SCO cytochrome c oxidase assembly protein 1

Overview
NameSCO cytochrome c oxidase assembly protein 1
Smed IDSMED30023957
Length (bp)1009
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SCO cytochrome c oxidase assembly protein 1 (SMED30023957) t-SNE clustered cells

Violin plots show distribution of expression levels for SCO cytochrome c oxidase assembly protein 1 (SMED30023957) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SCO cytochrome c oxidase assembly protein 1 (SMED30023957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SCO cytochrome c oxidase assembly protein 1 (SMED30023957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023957h1SMcG0012578 SmedASXL_011303SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30023957h1SMcG0012578 dd_Smed_v4_9334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023957h1SMcG0012578 dd_Smed_v4_9334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO1 (SCO cytochrome c oxidase assembly protein 1 [Source:HGNC Symbol;Acc:HGNC:10603])

HSP 1 Score: 202.601 bits (514), Expect = 1.727e-62
Identity = 86/167 (51.50%), Postives = 121/167 (72.46%), Query Frame = 3
Query:  276 GDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
            G P +GG F L  H G ++T  D+  +WLL+YFG+ HCPD+CPE+LEKM  +VD+ID+ + +P++ P+F+S+DP+RDT  ++A Y+KEFS K++GLTG   E+  + ++Y+V+Y  G KDE  DY+VDH IIMYLIGP G+FL Y+G  K   EI ASI + MR Y 
Sbjct:  132 GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYR 298          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO2 (SCO cytochrome c oxidase assembly protein 2 [Source:HGNC Symbol;Acc:HGNC:10604])

HSP 1 Score: 174.096 bits (440), Expect = 5.226e-52
Identity = 67/164 (40.85%), Postives = 114/164 (69.51%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 785
            GDF L+DH+G  R + DF+ +W+L+YFG+ HCPDICP++LEK+  +V +++    +P + P+F++VDP+RD   ++A+Y+++F  +++GLTG   ++   + SY+V+Y  G KDE  DY+VDH+I +YL+ P G F  YYG ++S ++I  S+   M  +  ++
Sbjct:  102 GDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVL 265          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO2 (SCO cytochrome c oxidase assembly protein 2 [Source:HGNC Symbol;Acc:HGNC:10604])

HSP 1 Score: 174.096 bits (440), Expect = 5.226e-52
Identity = 67/164 (40.85%), Postives = 114/164 (69.51%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 785
            GDF L+DH+G  R + DF+ +W+L+YFG+ HCPDICP++LEK+  +V +++    +P + P+F++VDP+RD   ++A+Y+++F  +++GLTG   ++   + SY+V+Y  G KDE  DY+VDH+I +YL+ P G F  YYG ++S ++I  S+   M  +  ++
Sbjct:  102 GDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVL 265          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO2 (SCO cytochrome c oxidase assembly protein 2 [Source:HGNC Symbol;Acc:HGNC:10604])

HSP 1 Score: 174.096 bits (440), Expect = 5.226e-52
Identity = 67/164 (40.85%), Postives = 114/164 (69.51%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 785
            GDF L+DH+G  R + DF+ +W+L+YFG+ HCPDICP++LEK+  +V +++    +P + P+F++VDP+RD   ++A+Y+++F  +++GLTG   ++   + SY+V+Y  G KDE  DY+VDH+I +YL+ P G F  YYG ++S ++I  S+   M  +  ++
Sbjct:  102 GDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVL 265          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Match: SCO2 (SCO cytochrome c oxidase assembly protein 2 [Source:HGNC Symbol;Acc:HGNC:10604])

HSP 1 Score: 174.096 bits (440), Expect = 5.226e-52
Identity = 67/164 (40.85%), Postives = 114/164 (69.51%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 785
            GDF L+DH+G  R + DF+ +W+L+YFG+ HCPDICP++LEK+  +V +++    +P + P+F++VDP+RD   ++A+Y+++F  +++GLTG   ++   + SY+V+Y  G KDE  DY+VDH+I +YL+ P G F  YYG ++S ++I  S+   M  +  ++
Sbjct:  102 GDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVL 265          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Celegans
Match: sco-1 (SCO (Yeast Suppressor of Cytochrome Oxidase deficiency) homolog [Source:UniProtKB/TrEMBL;Acc:Q17557])

HSP 1 Score: 145.976 bits (367), Expect = 5.541e-41
Identity = 63/172 (36.63%), Postives = 105/172 (61.05%), Query Frame = 3
Query:  270 SYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIK--DEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNV 779
            + G   IGG+++L++  G      + +  WLL+YFG+ +CPDICP+++EKM  +V+ I+   +   I+P+F+SVDP+RD+   V +Y  EFS K+ G TG   ++  + ++++V++  G +   +  DY+VDH +IMYLI P G F  YYG  +  +EI   I  ++  Y  
Sbjct:  131 TAGKARIGGEWELMNTDGKMEGSQELRGNWLLMYFGFTNCPDICPDEIEKMVKVVEIIEAKKDATPIVPVFISVDPERDSVARVKEYCSEFSNKLRGFTGTTEQVNKVAKTFRVYHSQGPRTNKQEDDYIVDHTVIMYLIDPSGQFHDYYGQNRKAEEIANVIEMKVLKYQA 302          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Fly
Match: Scox (gene:FBgn0262467 transcript:FBtr0079052)

