Monocarboxylate transporter

Overview
NameMonocarboxylate transporter
Smed IDSMED30023945
Length (bp)1781
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Monocarboxylate transporter (SMED30023945) t-SNE clustered cells

Violin plots show distribution of expression levels for Monocarboxylate transporter (SMED30023945) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Monocarboxylate transporter (SMED30023945) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Monocarboxylate transporter (SMED30023945) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023945

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30023945h1SMcG0003842 dd_Smed_v4_7474_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A4 (solute carrier family 16 member 4 [Source:HGNC Symbol;Acc:HGNC:10925])

HSP 1 Score: 81.2629 bits (199), Expect = 1.481e-15
Identity = 102/471 (21.66%), Postives = 197/471 (41.83%), Query Frame = 1
Query:   88 TVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNT---------------CNNRIEKDSSDKEIEKVPL------------QEMENGKVNHNEKLKEKKPS------TYKRIHVVML----VIYIIAKVFADVGDVGIAFALPPYG----EKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMF---VAFFFMSL 1365
            T  +D GW W + I  F+ N  V G+ K+F I     QE    +   +   G ++ +  +C  P+  ++C   G +    +G+      ++ + +AT++    + +G   G+   F+Y    V+  + F+ R+ ++  ++ +G+ +  +  P     LID Y   GA ++   IA +   ++ L+ P++I+ E      +K +               C+   E    D   +K  L            +E  NG   +   LK  + S      + K++  + L      YI    F       +A+ +P +      K+L +   D S  ++VAG ++ +S+++ G V+DQ W ++     +  +L   T        ++     +   F + +G  + L+  VL DL     +     +  F  G+ + +G    G+L D ++TY  S  F GI      V+FFF+ L
Sbjct:   12 TKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFCAGPLVAIICDILGEKTTSILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYFKKRLALSTAIARSGMGLTFLLAP-FTKFLIDLYDWTGALILFGAIALNLVPSSMLLRPIHIKSENNSGIKDKGSSLSAHGPEAHATETHCHETEESTIKDSTTQKAGLPSKNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNPFFYIFTWSFL---LSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVSQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPL 478          
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A1 (solute carrier family 16 member 1 [Source:HGNC Symbol;Acc:HGNC:10922])

HSP 1 Score: 70.8626 bits (172), Expect = 2.189e-12
Identity = 79/323 (24.46%), Postives = 143/323 (44.27%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGS--AGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKL-----KEKKPSTYKRIHVVM---------LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSD 1017
            D GW W V IG FI+        KS  +     + + +++ + ++    ++   MY   PI+ +L  K+G R+++ +G   +GC L  I A F   V    + IG   G+ L F  +P   M+G+ F  R  +A GL++AG  +       +  V    +  RG++L+  G+  +  V  ALM P+            K T   +  KD S   +EK     ++    + N  L     K++K S ++ I+  +          ++Y+   V    G       L  YG KS   S++  +  +++   VD+++R  +G+V++
Sbjct:   15 DGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGL--IAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPI----------GPKPT---KAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYG-KSQHYSSEKSAFLLSILAFVDMVARPSMGLVAN 321          
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A1 (solute carrier family 16 member 1 [Source:HGNC Symbol;Acc:HGNC:10922])

HSP 1 Score: 70.8626 bits (172), Expect = 2.189e-12
Identity = 79/323 (24.46%), Postives = 143/323 (44.27%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGS--AGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKL-----KEKKPSTYKRIHVVM---------LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSD 1017
            D GW W V IG FI+        KS  +     + + +++ + ++    ++   MY   PI+ +L  K+G R+++ +G   +GC L  I A F   V    + IG   G+ L F  +P   M+G+ F  R  +A GL++AG  +       +  V    +  RG++L+  G+  +  V  ALM P+            K T   +  KD S   +EK     ++    + N  L     K++K S ++ I+  +          ++Y+   V    G       L  YG KS   S++  +  +++   VD+++R  +G+V++
Sbjct:   15 DGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGL--IAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPI----------GPKPT---KAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYG-KSQHYSSEKSAFLLSILAFVDMVARPSMGLVAN 321          
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A1 (solute carrier family 16 member 1 [Source:HGNC Symbol;Acc:HGNC:10922])

HSP 1 Score: 70.8626 bits (172), Expect = 2.940e-12
Identity = 79/323 (24.46%), Postives = 143/323 (44.27%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGS--AGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKL-----KEKKPSTYKRIHVVM---------LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSD 1017
            D GW W V IG FI+        KS  +     + + +++ + ++    ++   MY   PI+ +L  K+G R+++ +G   +GC L  I A F   V    + IG   G+ L F  +P   M+G+ F  R  +A GL++AG  +       +  V    +  RG++L+  G+  +  V  ALM P+            K T   +  KD S   +EK     ++    + N  L     K++K S ++ I+  +          ++Y+   V    G       L  YG KS   S++  +  +++   VD+++R  +G+V++
Sbjct:   15 DGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGL--IAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPI----------GPKPT---KAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYG-KSQHYSSEKSAFLLSILAFVDMVARPSMGLVAN 321          
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A1 (solute carrier family 16 member 1 [Source:HGNC Symbol;Acc:HGNC:10922])

HSP 1 Score: 70.8626 bits (172), Expect = 2.940e-12
Identity = 79/323 (24.46%), Postives = 143/323 (44.27%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGS--AGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKL-----KEKKPSTYKRIHVVM---------LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSD 1017
            D GW W V IG FI+        KS  +     + + +++ + ++    ++   MY   PI+ +L  K+G R+++ +G   +GC L  I A F   V    + IG   G+ L F  +P   M+G+ F  R  +A GL++AG  +       +  V    +  RG++L+  G+  +  V  ALM P+            K T   +  KD S   +EK     ++    + N  L     K++K S ++ I+  +          ++Y+   V    G       L  YG KS   S++  +  +++   VD+++R  +G+V++
Sbjct:   15 DGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGL--IAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPI----------GPKPT---KAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYG-KSQHYSSEKSAFLLSILAFVDMVARPSMGLVAN 321          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-6 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:O17328])

