM domain only 3 [Source:NCBI gene;Acc:103033888][more]
lmo21.341e-2850.79LIM domain only 2 [Source:NCBI gene;Acc:111190647][more]
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo22.591e-3052.07LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo24.022e-3049.23LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo4b3.124e-2543.70LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
PXN8.273e-728.57paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
ENSPMAT00000002189.11.956e-639.68pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gen... [more]
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488091.871e-4664.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378726.148e-3853.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373164.650e-2643.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433542.288e-1434.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LHX18.161e-1236.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM domain only protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo39.284e-4558.82LIM domain only 3 [Source:NCBI gene;Acc:101154994][more]
lmo12.237e-4458.82rhombotin-1 [Source:NCBI gene;Acc:101162198][more]
ENSORLT00000030604.15.247e-3957.94rhombotin-1 [Source:NCBI gene;Acc:101174827][more]
lmo23.069e-2951.59LIM domain only 2 [Source:NCBI gene;Acc:101169199][more]
lmo4b7.988e-2742.31LIM domain only 4 [Source:NCBI gene;Acc:101173927][more]
back to top
BLAST of LIM domain only protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037556.18.949e-100100.00SMESG000037556.1[more]
SMESG000028893.11.766e-3148.67SMESG000028893.1[more]
SMESG000071273.17.172e-1439.24SMESG000071273.1[more]
SMESG000043039.11.531e-1031.36SMESG000043039.1[more]
SMESG000043039.18.814e-832.91SMESG000043039.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023969 ID=SMED30023969|Name=LIM domain only protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1037bp
CATGTTTACTTGTGATATTAGTTTAAGCCATCAATTCAATTAACTCCTGA
TTATTGCCCACTCTATGGAGAGCTTTAAGAAAACAATCCCATATTTTGTT
GTATTTCTAATTAATTGCTTTGAGGATTCACAATTCTCATCCAGCAGTCC
ATTTAGTAGTATTTCTCAATAATCCATTAAGAAATTTCCTTTCAAACAAA
TTAGACAGGTTTTCAAACCAGGCCTCTCTGTTGAGTTGCATTTAATAGAC
GCTGATTTCTCATTGGTCAGAAAATGAACCAATTAAATTCAAGTTCCATT
TCACTATAATTTTATTCGATATTCATTGCATTTGTTAAATGTGTTTAAAT
TTTTCAGCTTTAAAATTTGTAATCGAATGAATAGTAGCAACGCAAATTTT
GAGAAAAGTCCCTGTTGCACCAGTTGCCAAGAGGTAATTGCCGAGTCTCA
CTTGTTAAAAGTTGACAACCAATATTGGCATGAAGATTGTTTAAGATGTA
ATTGTTGTAATTGTCGCCTTGGAGAGGTCGGGTCTTCCCTTTATGCTCGA
GCGGATTTGTTACTTTGTAAACGAGATTATCTCAGAATGTTCGGTTCTAT
TGGCTATTGCAACGCTTGCGACAAAGTGATTCCAGCATTTGAGTTGGTAA
TGAGGGCGGGAAGTTTTGTGTATCATTTGGAATGCTTTGGCTGTCAAGAA
TGTAATCATAGATTTTGCGTTGGGGACAAATGTTACTTGTACGGAAACAG
AATTCTTTGCGAGGCGGATTATGAAGAGATAATGCTTTATAATAAAATCG
CAAGTCAAATCCCACTTACTGGTTCTTTCGTTTTCTGAAGTTCTGACCCG
ACAATTTCAGTGCTCTCAAGCTAACAAAATTTTCAGGAATATTTTTGATC
ATGACTGAATATATCTGTAAAGATTTTCATTCAACTCGTATTGAATAAAT
TATTGCTCGAGGAATTTTTTATTTTGTTTTAATGAATTAATATATTGGAT
AATATTGTTGTTTTGATATAAATATATCCTTTTTGAG
back to top

protein sequence of SMED30023969-orf-1

>SMED30023969-orf-1 ID=SMED30023969-orf-1|Name=SMED30023969-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MNSSNANFEKSPCCTSCQEVIAESHLLKVDNQYWHEDCLRCNCCNCRLGE
VGSSLYARADLLLCKRDYLRMFGSIGYCNACDKVIPAFELVMRAGSFVYH
LECFGCQECNHRFCVGDKCYLYGNRILCEADYEEIMLYNKIASQIPLTGS
FVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000028Category 2 cell
PLANA:0000033epidermal progenitor cell
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 13..67
e-value: 2.9E-10
score: 50.1
coord: 77..131
e-value: 6.5E-10
score: 48.9
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 14..72
e-value: 2.5E-12
score: 46.8
coord: 78..134
e-value: 1.6E-11
score: 44.2
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 78..113
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 14..48
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 12..74
score: 13.217
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 76..138
score: 12.177
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 71..145
e-value: 2.4E-18
score: 68.6
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 1..70
e-value: 6.4E-16
score: 60.0
NoneNo IPR availablePANTHERPTHR45787FAMILY NOT NAMEDcoord: 3..143
NoneNo IPR availablePANTHERPTHR45787:SF6BEADEX, ISOFORM Dcoord: 3..143
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 39..71
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 9..39
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 76..104