HSP 1 Score: 196.438 bits (498), Expect = 3.883e-61
Identity = 89/225 (39.56%), Postives = 141/225 (62.67%), Query Frame = 3
Query:  114 SKSLLPKSRRKLMIV--IGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVL 782
            +K   P S R L ++  +G  G  F +Y  ++    + +E  + +           G   IGG ++LVD +G  R   DF  KWLL+YFG+ HCPDICP++LEKM+ +VD+++ +   P + PIF++VDP+RD+   VAKY+KEFS K++GLTG   +I+ + ++++V++  G +DE  DY+VDH IIMYL+ P G+F+ YYG  +  D+  ASI+  +  +N +
Sbjct:   31 TKGKGPISWRSLAVIGALGAGGVGFMLYVKSEKDEARMKERQRQL-----------GKAAIGGSWELVDSQGAVRKSEDFLGKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPERDSKEVVAKYVKEFSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDEDNDYIVDHTIIMYLVNPDGEFVDYYGQNRDKDQCVASILVNIAKWNSM 244          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Match: sco1 (SCO cytochrome c oxidase assembly protein 1 [Source:ZFIN;Acc:ZDB-GENE-140909-1])

HSP 1 Score: 192.2 bits (487), Expect = 1.669e-58
Identity = 91/192 (47.40%), Postives = 128/192 (66.67%), Query Frame = 3
Query:  201 QYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
            +Y  R+ EE ++           S G P +GG F L+DH        DF  +WLL+YFG+ HCPDICP++LEKM   VD+IDN   +P++ P+ +S+DP+RDTP ++A Y+K+FS K+IGLTG   +I+ ++++Y+V+Y  G KDE  DY+VDH IIMYL+GP G FL+YYG  K   EI +SI S MR + 
Sbjct:  130 KYFKREKEELFE------KERTKSIGKPALGGPFSLLDHNNKPSRSEDFLGRWLLIYFGFTHCPDICPDELEKMIEAVDEIDNIDTLPDVTPLLISIDPERDTPEALAAYVKDFSPKLIGLTGTTAQIEQVSRAYRVYYSQGPKDEDNDYIVDHTIIMYLVGPDGQFLEYYGQNKKSSEIASSIASYMRKHK 315          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Match: sco1 (SCO cytochrome c oxidase assembly protein 1 [Source:ZFIN;Acc:ZDB-GENE-140909-1])

HSP 1 Score: 192.2 bits (487), Expect = 1.838e-58
Identity = 91/192 (47.40%), Postives = 128/192 (66.67%), Query Frame = 3
Query:  201 QYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
            +Y  R+ EE ++           S G P +GG F L+DH        DF  +WLL+YFG+ HCPDICP++LEKM   VD+IDN   +P++ P+ +S+DP+RDTP ++A Y+K+FS K+IGLTG   +I+ ++++Y+V+Y  G KDE  DY+VDH IIMYL+GP G FL+YYG  K   EI +SI S MR + 
Sbjct:  130 KYFKREKEELFE------KERTKSIGKPALGGPFSLLDHNNKPSRSEDFLGRWLLIYFGFTHCPDICPDELEKMIEAVDEIDNIDTLPDVTPLLISIDPERDTPEALAAYVKDFSPKLIGLTGTTAQIEQVSRAYRVYYSQGPKDEDNDYIVDHTIIMYLVGPDGQFLEYYGQNKKSSEIASSIASYMRKHK 315          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 173.711 bits (439), Expect = 6.757e-52
Identity = 70/160 (43.75%), Postives = 116/160 (72.50%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            GDF L+DH G +RT+ DF   W+L+YFG+ HCPDICP++LEK++ +V  +D + ++P++ P+F++VDP+RD  +++A+Y+K+F  +++GLTG   E+K   + ++V+   G KDE GDY+VDH+I++YL+ P G F+ YY   K+  +I  SI + M+ +
Sbjct:  114 GDFHLLDHTGQRRTKRDFLGHWVLLYFGFTHCPDICPDELEKLTSVVHILDKDPSLPSVQPLFITVDPERDDVSAMARYVKDFHPRLVGLTGSAEEVKQAGRDFRVYASNGPKDEDGDYIVDHSIVIYLVNPDGLFIDYYNRMKNDTQIAESIRNHMKTF 273          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 173.711 bits (439), Expect = 6.757e-52
Identity = 70/160 (43.75%), Postives = 116/160 (72.50%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            GDF L+DH G +RT+ DF   W+L+YFG+ HCPDICP++LEK++ +V  +D + ++P++ P+F++VDP+RD  +++A+Y+K+F  +++GLTG   E+K   + ++V+   G KDE GDY+VDH+I++YL+ P G F+ YY   K+  +I  SI + M+ +
Sbjct:  114 GDFHLLDHTGQRRTKRDFLGHWVLLYFGFTHCPDICPDELEKLTSVVHILDKDPSLPSVQPLFITVDPERDDVSAMARYVKDFHPRLVGLTGSAEEVKQAGRDFRVYASNGPKDEDGDYIVDHSIVIYLVNPDGLFIDYYNRMKNDTQIAESIRNHMKTF 273          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Xenopus
Match: sirt4 (sirtuin 4 [Source:Xenbase;Acc:XB-GENE-948981])

HSP 1 Score: 202.986 bits (515), Expect = 1.799e-63
Identity = 93/215 (43.26%), Postives = 141/215 (65.58%), Query Frame = 3
Query:  129 PKSRRKLMIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            P S + L + +   G    + G+ +Y  ++ E+  +           S G P +GG F L+DH G  +T  D+  +W+L+YFG+ HCPDICPE++EKM L+VD+ID    +PN+ P+F+++DP+RD+ ++VA Y+KEFS K+IGLTG   +I+ + ++Y+V++ +G KDE  DY+VDH IIMYL+ P G F+ YYG  K   EI +SI S MRN+
Sbjct:   42 PVSWKSLALTVALGGA--LMAGM-KYLKKEKEDKLE------QERKRSLGKPLLGGPFSLIDHNGQPKTDKDYLGQWVLLYFGFTHCPDICPEEIEKMILVVDEIDKIPTLPNLTPLFITIDPERDSKDAVANYVKEFSPKLIGLTGSSEQIEKVAKAYRVYFSSGPKDEDNDYIVDHTIIMYLLAPDGSFVDYYGQNKRNAEISSSIASHMRNF 247          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Xenopus
Match: sec24a (SEC24 homolog A, COPII coat complex component [Source:Xenbase;Acc:XB-GENE-987688])