HSP 1 Score: 67.781 bits (164), Expect = 1.356e-11
Identity = 52/169 (30.77%), Postives = 79/169 (46.75%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSA----GCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYL 594
            D GW W V +G F  +    G   SFG+++ +  E  ++S     L   L+        P+   +C K+G R+    G+     GC LS    YFAT +   VI +G  +G   G +Y P  V+V   F N+  +A G++VAG  +G + F  I    I+ Y  R  +L
Sbjct:   19 DGGWGWVVVLGSFFVHVFADGFVYSFGVLVETLMEEFHASNTMAALIISLLTGLTLGSGPLASAVCNKYGCRITTITGAGVAFVGCALS----YFATAMWHIVITVGVIMGTGFGLMYCPAIVIVTMYFENKRSLATGIAVAGAGVGTVLFAPINAFFINNYGWRSVFL 183          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 57.7658 bits (138), Expect = 1.765e-8
Identity = 44/155 (28.39%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLI 564
            D G+ W +    F++N +V G++ +F     S +E    S       G LI      + P+   LC K+  R ++  G     ++F+ A  + N+ ++++  G   G+  G IY P  V+VG  F ++  +A G+SVAG  +G    P I  V I
Sbjct:   16 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCI 170          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 57.7658 bits (138), Expect = 1.765e-8
Identity = 44/155 (28.39%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLI 564
            D G+ W +    F++N +V G++ +F     S +E    S       G LI      + P+   LC K+  R ++  G     ++F+ A  + N+ ++++  G   G+  G IY P  V+VG  F ++  +A G+SVAG  +G    P I  V I
Sbjct:   16 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCI 170          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 57.7658 bits (138), Expect = 1.765e-8
Identity = 44/155 (28.39%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLI 564
            D G+ W +    F++N +V G++ +F     S +E    S       G LI      + P+   LC K+  R ++  G     ++F+ A  + N+ ++++  G   G+  G IY P  V+VG  F ++  +A G+SVAG  +G    P I  V I
Sbjct:   16 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCI 170          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 57.7658 bits (138), Expect = 2.019e-8
Identity = 44/155 (28.39%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLI 564
            D G+ W +    F++N +V G++ +F     S +E    S       G LI      + P+   LC K+  R ++  G     ++F+ A  + N+ ++++  G   G+  G IY P  V+VG  F ++  +A G+SVAG  +G    P I  V I
Sbjct:   71 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCI 225          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: hrm (gene:FBgn0033028 transcript:FBtr0086072)

HSP 1 Score: 77.411 bits (189), Expect = 1.383e-14
Identity = 53/181 (29.28%), Postives = 88/181 (48.62%), Query Frame = 1
Query:   91 VKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTA 633
            V  D GW W V +G  + N ++ G  KSFG++     +   SS         L Y     L P++ +L  K+ YR +  +G A   L  I +++A+++    I+ G  +GI  G  + P   +V   F    G+A GL ++G ++G I  P ++  L++ Y   G+ L+  GI  + FV A
Sbjct:   48 VPPDGGWGWLVLLGSCLTNILIPGTIKSFGVLFSEFTDAFNSSPTKAAWIPALCYFLYSSLGPVSSILSVKYSYRTVTLLGGASASLGMILSFWASSIEFLYISYGVLVGIGAGLSFPPTVYIVTSYFAKLRGLANGLCISGSALGSIILPPLLRWLLETYGYHGSCLIMGGITLNVFVAA 228          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: hrm (gene:FBgn0033028 transcript:FBtr0345359)

HSP 1 Score: 77.411 bits (189), Expect = 1.383e-14
Identity = 53/181 (29.28%), Postives = 88/181 (48.62%), Query Frame = 1
Query:   91 VKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTA 633
            V  D GW W V +G  + N ++ G  KSFG++     +   SS         L Y     L P++ +L  K+ YR +  +G A   L  I +++A+++    I+ G  +GI  G  + P   +V   F    G+A GL ++G ++G I  P ++  L++ Y   G+ L+  GI  + FV A
Sbjct:   48 VPPDGGWGWLVLLGSCLTNILIPGTIKSFGVLFSEFTDAFNSSPTKAAWIPALCYFLYSSLGPVSSILSVKYSYRTVTLLGGASASLGMILSFWASSIEFLYISYGVLVGIGAGLSFPPTVYIVTSYFAKLRGLANGLCISGSALGSIILPPLLRWLLETYGYHGSCLIMGGITLNVFVAA 228          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: Sln (gene:FBgn0033657 transcript:FBtr0088032)

HSP 1 Score: 76.6406 bits (187), Expect = 3.711e-14
Identity = 70/268 (26.12%), Postives = 116/268 (43.28%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAG---GLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAAL-MPLYIXXXXXXKRNNK------------------------NTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYK 819
            D G+ W +  G F   F V GL KS+G++     E   SS A  T+A     ++      L+P++  LCQ+F  R ++ +G   C +  I +YFAT+++  ++  G   GI  G   +P  V+V + F     +A G+ V+G + G    P +I  L +     G  L+  G   H  V+A L  P+    ++   +  +                        +TC+     + SDK IE + L+E +    NH      K+P+  K
Sbjct:  227 DGGYGWFIVFGAFSVQFWVAGLVKSYGVLYVEIMETFPSSTA--TVASWIPAILSALCLVLAPLSSALCQRFSCRTVVFVGGIFCAMGMILSYFATSLLHLLLTFGVLTGIGGGLSTTPGIVIVSQYFDKHRALANGICVSGTAAGSFILPVLIKHLAENCGFHGTILILGGCMLHVCVSATLYRPISAYTDQDSGQGQEETAKPLNEDINPSTTGILTTSTYLDTCDVGAGHELSDKFIEHLFLEESK----NHLNYYASKQPAQDK 488          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: CG13907 (gene:FBgn0035173 transcript:FBtr0072593)