HSP 1 Score: 176.792 bits (447), Expect = 6.848e-53
Identity = 72/161 (44.72%), Postives = 113/161 (70.19%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
            GDF LVDH G  RT+   ++ W+L+YFG+ HCPDICP++LEK+S  V  +D +  +P+++P+F++VDP+RD+  ++AKY+ +F  +++GLTG   ++K + ++Y+V+Y TG KDE  DY+VDH I++YL+ P G F  YY   K+  EI  S+   M+ Y 
Sbjct:  109 GDFSLVDHTGQPRTKSFLRDNWVLLYFGFTHCPDICPDELEKLSSAVSLLDKDPALPHVLPVFITVDPERDSVAALAKYVSDFHPRLLGLTGSTEQVKEVAKAYRVYYSTGPKDEDNDYIVDHTIMIYLLNPDGLFTDYYSRGKTDQEIADSVRRHMQTYT 269          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Match: Sco1 (SCO1 cytochrome c oxidase assembly protein [Source:MGI Symbol;Acc:MGI:106362])

HSP 1 Score: 202.216 bits (513), Expect = 9.810e-63
Identity = 92/215 (42.79%), Postives = 138/215 (64.19%), Query Frame = 3
Query:  129 PKSRRKLMIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            P S + L +     G    + G+  +K  + E     + ++    + S G P +GG F L  H G  +T  D+  +W+L+YFG+ HCPDICPE+LEKM  +V++ID+  ++PN+ P+F+++DP+RDT  ++A Y+KEFS K++GLTG   EI  + ++Y+V+Y  G KDE  DY+VDH IIMYLIGP G+FL Y+G  K   EI  SI + MR++
Sbjct:   75 PVSWKSLALTFAIGGS--LLAGMKYFKKEKIESVS--LLELEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHMRSH 285          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Match: Sco1 (SCO1 cytochrome c oxidase assembly protein [Source:MGI Symbol;Acc:MGI:106362])

HSP 1 Score: 199.134 bits (505), Expect = 1.225e-61
Identity = 85/170 (50.00%), Postives = 122/170 (71.76%), Query Frame = 3
Query:  264 NNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            + S G P +GG F L  H G  +T  D+  +W+L+YFG+ HCPDICPE+LEKM  +V++ID+  ++PN+ P+F+++DP+RDT  ++A Y+KEFS K++GLTG   EI  + ++Y+V+Y  G KDE  DY+VDH IIMYLIGP G+FL Y+G  K   EI  SI + MR++
Sbjct:  111 HRSIGKPLLGGPFSLTTHNGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHMRSH 280          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Match: Sco2 (SCO2 cytochrome c oxidase assembly protein [Source:MGI Symbol;Acc:MGI:3818630])

HSP 1 Score: 176.792 bits (447), Expect = 2.634e-53
Identity = 85/251 (33.86%), Postives = 146/251 (58.17%), Query Frame = 3
Query:   45 NFSKYIKFLRFS--KILNINQSFYCSKSLL--PKSRRKLMIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 785
              S++   LR S  + L+ N   +  +     P  R +L+I    T       G A    R  +E ++           + G     GDF L+DHKG  R + DF+ +W+L+YFG+ HCPDICP++LEK+  +V K++   ++P + P+F++VDP+RD   ++A+Y++EF  +++GLTG   ++ + +++Y+V+Y  G KDE  DY+VDH+I +YL+ P G F  YYG ++S ++I  SI   +  ++ ++
Sbjct:   12 KLSQFKPLLRISGGETLHRNSRHWAGQGQRQGPGLRTRLLI----TALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQ----GDFSLLDHKGQPRCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQPVFITVDPERDDVAAMARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQIVESIRRHIAAFHSVL 254          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Match: Sco2 (SCO2 cytochrome c oxidase assembly protein [Source:MGI Symbol;Acc:MGI:3818630])

HSP 1 Score: 176.792 bits (447), Expect = 2.634e-53
Identity = 85/251 (33.86%), Postives = 146/251 (58.17%), Query Frame = 3
Query:   45 NFSKYIKFLRFS--KILNINQSFYCSKSLL--PKSRRKLMIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 785
              S++   LR S  + L+ N   +  +     P  R +L+I    T       G A    R  +E ++           + G     GDF L+DHKG  R + DF+ +W+L+YFG+ HCPDICP++LEK+  +V K++   ++P + P+F++VDP+RD   ++A+Y++EF  +++GLTG   ++ + +++Y+V+Y  G KDE  DY+VDH+I +YL+ P G F  YYG ++S ++I  SI   +  ++ ++
Sbjct:   12 KLSQFKPLLRISGGETLHRNSRHWAGQGQRQGPGLRTRLLI----TALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQ----GDFSLLDHKGQPRCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQPVFITVDPERDDVAAMARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQIVESIRRHIAAFHSVL 254          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|O75880|SCO1_HUMAN (Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 8.293e-62
Identity = 86/167 (51.50%), Postives = 121/167 (72.46%), Query Frame = 3
Query:  276 GDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
            G P +GG F L  H G ++T  D+  +WLL+YFG+ HCPD+CPE+LEKM  +VD+ID+ + +P++ P+F+S+DP+RDT  ++A Y+KEFS K++GLTG   E+  + ++Y+V+Y  G KDE  DY+VDH IIMYLIGP G+FL Y+G  K   EI ASI + MR Y 
Sbjct:  132 GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYR 298          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|Q5SUC9|SCO1_MOUSE (Protein SCO1 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco1 PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 8.566e-61
Identity = 85/170 (50.00%), Postives = 122/170 (71.76%), Query Frame = 3
Query:  264 NNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            + S G P +GG F L  H G  +T  D+  +W+L+YFG+ HCPDICPE+LEKM  +V++ID+  ++PN+ P+F+++DP+RDT  ++A Y+KEFS K++GLTG   EI  + ++Y+V+Y  G KDE  DY+VDH IIMYLIGP G+FL Y+G  K   EI  SI + MR++
Sbjct:  111 HRSIGKPLLGGPFSLTTHNGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHMRSH 280          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|A1A4J8|SCO1_BOVIN (Protein SCO1 homolog, mitochondrial OS=Bos taurus OX=9913 GN=SCO1 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.106e-60
Identity = 86/171 (50.29%), Postives = 120/171 (70.18%), Query Frame = 3
Query:  264 NNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
            + S G P +GG F L  H G  +T  D+  +W+L+YFG+ HCPDICPE+LEKM  +VD+ID+   +PN+ P+F+++DP+RDT  ++A Y+KEFS K+IGLTG   EI  + ++++V+Y  G KDE  DY+VDH IIMYLIGP G+FL Y+G  K   EI  SI + MR + 
Sbjct:  132 HRSIGKPLLGGPFSLTTHTGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIQVVDEIDSIPTLPNLTPLFITIDPERDTKEAIANYVKEFSPKLIGLTGTKEEIDQVARAFRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKNAEIAGSIAAHMRTHR 302          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|A6H784|SCO2_BOVIN (Protein SCO2 homolog, mitochondrial OS=Bos taurus OX=9913 GN=SCO2 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.738e-52
Identity = 69/164 (42.07%), Postives = 116/164 (70.73%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 785
            GDF L+DH+G  R + DF+ +W+L+YFG+ HCPDICP++LEK+  +V +++    +P + P+F++VDP+RDT  ++A+Y+++F  +++GLTG   +I  +++SY+V+Y  G KDE  DY+VDH+I +YL+ P G F  YY  A+S ++I  S+   M  +  ++
Sbjct:  102 GDFSLLDHRGRVRCKADFRGQWVLLYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPLFITVDPERDTVAAMARYVQDFHPRLLGLTGSAEQIAQVSRSYRVYYSAGPKDEDQDYIVDHSIAIYLLSPDGLFTDYYSRARSAEQITDSVRRHMAAFRSVL 265          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Match: sp|Q8VCL2|SCO2_MOUSE (Protein SCO2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco2 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.842e-52
Identity = 85/251 (33.86%), Postives = 146/251 (58.17%), Query Frame = 3
Query:   45 NFSKYIKFLRFS--KILNINQSFYCSKSLL--PKSRRKLMIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 785
              S++   LR S  + L+ N   +  +     P  R +L+I    T       G A    R  +E ++           + G     GDF L+DHKG  R + DF+ +W+L+YFG+ HCPDICP++LEK+  +V K++   ++P + P+F++VDP+RD   ++A+Y++EF  +++GLTG   ++ + +++Y+V+Y  G KDE  DY+VDH+I +YL+ P G F  YYG ++S ++I  SI   +  ++ ++
Sbjct:   12 KLSQFKPLLRISGGETLHRNSRHWAGQGQRQGPGLRTRLLI----TALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQ----GDFSLLDHKGQPRCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQPVFITVDPERDDVAAMARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQIVESIRRHIAAFHSVL 254          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: A0A452IUW6 (SCO cytochrome c oxidase assembly protein 1 OS=Gopherus agassizii OX=38772 GN=SCO1 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 9.870e-64
Identity = 92/170 (54.12%), Postives = 124/170 (72.94%), Query Frame = 3
Query:  267 NSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
             + G P +GG F LVDH+G  RT  DF  +W+L+YFG+ HCPDICPE+LEKM L VD+ID   ++PN+ P+F+++DP+RDT  +VA+Y+KEFS K+IGLTG   +I+ + ++Y+V+Y +G KDE  DY+VDH IIMYLIGP G F+ YYG  K   EI  SI + MR Y 
Sbjct:  108 RALGKPLLGGPFSLVDHQGQPRTNRDFLGQWVLIYFGFTHCPDICPEELEKMILAVDEIDQIPSLPNVTPLFITIDPERDTGEAVARYVKEFSPKLIGLTGTKEQIEQVARAYRVYYSSGPKDEDNDYIVDHTIIMYLIGPDGGFVDYYGQNKKNSEIATSIAAHMRQYK 277          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: A0A4D9DQT7 (EMILIN-1 OS=Platysternon megacephalum OX=55544 GN=DR999_PMT18256 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.353e-63
Identity = 92/170 (54.12%), Postives = 125/170 (73.53%), Query Frame = 3
Query:  267 NSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
             + G P +GG F LVDH+G  RT  DF  +W+L+YFG+ HCPDICPE+LEKM L VD+ID   ++PN+ P+F+++DP+RDT  +VA+Y+KEFS K+IGLTG   +I+ ++++Y+V+Y +G KDE  DY+VDH IIMYLIGP G F+ YYG  K   EI  SI + MR Y 
Sbjct:  107 RAVGKPLLGGPFSLVDHQGQPRTNRDFLGQWVLIYFGFTHCPDICPEELEKMILAVDEIDKIPSLPNVTPLFITIDPERDTGEAVARYVKEFSPKLIGLTGTKEQIEQVSRAYRVYYSSGPKDEDHDYIVDHTIIMYLIGPDGGFVDYYGQNKKNSEIATSIAAHMRQYK 276          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: K7G5X0 (SCO cytochrome c oxidase assembly protein 1 OS=Pelodiscus sinensis OX=13735 GN=SCO1 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 6.577e-63
Identity = 89/170 (52.35%), Postives = 126/170 (74.12%), Query Frame = 3
Query:  267 NSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
             + G P +GG F LVDH+G  RT  DF  +W+L+YFG+ HCPDICPE+LEKM L VD+ID   ++P++ P+F+++DP+RDT  ++A+Y+KEFS K++GLTG   +I+ + ++Y+V+Y +G KDE  DY+VDH IIMYLIGP GDF+ YYG  K   EI +SI + MR + 
Sbjct:   59 RALGKPLLGGPFSLVDHQGQPRTNKDFLGQWVLIYFGFTHCPDICPEELEKMILAVDEIDKIPSLPDVTPLFITIDPERDTGEAIARYVKEFSPKLVGLTGTKEQIEQVARAYRVYYSSGPKDEDNDYIVDHTIIMYLIGPDGDFVDYYGQNKKNSEIASSIAAHMRQHK 228          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: A0A091G1F6 (Uncharacterized protein (Fragment) OS=Cuculus canorus OX=55661 GN=N303_04651 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 2.964e-62
Identity = 90/170 (52.94%), Postives = 124/170 (72.94%), Query Frame = 3
Query:  264 NNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            N   G P +GG F LV+HKG  RT  D+  +W+L+YFG+ HCPDICP++LEKM  +VD+ID   ++PN+ P+F+++DP+RDT  ++A+Y+KEFS K+IGLTG   +I  + ++Y+V+Y  G KDE  DY+VDH IIMYL+GP GDF+ YYG  K   EI ASI + MR Y
Sbjct:   23 NRGIGKPLLGGPFSLVNHKGQPRTSKDYIGQWVLIYFGFTHCPDICPDELEKMIEVVDEIDRIPSLPNLTPLFITIDPERDTEEAIARYVKEFSPKLIGLTGTKAQIDQVAKAYRVYYSEGPKDEDDDYIVDHTIIMYLLGPDGDFVDYYGQNKRSTEISASIAAHMRKY 192          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Match: A0A091N4A5 (Uncharacterized protein (Fragment) OS=Acanthisitta chloris OX=57068 GN=N310_03492 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.850e-62
Identity = 88/170 (51.76%), Postives = 123/170 (72.35%), Query Frame = 3
Query:  264 NNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            N   G P +GG F LV H+G  RT  D+  +W+L+YFG+ HCPDICP++LEKM  +VD+ID   ++PN+ P+F+++DP+RD+  ++A+Y+KEFS K++GLTG   +I  + ++Y+V+Y  G KDE  DY+VDH IIMYL+GP GDF+ YYG  K   EI ASI S MR Y
Sbjct:   15 NRGIGKPLLGGPFSLVSHEGQPRTSKDYLGQWVLIYFGFTHCPDICPDELEKMVAVVDEIDRIPSLPNLTPLFITIDPERDSQEAIARYVKEFSPKLVGLTGTRAQIDQVAKAYRVYYSEGPKDEDNDYIVDHTIIMYLLGPDGDFVDYYGQNKRSTEISASIASHMRKY 184          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Cavefish
Match: sco1 (SCO cytochrome c oxidase assembly protein 1 [Source:ZFIN;Acc:ZDB-GENE-140909-1])