HSP 1 Score: 73.9442 bits (180), Expect = 2.041e-13
Identity = 54/181 (29.83%), Postives = 85/181 (46.96%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM 642
            D G+ W +    F+ N IV G+A +FGI +       +     +   G L+        PI   L  K+G R +   GS    ++F+ + F+TNV M +   G   G   G IY P  V VG  F  +  +A G++V G   G  AF  + T L+++Y  + A L+ AG+  +  +  A+M
Sbjct:   73 DGGYGWVICFASFMCNMIVDGIAYTFGIFLEEFVAYFHEGKGTVAWVGSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAIFGAMM 253          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: CG13907 (gene:FBgn0035173 transcript:FBtr0345005)

HSP 1 Score: 73.9442 bits (180), Expect = 2.041e-13
Identity = 54/181 (29.83%), Postives = 85/181 (46.96%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM 642
            D G+ W +    F+ N IV G+A +FGI +       +     +   G L+        PI   L  K+G R +   GS    ++F+ + F+TNV M +   G   G   G IY P  V VG  F  +  +A G++V G   G  AF  + T L+++Y  + A L+ AG+  +  +  A+M
Sbjct:   73 DGGYGWVICFASFMCNMIVDGIAYTFGIFLEEFVAYFHEGKGTVAWVGSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAIFGAMM 253          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: slc16a8 (solute carrier family 16 member 8 [Source:ZFIN;Acc:ZDB-GENE-121128-1])

HSP 1 Score: 90.8929 bits (224), Expect = 5.491e-19
Identity = 110/454 (24.23%), Postives = 180/454 (39.65%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVM-----LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR--RSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKFVFDTTSTTTDPPYIKKS 1437
            D GW W V +GGF+         K+  +                     +I   +Y   PI+ ++  KFG R ++ +G     L  I A FAT++I   I  G   G+ L   + P  +M+G  F  R  +A GL+ AG  +   A   +  +L+D+Y  RG +L+  G+  +     A+M PL        K   +  CN  ++        E +P +  +   V  N    +K+PS  K +   +     L+IYIIAK    +G       L  Y  K   + +++ +  +++ G +D+ +R   G+V+   W R   S   + A L    T         Y    IF   FGL  G    L   VL  +VG      +  +++    + +  G    GYL D  K Y       G  +  A  F++L      F   +     D P  +++
Sbjct:   15 DGGWGWVVLLGGFVITGFSYAFPKAISVYFKELMHDFGCGYKDTAWISSIILAMLYGSGPISSIMVNKFGCRPVMLVGGLLASLGMISASFATSIIHLYITAGVITGLGLALNFQPSLIMLGAYFDKRRPLANGLAAAGSPVFLSALSPLGQLLLDQYGWRGGFLITGGLLLNCCTCGAVMRPL--------KLKERKACNQELK--------EMLPPEAGQENIVCENN--NDKQPSKKKLLDFSVLRDKGLIIYIIAKFIVVLGLFVPTILLVNY-AKDQGVPDKEAAFLLSIIGFIDIFARPTCGVVAGLKWVRPKMSYFFSLALLFNGLTDVCSATSTDYKGLIIFCVFFGLSYGMVGALQFEVLMGIVGTSKFSSALGLVLLFEAVAVLIGPPSAGYLVDKYKNYELIFYMAGGELITAGIFLALA----SFCCISQKKRKDSPQTQQT 445          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: slc16a8 (solute carrier family 16 member 8 [Source:ZFIN;Acc:ZDB-GENE-121128-1])

HSP 1 Score: 90.8929 bits (224), Expect = 5.491e-19
Identity = 110/454 (24.23%), Postives = 180/454 (39.65%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVM-----LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR--RSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKFVFDTTSTTTDPPYIKKS 1437
            D GW W V +GGF+         K+  +                     +I   +Y   PI+ ++  KFG R ++ +G     L  I A FAT++I   I  G   G+ L   + P  +M+G  F  R  +A GL+ AG  +   A   +  +L+D+Y  RG +L+  G+  +     A+M PL        K   +  CN  ++        E +P +  +   V  N    +K+PS  K +   +     L+IYIIAK    +G       L  Y  K   + +++ +  +++ G +D+ +R   G+V+   W R   S   + A L    T         Y    IF   FGL  G    L   VL  +VG      +  +++    + +  G    GYL D  K Y       G  +  A  F++L      F   +     D P  +++
Sbjct:   15 DGGWGWVVLLGGFVITGFSYAFPKAISVYFKELMHDFGCGYKDTAWISSIILAMLYGSGPISSIMVNKFGCRPVMLVGGLLASLGMISASFATSIIHLYITAGVITGLGLALNFQPSLIMLGAYFDKRRPLANGLAAAGSPVFLSALSPLGQLLLDQYGWRGGFLITGGLLLNCCTCGAVMRPL--------KLKERKACNQELK--------EMLPPEAGQENIVCENN--NDKQPSKKKLLDFSVLRDKGLIIYIIAKFIVVLGLFVPTILLVNY-AKDQGVPDKEAAFLLSIIGFIDIFARPTCGVVAGLKWVRPKMSYFFSLALLFNGLTDVCSATSTDYKGLIIFCVFFGLSYGMVGALQFEVLMGIVGTSKFSSALGLVLLFEAVAVLIGPPSAGYLVDKYKNYELIFYMAGGELITAGIFLALA----SFCCISQKKRKDSPQTQQT 445          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: slc16a4 (solute carrier family 16 member 4 [Source:ZFIN;Acc:ZDB-GENE-070112-602])