HSP 1 Score: 200.675 bits (509), Expect = 5.309e-62
Identity = 94/217 (43.32%), Postives = 134/217 (61.75%), Query Frame = 3
Query:  129 PKSRRKLMIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNV 779
            P + + L I     G   F+ G+  +K  + E        I      S G   +GG F LVDH        DF  +W+L+YFG+ HCPDICP++LEKM+ +V +ID+   +P++ P+ +++DPDRDTP ++AKY+KEFS K+IGLTG   +I+  +++Y+V++  G KDE  DY+VDH IIMYL+GP G F+ YYG  K   EI ASI S MR   +
Sbjct:  102 PVTWKSLAITFAIGGT--FLLGMKYFKKEKEEM-------IERERTRSVGKAALGGPFSLVDHNNKPTKSDDFLGQWVLIYFGFTHCPDICPDELEKMAEVVKEIDSIRTLPDLTPLLITIDPDRDTPEALAKYVKEFSPKLIGLTGTAAQIQEASRAYRVYFSQGPKDEDNDYIVDHTIIMYLVGPDGQFVDYYGQNKKATEISASIASHMRKQKL 309          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Cavefish
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 194.126 bits (492), Expect = 7.559e-60
Identity = 81/160 (50.62%), Postives = 119/160 (74.38%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            GDF L DH G +R++ D++  W+L+YFG+ HCPDICPE+LEKM+ +V+ +D  +N+P + P+FV+VDP+RD   ++AKY+K+F  ++IGLTG P E+K + Q+Y+V+   G KD+ GDY+VDH II+YLI P G FL YY  AKS  +I  S+ + M+N+
Sbjct:  114 GDFSLTDHTGKRRSKKDYRGSWVLMYFGFTHCPDICPEELEKMASVVNLLDEETNLPRVQPLFVTVDPERDDTATMAKYVKDFHPRLIGLTGTPEEVKEVGQTYRVYASAGPKDDDGDYIVDHTIIIYLINPDGLFLDYYNRAKSATQIAESVRNHMKNH 273          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Sea Lamprey
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 143.28 bits (360), Expect = 8.527e-42
Identity = 62/165 (37.58%), Postives = 107/165 (64.85%), Query Frame = 3
Query:  291 GGDFQLVDHKGVQRTRVDF-KNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEY-GDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNV 779
            G  F+L D  G +    D    +W L+YFG+ HCPD+CPE++EK+S ++  +D ++N+P + P+FV++DP RD   +VA+YIK+F  +++GLTG P +I  I+++Y+V+ + G +D    +Y+VDH+II YLI P G  L++Y  +    ++   +   +R + +
Sbjct:   39 GVKFELTDQSGRKVKGHDLLVGRWSLLYFGFTHCPDVCPEEMEKVSGVIHTLDKDTNLPRVQPVFVTIDPQRDDVAAVAQYIKDFHPRLVGLTGSPEQISAISKAYRVYAQPGPRDPTDQEYVVDHSIITYLICPHGAVLEFYNRSVEEADMAEKVRQRLRAHRL 203          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Yeast
Match: SCO2 (Protein anchored to mitochondrial inner membrane; may have a redundant function with Sco1p in delivery of copper to cytochrome c oxidase; interacts with Cox2p; SCO2 has a paralog, SCO1, that arose from the whole genome duplication [Source:SGD;Acc:S000000228])

HSP 1 Score: 132.109 bits (331), Expect = 1.190e-36
Identity = 62/154 (40.26%), Postives = 100/154 (64.94%), Query Frame = 3
Query:  261 SNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKT--GIKDEYGDYLVDHAIIMYLIGPQGDFLQYYG 716
            +N +YG   +GG F L D  G   T  + K K+ ++YFG+ HCPDICPE+L++++  + ++D+  ++  I P+F+S DP RDTP+ + +Y+ +F   +IGLTG   ++K++ + YKV++ T   +K    DYLVDH+I  YLI P+G F+   G
Sbjct:  112 ANRAYGSVALGGPFNLTDFNGKPFTEENLKGKFSILYFGFSHCPDICPEELDRLTYWISELDDKDHI-KIQPLFISCDPARDTPDVLKEYLSDFHPAIIGLTGTYDQVKSVCKKYKVYFSTPRDVKPN-QDYLVDHSIFFYLIDPEGQFIDALG 263          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Yeast
Match: SCO1 (Copper-binding protein of mitochondrial inner membrane; required for cytochrome c oxidase activity and respiration; may function to deliver copper to cytochrome c oxidase; similar to thioredoxins; SCO1 has a paralog, SCO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000241])

HSP 1 Score: 125.946 bits (315), Expect = 2.445e-34
Identity = 60/172 (34.88%), Postives = 102/172 (59.30%), Query Frame = 3
Query:  261 SNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYG-DYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNY 773
            +N  YG P +GG F L D  G + T  +   K+ ++YFG+ +CPDICP++L+K+ L ++ + +   +  + P+F++ DP RD+P  + +Y+ +F   ++GLTG   E+KN  + Y+V++ T    + G DYLVDH+I  YL+ P+G F+   G           IV  +++Y
Sbjct:  106 ANRGYGKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGI-TLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYFSTPPNVKPGQDYLVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSY 276          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Nematostella
Match: EDO49876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY8])

HSP 1 Score: 180.259 bits (456), Expect = 1.062e-55
Identity = 78/171 (45.61%), Postives = 115/171 (67.25%), Query Frame = 3
Query:  267 NSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNV 779
             S G   +GG F L+DH G  +T  DF+ KWLL+YFG+ HCPDICP++LEKM+  +D          + P+F+SVDP RDT  +VA+Y+KEF  K++GLTG   +++ + ++Y+V++  G  DE  DY+VDH II YL+ P G+F++Y+G  K+ +EI ASI + M  Y +
Sbjct:   39 RSIGKVALGGPFDLIDHHGKPKTDKDFRGKWLLLYFGFTHCPDICPDELEKMAEAIDLTTKGKVSEELQPLFISVDPKRDTVEAVAEYVKEFHPKLLGLTGPVEKVQEVCKAYRVYFSAGPADEDNDYIVDHTIIQYLVSPDGEFMEYFGQNKNAEEIAASITNHMLKYKL 209          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Nematostella
Match: EDO25395 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWL6])

HSP 1 Score: 54.299 bits (129), Expect = 1.137e-9
Identity = 31/97 (31.96%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  477 IFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFY----KTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIV 755
            IFVSVDP+RDT   +A+YI  F    +G+TG+  ++  +  +    Y         DE  +YLVDH   + L+ P G F   + S  +   I   ++
Sbjct:    4 IFVSVDPERDTLEKLAQYIPYFHPTFLGVTGEHDQLTQLAHNLGAMYLKLPAAAENDE--NYLVDHTGSILLVNPAGHFHAVFTSPHNAQAIAKDLI 98          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Medaka
Match: sco1 (protein SCO1 homolog, mitochondrial [Source:NCBI gene;Acc:101175404])