HSP 1 Score: 65.4698 bits (158), Expect = 1.152e-10
Identity = 112/498 (22.49%), Postives = 195/498 (39.16%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRN---------------NKNT--CNNRIEKDSS-----DKEIEKVPLQE----------------------------------------MENGKVNHNEKLKEKKPS--TYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYG----EKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKF 1386
            D GW W V +  F+ N +V G  K+FGI   + Q+    S   ++  G ++ +      P+  + C K G R+   +G+      F+ + FAT+V    I++G  +G+    +Y    V++   FR R+  A  +  +G+ +   A      +L+D+Y  +GA L+  G+  +   +  L+ P+ I        N               N NT   N   + DSS     D  I K P+ E                                        +ENG+    E + E  P    +  +      IY  + VF+      +A+ +P +      ++L +   D S  I+VAG  + ++++  G V+D+    +     A  +L            SY    ++   F +  G  + L+  VL DLVG   L  S    MF +GL    G    G+L D ++TY  S    G+   ++   + LE   +++
Sbjct:   39 DGGWGWMVVLHCFLVNVLVMGTLKTFGIFFVALQDEFGGSSESISWIGSIMSSLRLSGGPLASVACAKLGNRVTSIVGALFVSAGFLFSIFATSVTYLYISMGLVVGLGFALLYQATSVVIVTYFRKRLATAYSIGRSGMGL-TFALAPFTQLLLDQYAWQGALLILGGLMLNLVASGMLLRPINIRHPASPISNSTIHKTEKDPLKNNMNGNTPVANGTSKSDSSPPIHKDTLIIKNPVHEQNSLPHLDLKKPTQNGVNGTDSSQTKTSPEMNGVSPVDSLLENGRT---ENVPENSPKVLDFSLLKNPFFCIYTWSLVFSQ-----LAYFIPYFHLSARARNLGIDPMDASFIISVAGITETVAQLASGWVTDRNLVHKYHYHKAYLILCGVVNLLSPLATSYILLMVYAVFFAIFCGGYMALLLPVLVDLVGADKLNNSMGFSMFFVGLGCLTGPPLAGFLYDYTQTYDCSFYLAGVCYLLSSISLFLEPLARRW 527          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: slc16a4 (solute carrier family 16 member 4 [Source:ZFIN;Acc:ZDB-GENE-070112-602])

HSP 1 Score: 65.4698 bits (158), Expect = 1.152e-10
Identity = 112/498 (22.49%), Postives = 195/498 (39.16%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRN---------------NKNT--CNNRIEKDSS-----DKEIEKVPLQE----------------------------------------MENGKVNHNEKLKEKKPS--TYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYG----EKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKF 1386
            D GW W V +  F+ N +V G  K+FGI   + Q+    S   ++  G ++ +      P+  + C K G R+   +G+      F+ + FAT+V    I++G  +G+    +Y    V++   FR R+  A  +  +G+ +   A      +L+D+Y  +GA L+  G+  +   +  L+ P+ I        N               N NT   N   + DSS     D  I K P+ E                                        +ENG+    E + E  P    +  +      IY  + VF+      +A+ +P +      ++L +   D S  I+VAG  + ++++  G V+D+    +     A  +L            SY    ++   F +  G  + L+  VL DLVG   L  S    MF +GL    G    G+L D ++TY  S    G+   ++   + LE   +++
Sbjct:   39 DGGWGWMVVLHCFLVNVLVMGTLKTFGIFFVALQDEFGGSSESISWIGSIMSSLRLSGGPLASVACAKLGNRVTSIVGALFVSAGFLFSIFATSVTYLYISMGLVVGLGFALLYQATSVVIVTYFRKRLATAYSIGRSGMGL-TFALAPFTQLLLDQYAWQGALLILGGLMLNLVASGMLLRPINIRHPASPISNSTIHKTEKDPLKNNMNGNTPVANGTSKSDSSPPIHKDTLIIKNPVHEQNSLPHLDLKKPTQNGVNGTDSSQTKTSPEMNGVSPVDSLLENGRT---ENVPENSPKVLDFSLLKNPFFCIYTWSLVFSQ-----LAYFIPYFHLSARARNLGIDPMDASFIISVAGITETVAQLASGWVTDRNLVHKYHYHKAYLILCGVVNLLSPLATSYILLMVYAVFFAIFCGGYMALLLPVLVDLVGADKLNNSMGFSMFFVGLGCLTGPPLAGFLYDYTQTYDCSFYLAGVCYLLSSISLFLEPLARRW 527          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: si:ch211-234h8.7 (si:ch211-234h8.7 [Source:ZFIN;Acc:ZDB-GENE-061009-16])

HSP 1 Score: 64.3142 bits (155), Expect = 1.872e-10
Identity = 70/319 (21.94%), Postives = 131/319 (41.07%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELL------YSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNA--IAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V  G F+         K+  +     +EL+      YS  A ++    ++   +Y   P+  +L  +FG R ++ +G     L  I A FAT++I   +  G   G+ +   + P  +M+ R F  +  +A GL+ AG  +       +  VL  +Y  RG +L+  GI  +     ALM   +  +       +N        D  DK ++  P       K+      +++    Y     +M++   +  VF       +++A         E+ N+D  +A  +++ G +D+ +R   G+++   W R
Sbjct:   17 DGGWGWAVLFGCFVITGFSYAFPKAVSVFF---KELIREFGVGYSDTAWIS---SILLAMLYGTGPLCSILVNRFGCRPVMLVGGLFASLGMILASFATSIIHIYLCTGVITGLGMALNFQPSLIMLNRYFSEKRPLANGLAAAGSPVALCCLSPLGQVLQYEYGWRGGFLILGGILLNCCACGALMRPLVPPKSSEAPGIENA------PDDGDKTVKPKP-------KLLDFSVFRDRGFLIYTIAASIMVLGLFVPPVFV------VSYA--------KELGNEDTKSALLLSILGFIDIFARPTCGIIAGLQWVR 302          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 75.485 bits (184), Expect = 7.862e-14
Identity = 77/317 (24.29%), Postives = 132/317 (41.64%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVML------VIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V  G FI+        K+  +     QE+  +S + +     ++   MY   PI+ +L  K+G R ++  G   C L+ I A F  +V+   I IG   G  L F   P   ++G+ F  +  IA GL++AG  +       +   L +++  RG++L+  G+  +  V  +LM                     I      K+IEK P       K + N K KE    +  +   + L      +IY+   V   +G       L PY  K + +     +  +++   VD+++R  +GMV++  + R
Sbjct:   14 DGGWGWVVVFGSFISIGFSYAFPKAITVFFKEIQEIFNTSYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPVVIGGGVLCSLAMISASFCNSVMQLYICIGVMGGFGLAFNLQPSLTIIGKYFFKKRPIANGLAMAGSPVFLSTLAPLNQFLFNQFGWRGSFLILGGLLLNCCVAGSLM-------------------RPIGPKPVKKDIEKAP-------KDDENHKKKESVCQSINKYLDLSLFKHRGFLIYLSGNVIMFIGFFAPIVFLAPYA-KHMGIDQYSSAFLLSILAFVDMVARPTMGMVANTRFIR 303          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 74.3294 bits (181), Expect = 1.271e-13
Identity = 77/317 (24.29%), Postives = 132/317 (41.64%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVML------VIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V  G FI+        K+  +     QE+  +S + +     ++   MY   PI+ +L  K+G R ++  G   C L+ I A F  +V+   I IG   G  L F   P   ++G+ F  +  IA GL++AG  +       +   L +++  RG++L+  G+  +  V  +LM                     I      K+IEK P       K + N K KE    +  +   + L      +IY+   V   +G       L PY  K + +     +  +++   VD+++R  +GMV++  + R
Sbjct:   14 DGGWGWVVVFGSFISIGFSYAFPKAITVFFKEIQEIFNTSYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPVVIGGGVLCSLAMISASFCNSVMQLYICIGVMGGFGLAFNLQPSLTIIGKYFFKKRPIANGLAMAGSPVFLSTLAPLNQFLFNQFGWRGSFLILGGLLLNCCVAGSLM-------------------RPIGPKPVKKDIEKAP-------KDDENHKKKESVCQSINKYLDLSLFKHRGFLIYLSGNVIMFIGFFAPIVFLAPY-AKHMGIDQYSSAFLLSILAFVDMVARPTMGMVANTRFIR 303          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: mad2l1 (mitotic arrest deficient 2 like 1 [Source:Xenbase;Acc:XB-GENE-947153])

HSP 1 Score: 68.9366 bits (167), Expect = 9.271e-12
Identity = 72/330 (21.82%), Postives = 139/330 (42.12%), Query Frame = 1
Query:   82 MSTVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGK---VNHNEKLKEKKPST-YKRIHVVMLVIYIIAKVFAD--VGDVGIAFA-------LPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            M     D GW W V +G FI+       +K+  +     QE   +S + +     ++   MY   P++ +L  ++G R ++  G     +  I A F+++++   I IG   G        P  ++VG+ F  +  IA GL++AG  +       +   L DK+  RG++ +   +  +  V  AL            R    +  ++I+K  +    EK   + +        ++  K++E K  T  ++ + V+ +     + F    VG+V + FA       L PY  K L +     +  +++   VD+ +R   G++++  W R
Sbjct:    9 MGYTPPDGGWGWMVVLGAFISMGFSYAFSKAITVFFKEIQEHFGASYSEIAWISSILLAAMYAGGPVSSILVNRYGSRPVVIFGGLLSGVGMIIATFSSSILQLYIFIGVIAGFGFSLNLQPSVIVVGKYFLKKRPIANGLAMAGSPVVLSTLAPLNQFLFDKFGWRGSFFILGALLLNCCVAGALF-----------RPIGPSTTDKIQKKPAQDLAEKGTNETLLTANKLPPSYGTKMEETKQETCLQKFNKVLDLTLFKHRGFMIYLVGNVVMFFAFYAPIVFLTPYA-KHLGVDEYSAAFLLSILAIVDMFARPGTGLIANTKWVR 326          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: slc16a12 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:394932])

HSP 1 Score: 66.2402 bits (160), Expect = 3.233e-11
Identity = 70/314 (22.29%), Postives = 135/314 (42.99%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXX------XXXXKRNNKNTCNNRIEKDSSDKEIEKVPL-QEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSD 1017
            D GW W + IG F        + +   I     Q       A       ++       +PI   +   F  ++ I +G        + + FAT++    + +G   G+     YSP   MVG+ F  R  +A G++++G  IG      ++ +LI++++ RGA L+  G   +  V  ALM P+ ++E       +  +  N+ T + R++   S       PL Q+  + ++ +  K KE     Y  +     ++  ++ +F   G       L PY   ++ +SNQ+ +  +++ G +D++  +  G V+D
Sbjct:   14 DGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDYARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPITLKEDSLHYPLKQEQMENEPTQSGRLDSSCS-------PLCQDCSHKRLCYCTK-KE-----YSFLLKPKFMVLAVSFLFLAYGCSPPFVYLVPYA-LNVGVSNQEAAFLMSILGIIDIVGNITFGWVTD 313          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: atf6b (activating transcription factor 6 beta [Source:Xenbase;Acc:XB-GENE-1013925])