HSP 1 Score: 197.978 bits (502), Expect = 3.255e-61
Identity = 85/171 (49.71%), Postives = 122/171 (71.35%), Query Frame = 3
Query:  264 NNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYN 776
            N S G P +GG F LVDH        DF  +W+L+YFG+ HCPDICP+++EKM  +VD+ID   ++PN+ P+ +++DP+RDTP ++A Y+KEFS K+IGLTG   +I+ ++++Y+V+Y  G KDE  DY+VDH IIMYLIGP G+F++Y+G  K   EI  SI + MR + 
Sbjct:  109 NKSIGRPALGGPFSLVDHNNKPTKSQDFLGQWVLLYFGFTHCPDICPDEIEKMIEVVDEIDKIQSLPNLTPLLITIDPERDTPEAMAAYVKEFSPKLIGLTGSTAQIEEVSRAYRVYYSQGPKDEDNDYIVDHTIIMYLIGPDGEFVEYFGQNKRGVEISNSIAAHMRKHR 279          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Medaka
Match: sco2 (SCO cytochrome c oxidase assembly protein 2 [Source:NCBI gene;Acc:606683])

HSP 1 Score: 181.415 bits (459), Expect = 4.032e-55
Identity = 76/163 (46.63%), Postives = 118/163 (72.39%), Query Frame = 3
Query:  294 GDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVL 782
            G F LVDH G +RT+ DF   W+L+YFG+ HCPDICP++L+K+S  V  +D ++++P + P+F++VDP+RD   ++A+Y+K+F  ++IGLTG P E+K+  + Y+V+   G KD+ GDY+VDH+I++YL+ P G FL YY   KS ++I  S+ + MR+Y  L
Sbjct:   93 GTFSLVDHTGRRRTKQDFLGSWVLLYFGFTHCPDICPDELDKLSAAVAVLDQDASLPPVQPLFITVDPERDGVPALARYVKDFHPRLIGLTGTPEEVKHAGRDYRVYASPGPKDQDGDYIVDHSILIYLLSPDGLFLDYYNRMKSSEQIADSVRNHMRSYQRL 255          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Planmine SMEST
Match: SMESG000073891.1 (SMESG000073891.1)

HSP 1 Score: 434.106 bits (1115), Expect = 2.780e-155
Identity = 211/212 (99.53%), Postives = 211/212 (99.53%), Query Frame = 3
Query:  150 MIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 785
            MIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYK GIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV
Sbjct:    1 MIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKAGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV 212          
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Planmine SMEST
Match: SMESG000067103.1 (SMESG000067103.1)

HSP 1 Score: 208.379 bits (529), Expect = 4.097e-66
Identity = 102/234 (43.59%), Postives = 151/234 (64.53%), Query Frame = 3
Query:   63 KFLRFSKILNINQSFYCSKSLLPKSRRKLMIVIGCTGFSFFIYGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTRVDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVSVDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDEYGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEM 764
            KF R    +   + F  S         K+ +       S FI G   YK  + +E  KLI  + +  N   G P IGGDF LVDH G   + +DF++KWLL+YFG+C+CPD+CP+Q+EK+ ++VD++ +     N++P+FVSVDP+RDTP  +  Y+KEFS K++GLTG   +I  ++++Y+++Y  G  D++GDY+VDHAIIMYLIGP+G+F++YYG  +S+ EI  SI   M
Sbjct:    3 KFSRLFNSVKFGRRFCSSNPKQDSKYSKMALKTSIFAGSIFIAGYF-YKKYRIDEFEKLI--VQNKLNEGVGTPLIGGDFHLVDHNGTSVSLLDFRSKWLLIYFGFCNCPDVCPDQIEKVVMVVDRLAHKK--INVVPLFVSVDPERDTPEIMKDYLKEFSNKILGLTGSVEDIHAVSKTYRIYYSKGPVDKFGDYIVDHAIIMYLIGPEGEFVEYYGQNRSVPEIARSIQGHM 231          
The following BLAST results are available for this feature:
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCO11.727e-6251.50SCO cytochrome c oxidase assembly protein 1 [Sourc... [more]
SCO25.226e-5240.85SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
SCO25.226e-5240.85SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
SCO25.226e-5240.85SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
SCO25.226e-5240.85SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sco-15.541e-4136.63SCO (Yeast Suppressor of Cytochrome Oxidase defici... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Scox3.883e-6139.56gene:FBgn0262467 transcript:FBtr0079052[more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sco11.669e-5847.40SCO cytochrome c oxidase assembly protein 1 [Sourc... [more]
sco11.838e-5847.40SCO cytochrome c oxidase assembly protein 1 [Sourc... [more]
sco26.757e-5243.75SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
sco26.757e-5243.75SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sirt41.799e-6343.26sirtuin 4 [Source:Xenbase;Acc:XB-GENE-948981][more]
sec24a6.848e-5344.72SEC24 homolog A, COPII coat complex component [Sou... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Sco19.810e-6342.79SCO1 cytochrome c oxidase assembly protein [Source... [more]
Sco11.225e-6150.00SCO1 cytochrome c oxidase assembly protein [Source... [more]
Sco22.634e-5333.86SCO2 cytochrome c oxidase assembly protein [Source... [more]
Sco22.634e-5333.86SCO2 cytochrome c oxidase assembly protein [Source... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75880|SCO1_HUMAN8.293e-6251.50Protein SCO1 homolog, mitochondrial OS=Homo sapien... [more]
sp|Q5SUC9|SCO1_MOUSE8.566e-6150.00Protein SCO1 homolog, mitochondrial OS=Mus musculu... [more]
sp|A1A4J8|SCO1_BOVIN1.106e-6050.29Protein SCO1 homolog, mitochondrial OS=Bos taurus ... [more]
sp|A6H784|SCO2_BOVIN1.738e-5242.07Protein SCO2 homolog, mitochondrial OS=Bos taurus ... [more]
sp|Q8VCL2|SCO2_MOUSE1.842e-5233.86Protein SCO2 homolog, mitochondrial OS=Mus musculu... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A452IUW69.870e-6454.12SCO cytochrome c oxidase assembly protein 1 OS=Gop... [more]
A0A4D9DQT71.353e-6354.12EMILIN-1 OS=Platysternon megacephalum OX=55544 GN=... [more]
K7G5X06.577e-6352.35SCO cytochrome c oxidase assembly protein 1 OS=Pel... [more]
A0A091G1F62.964e-6252.94Uncharacterized protein (Fragment) OS=Cuculus cano... [more]
A0A091N4A53.850e-6251.76Uncharacterized protein (Fragment) OS=Acanthisitta... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sco15.309e-6243.32SCO cytochrome c oxidase assembly protein 1 [Sourc... [more]
sco27.559e-6050.63SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sco28.527e-4237.58SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SCO21.190e-3640.26Protein anchored to mitochondrial inner membrane; ... [more]
SCO12.445e-3434.88Copper-binding protein of mitochondrial inner memb... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO498761.062e-5545.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253951.137e-931.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sco13.255e-6149.71protein SCO1 homolog, mitochondrial [Source:NCBI g... [more]
sco24.032e-5546.63SCO cytochrome c oxidase assembly protein 2 [Sourc... [more]
back to top
BLAST of SCO cytochrome c oxidase assembly protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000073891.12.780e-15599.53SMESG000073891.1[more]
SMESG000067103.14.097e-6643.59SMESG000067103.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023957 ID=SMED30023957|Name=SCO cytochrome c oxidase assembly protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1009bp
CAATACTTTGTTTAAATAATTATTAATTTAAAATTAAAATGAACAATTTC
TCGAAGTACATAAAATTTTTAAGGTTTTCTAAAATTTTAAACATCAATCA
ATCATTTTATTGCAGTAAATCTTTGTTACCAAAATCCAGAAGAAAATTGA
TGATAGTAATAGGATGTACTGGATTCAGTTTTTTTATATATGGTTTAGCT
CAATATAAAAATAGGCAGGCTGAAGAGTCTTATAAACTTATTTTTGATAT
TATTGATTCATCTAATAATTCATATGGGGATCCTGATATAGGAGGAGATT
TTCAACTAGTTGATCATAAAGGAGTTCAGAGGACCAGAGTAGATTTTAAA
AATAAATGGTTATTAGTATATTTTGGTTATTGTCATTGCCCCGATATCTG
CCCTGAGCAGTTAGAAAAAATGTCACTTATCGTAGATAAAATCGACAATA
ATTCCAATGTGCCAAATATCATACCGATATTCGTCAGTGTTGACCCTGAC
AGAGATACTCCTAATAGTGTAGCTAAATATATAAAGGAATTCTCTACCAA
AATGATTGGATTAACCGGAGATCCTCATGAAATCAAAAATATTACGCAGT
CATATAAAGTATTTTATAAAACTGGAATAAAAGATGAATATGGCGATTAC
TTGGTCGATCATGCAATAATCATGTATCTCATCGGTCCTCAAGGTGATTT
CCTCCAATATTATGGCTCTGCGAAATCTATCGATGAAATATATGCTTCTA
TCGTATCAGAAATGAGAAATTATAATGTGTTGGTTTAATGTTGTAAAGGG
CAGTCATTTTTAGTACAATTTTTGTAACCATCGTGATAGTTTTGTTTTAT
TCATTTTCTTGTAATAATTTTTTATAGATTTTTATTGACAATTTTGTAAT
CGCACTGTCCTCAACTTTGGTTACATACTACAGTAGTGAATTGTGTGCCA
TCTGACACTTTGGCACCTAAATGCTTCCTACTAAATAATATTTCAGATTA
TAAATAAAG
back to top

protein sequence of SMED30023957-orf-1

>SMED30023957-orf-1 ID=SMED30023957-orf-1|Name=SMED30023957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=250bp
MNNFSKYIKFLRFSKILNINQSFYCSKSLLPKSRRKLMIVIGCTGFSFFI
YGLAQYKNRQAEESYKLIFDIIDSSNNSYGDPDIGGDFQLVDHKGVQRTR
VDFKNKWLLVYFGYCHCPDICPEQLEKMSLIVDKIDNNSNVPNIIPIFVS
VDPDRDTPNSVAKYIKEFSTKMIGLTGDPHEIKNITQSYKVFYKTGIKDE
YGDYLVDHAIIMYLIGPQGDFLQYYGSAKSIDEIYASIVSEMRNYNVLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR012336Thioredoxin-like_fold
IPR003782SCO1/SenC
Vocabulary: molecular function
TermDefinition
GO:0005507copper ion binding
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0030016myofibril
GO:0072492host cell mitochondrial intermembrane space
Vocabulary: biological process
TermDefinition
GO:0006091generation of precursor metabolites and energy
GO:0006825copper ion transport
GO:0006878cellular copper ion homeostasis
GO:0008535respiratory chain complex IV assembly
GO:0033617mitochondrial respiratory chain complex IV assembly
GO:1901799negative regulation of proteasomal protein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 81..249
e-value: 1.2E-53
score: 183.2
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 82..242
IPR003782Copper chaperone SCO1/SenCPFAMPF02630SCO1-SenCcoord: 85..221
e-value: 7.3E-44
score: 148.9
IPR003782Copper chaperone SCO1/SenCPANTHERPTHR12151SCO1/SENCcoord: 37..246
IPR003782Copper chaperone SCO1/SenCCDDcd02968SCOcoord: 84..226
e-value: 5.78752E-55
score: 171.247
NoneNo IPR availablePANTHERPTHR12151:SF5AT19154Pcoord: 37..246
NoneNo IPR availableTMHMMTMhelixcoord: 37..56