HSP 1 Score: 62.3882 bits (150), Expect = 1.267e-9
Identity = 62/250 (24.80%), Postives = 99/250 (39.60%), Query Frame = 1
Query:   94 KIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKV----PLQEMENGKVNHNEKLKEKKPSTYKRIHV 831
             ID+GWAW V +  F+ + +V G   + GI+     E    S         L       + PI  L     G R    IG     L ++ + +A NV     + G   GI  G +Y P  V VG  F+ R  +A GLS  G   G      ++  L  +   R A ++   +  +  V  ALM     +EE +K + +   + +  K+ +   +  +     L E E GK + +  +   K  T   I +
Sbjct:   28 NIDRGWAWMVVLSSFLVHLLVMGSQMALGILNLEWLEEFKQSRGLTAWISSLSMGITLIVGPIIGLFINTCGCRKTAMIGGFLTSLGWVLSAYAPNVHFLFFSFGVTAGIGSGMVYLPAVVTVGHYFQKRRALAQGLSTTGTGFGTFLITVLLKYLCRELGWRNAMIIQGAVTLNLCVCGALMRPLDHDEEHLKDHEEAAVDPKDAKEGALLNVNAIKANSELHEEEEGKASADTAVSWSKEETRNDIFI 277          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a12 (solute carrier family 16 (monocarboxylic acid transporters), member 12 [Source:MGI Symbol;Acc:MGI:2147716])

HSP 1 Score: 71.633 bits (174), Expect = 1.149e-12
Identity = 86/431 (19.95%), Postives = 177/431 (41.07%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR--RSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKK 1383
            D GW W +  G F+       + +   I     Q       +       ++       +P+  ++  +   +  I +G       FI   FAT++    +++G   G+     YSP   MVG+ F  R  +A G++++G  IG      ++ +LI++++ RGA L+  G   +  V  ALM P+ ++E+  +   N    N   +++   +     PL + E  +      L+++    Y  + +   V+  ++ +F   G   +   L PY   S+ +S+   +  +++ G +D++  +  G ++D+   +  R +    A  L+           ++     F   FG   G  +TL+ VV  ++VG  +L  +  ++ F   +         G+L D + +Y  +    G  M  +   +     VK+
Sbjct:   14 DGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDYSQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDRSVPEKNH---NRESQREDCKQASPYSPLTK-ECTETRLCCSLQQE----YGFLLMSDFVVLAVSVLFMAYGCSPLFVYLVPYA-LSVGVSHHQAAFLMSILGVIDIVGNITFGWLTDRRCLKNYRYVCYLFAVALDGLCYLCLPMLQTFPLLVPFSCTFGYFDGAYVTLIPVVTAEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGWLVDTTGSYTAAFLLCGFAMIFSSILLGFVRIVKR 435          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a4 (solute carrier family 16 (monocarboxylic acid transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385183])

HSP 1 Score: 71.2478 bits (173), Expect = 1.650e-12
Identity = 96/489 (19.63%), Postives = 197/489 (40.29%), Query Frame = 1
Query:   88 TVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRI-------------------------HVVMLVIYIIAKVFADVGDV---------------GIAFALPPYG----EKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLG---INMFVAFFFMSLEYPVKKFVFDTTSTT 1410
            T  +D GW W V +  F+ N  V G+ K+F I     QE    +   +   G ++ +  +   P+  ++C   G +    +G+      ++ + +AT +    + +G   G+   F+Y    V++ + F+ R+G++  ++ +G+ +  +  P     LID Y   GA ++   I  +   ++ L+ P++ +        NK +  +  E ++S K  E    +E +   +  +   K ++P+T   +                         H    V +   +   D+                   +A+ +P +      K+L +   D S  ++VAG  + +S+++ G ++DQ W ++     +  +L   T        ++     +  +F + +G  + L+  VL DL     +        F  G+ + +G    G++ D ++TY  S  F G   I   V+ FF+ L    K+   D   TT
Sbjct:   12 TKPLDGGWGWMVVLHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFSAGPLAAIICDVLGEKATSILGTFLVSGGYVISSWATGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKKRLGLSTAIARSGMGLTFLLAP-FTKFLIDLYDWTGALILFGAIILNLVPSSMLLRPIHSQSNNNSDIENKGSILSATEPEASYKT-ETSKCKETQEPFIKDSTMKKSEQPTTTLTVLGNQSEEFSNRPHRNRPLLMSNGKSHKKKFVSWNCKQKLLDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDVMDASYLVSVAGITETVSQLISGWIADQNWIKKYQYHKSYLILCGVTNLLAPLATTFPLLMAYTILFAIFAGGYLALILPVLVDLSKNSRVHKFLGYASFFAGIAVLSGPPIAGWIYDYTQTYTGSFYFSGTCYILSSVSLFFVPLAERWKRKQSDLLRTT 498          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a1 (solute carrier family 16 (monocarboxylic acid transporters), member 1 [Source:MGI Symbol;Acc:MGI:106013])

HSP 1 Score: 65.855 bits (159), Expect = 6.839e-11
Identity = 74/323 (22.91%), Postives = 141/323 (43.65%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGS--AGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVM---------LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V +G FI+        KS  +     + +  ++ + ++    ++   MY   PI+ +L  K+G R ++  G   +GC L  I A F   V    + IG   G+ L F  +P   M+G+ F  +  +A GL++AG  +       +     D +  RG++L+  G+  +  V  +LM P+  E+ ++ K  +K +     + D++   I   P               K +K S ++ I+  +          ++Y+   V    G       L  YG KS + S++  +  +++   VD+++R  +G+ ++  W R
Sbjct:   15 DGGWGWAVLVGAFISIGFSYAFPKSITVFFKEIEVIFSATTSEVSWISSIMLAVMYAGGPISSILVNKYGSRPVMIAGGCLSGCGL--IAASFCNTVQELYLCIGVIGGLGLAFNLNPALTMIGKYFYKKRPLANGLAMAGSPVFLSTLAPLNQAFFDIFDWRGSFLILGGLLLNCCVAGSLMRPIGPEQVKLEKLKSKESLQEAGKSDANTDLIGGSP---------------KGEKLSVFQTINKFLDLSLFTHRGFLLYLSGNVVMFFGLFTPLVFLSSYG-KSKDFSSEKSAFLLSILAFVDMVARPSMGLAANTKWIR 319          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a4 (solute carrier family 16 (monocarboxylic acid transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385183])

HSP 1 Score: 60.8474 bits (146), Expect = 2.357e-9
Identity = 68/361 (18.84%), Postives = 148/361 (41.00%), Query Frame = 1
Query:   88 TVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTY-------------------------KRIHVVMLVIYIIAKVFADVGDV---------------GIAFALPPYG----EKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRR 1035
            T  +D GW W V +  F+ N  V G+ K+F I     QE    +   +   G ++ +  +   P+  ++C   G +    +G+      ++ + +AT +    + +G   G+   F+Y    V++ + F+ R+G++  ++ +G+ +  +  P     LID Y   GA ++   I  +   ++ L+ P++ +        NK +  +  E ++S K  E    +E +   +  +   K ++P+T                           + H    V +   +   D+                   +A+ +P +      K+L +   D S  ++VAG  + +S+++ G ++DQ W ++
Sbjct:   12 TKPLDGGWGWMVVLHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFSAGPLAAIICDVLGEKATSILGTFLVSGGYVISSWATGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKKRLGLSTAIARSGMGLTFLLAP-FTKFLIDLYDWTGALILFGAIILNLVPSSMLLRPIHSQSNNNSDIENKGSILSATEPEASYK-TETSKCKETQEPFIKDSTMKKSEQPTTTLTVLGNQSEEFSNRPHRNRPLLMSNGKSHKKKFVSWNCKQKLLDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDVMDASYLVSVAGITETVSQLISGWIADQNWIKK 370          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a7 (solute carrier family 16 (monocarboxylic acid transporters), member 7 [Source:MGI Symbol;Acc:MGI:1330284])

HSP 1 Score: 59.6918 bits (143), Expect = 7.064e-9
Identity = 65/311 (20.90%), Postives = 129/311 (41.48%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V    FI+        K+  +     QE+  ++ + +     ++   MY   PI+ +L   +G R ++ +G   C +  I A ++ +VI   + +G   G+ L F   P   ++G+ F  R  +A G ++AG  +           L + Y  +G++L+  GI  H  V   LM           + +K+   +R   DS+ K+  KV   +  N  ++ +  +                +IY+   V   +G       L  Y  K + + + + +  ++V   +D+ +R  +G++++    R
Sbjct:   16 DGGWGWVVVCASFISIGFSYAFPKAVTVFFKDIQEIFNTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCIGMILASYSNSVIELYLTVGFIGGLGLAFNLQPALTIIGKYFYRRRPLANGCAMAGSPVFLSTLAPFNQYLFNNYGWKGSFLILGGIFLHSCVAGCLM--RPVGPSPNTKKSKSKVGSR--HDSTLKKASKVSTAQKVNRFLDFSLFMHRG------------FLIYLSGNVILFLGIFAPIIFLAQYA-KHIGVDDYNSAFLLSVMAFIDMFARPSVGLIANTSLIR 309          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|O15374|MOT5_HUMAN (Monocarboxylate transporter 5 OS=Homo sapiens OX=9606 GN=SLC16A4 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.112e-15
Identity = 102/471 (21.66%), Postives = 197/471 (41.83%), Query Frame = 1
Query:   88 TVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNT---------------CNNRIEKDSSDKEIEKVPL------------QEMENGKVNHNEKLKEKKPS------TYKRIHVVML----VIYIIAKVFADVGDVGIAFALPPYG----EKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMF---VAFFFMSL 1365
            T  +D GW W + I  F+ N  V G+ K+F I     QE    +   +   G ++ +  +C  P+  ++C   G +    +G+      ++ + +AT++    + +G   G+   F+Y    V+  + F+ R+ ++  ++ +G+ +  +  P     LID Y   GA ++   IA +   ++ L+ P++I+ E      +K +               C+   E    D   +K  L            +E  NG   +   LK  + S      + K++  + L      YI    F       +A+ +P +      K+L +   D S  ++VAG ++ +S+++ G V+DQ W ++     +  +L   T        ++     +   F + +G  + L+  VL DL     +     +  F  G+ + +G    G+L D ++TY  S  F GI      V+FFF+ L
Sbjct:   12 TKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFCAGPLVAIICDILGEKTTSILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYFKKRLALSTAIARSGMGLTFLLAP-FTKFLIDLYDWTGALILFGAIALNLVPSSMLLRPIHIKSENNSGIKDKGSSLSAHGPEAHATETHCHETEESTIKDSTTQKAGLPSKNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNPFFYIFTWSFL---LSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVSQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPL 478          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|Q6GM59|MOT12_XENLA (Monocarboxylate transporter 12 OS=Xenopus laevis OX=8355 GN=slc16a12 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.399e-15
Identity = 94/453 (20.75%), Postives = 179/453 (39.51%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVM---LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR--RSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKFVFDTTSTTTDPPYIKKSV 1440
            D GW W + IG F        + +   I     Q       A       ++       +PI   +   F  ++ I +G        + + FAT++    + +G   G+     YSP   MVG+ F  R  +A G++++G  IG      ++ +LI++++ RGA L+  G   +  V  ALM P+                   +++DS    +++ P  +     +  +   K+    T K  H ++    +I  ++ +F   G       L PY   S+ +S+Q+ +  +++ G VD++  +  G V+D+ + +  R      A  L+     F      +     F  +FG   G  + L+ V+  D+VG  NL  +  ++ F   +         G+L D +  Y  +    G +M      + L   + +   +  +T      IK+ V
Sbjct:   14 DGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDYARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPI------------------SLKEDSLHYPLKREPQLDSSCSPLCQDCSHKKLCYCTTKEYHFLLKPKFIILAVSFLFLAYGCSPPFVYLVPY-SLSVGVSHQEAAFLMSILGIVDIVGNITFGWVTDRRFLKKHRYCCYLIAVGLDGLCCLFLPILTCFQLLVPFSVMFGYFDGAYVALIPVITGDVVGTSNLSSALGVVFFLHAVPYLLSPPIAGWLVDTTGDYTAAFLLSGFSMIFCSILLGLAKIINRIKKNPQATVVRSSDIKQEV 447          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|Q3MHW6|MOT1_BOVIN (Monocarboxylate transporter 1 OS=Bos taurus OX=9913 GN=SLC16A1 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.896e-12
Identity = 77/326 (23.62%), Postives = 139/326 (42.64%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKL-----KEKKPSTYKRIHVVM---------LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V IG FI+        KS  +     + +  ++ + ++    ++   MY   PI+ +L  K+G R ++ +G        I A F   V     ++G   G+ L F  +P   M+G+ F  R  +A GL++AG  +       +       Y  RG++L+  G+  +  V  ALM P+            K T     EK+ S   +++    E + G  + N  L     KE+K S ++ ++  +          ++Y+   V    G       L  YG KS   S++  +  +++   VD+++R  +G+V++  W R
Sbjct:   15 DGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFNATTSEVSWISSIMLAVMYGGGPISSVLVNKYGSRPVMIVGGILSGSGLIAASFCNTVQELYFSVGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLSTLAPLNQAFFMIYGWRGSFLILGGLLLNCCVAGALMRPI----------GPKPTT---AEKEKSKGSLQEAGKYETKKGASDANTDLIGGNPKEEKKSIFQTLNTFLDLSLFKHRGFLLYLSGNVLMFFGLFTPLVFLSNYG-KSKHYSSEKAAFLLSILAFVDMVARPSMGLVANTKWVR 326          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|Q8BGC3|MOT12_MOUSE (Monocarboxylate transporter 12 OS=Mus musculus OX=10090 GN=Slc16a12 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 8.035e-12
Identity = 86/431 (19.95%), Postives = 177/431 (41.07%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR--RSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKK 1383
            D GW W +  G F+       + +   I     Q       +       ++       +P+  ++  +   +  I +G       FI   FAT++    +++G   G+     YSP   MVG+ F  R  +A G++++G  IG      ++ +LI++++ RGA L+  G   +  V  ALM P+ ++E+  +   N    N   +++   +     PL + E  +      L+++    Y  + +   V+  ++ +F   G   +   L PY   S+ +S+   +  +++ G +D++  +  G ++D+   +  R +    A  L+           ++     F   FG   G  +TL+ VV  ++VG  +L  +  ++ F   +         G+L D + +Y  +    G  M  +   +     VK+
Sbjct:   14 DGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDYSQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDRSVPEKNH---NRESQREDCKQASPYSPLTK-ECTETRLCCSLQQE----YGFLLMSDFVVLAVSVLFMAYGCSPLFVYLVPYA-LSVGVSHHQAAFLMSILGVIDIVGNITFGWLTDRRCLKNYRYVCYLFAVALDGLCYLCLPMLQTFPLLVPFSCTFGYFDGAYVTLIPVVTAEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGWLVDTTGSYTAAFLLCGFAMIFSSILLGFVRIVKR 435          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|P53985|MOT1_HUMAN (Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.412e-11
Identity = 79/323 (24.46%), Postives = 143/323 (44.27%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGS--AGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKL-----KEKKPSTYKRIHVVM---------LVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSD 1017
            D GW W V IG FI+        KS  +     + + +++ + ++    ++   MY   PI+ +L  K+G R+++ +G   +GC L  I A F   V    + IG   G+ L F  +P   M+G+ F  R  +A GL++AG  +       +  V    +  RG++L+  G+  +  V  ALM P+            K T   +  KD S   +EK     ++    + N  L     K++K S ++ I+  +          ++Y+   V    G       L  YG KS   S++  +  +++   VD+++R  +G+V++
Sbjct:   15 DGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGL--IAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPI----------GPKPT---KAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYG-KSQHYSSEKSAFLLSILAFVDMVARPSMGLVAN 321          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: G7YEU6 (Monocarboxylate transporter 2 OS=Clonorchis sinensis OX=79923 GN=CLF_106233 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.684e-79
Identity = 181/513 (35.28%), Postives = 271/513 (52.83%), Query Frame = 1
Query:   82 MSTVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKD-----------SSDKEIEKVPLQE--MENGKVNHNEKLK--------------EKKPSTY-----------------------------------KRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWC--RRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXX--------------LCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKF 1386
            M TV +D   AW   IGGF+ANF++GGL KS+G+IM + QE+  S  A   LAGGLIYT M+CLS +   + Q++G R ++  G+ G  LS + A F+ ++ +WV+A+G G+G SL  IY  +F +VG+CFR  +G+A G+SVAGVS+GQ+AFPS++T L + Y  RG  ++ + +  H  +TAALMP YI     ++RN+ +    + ++D            S + +E+V L E  + N     N+KL               EK P +                                     ++   +LV+YI+ KVF D+GDV I+F  P +G K L  S   IS AIA++G VDL++R+ +G ++D+P C  RR  +L   WL+    +  F      +S                       +CSGTA+T M VVL+D VG   LP S A+ M  +GL I  GQ+ +GY+ADV+  Y  SL+   + M  A   + +E+PV+ +
Sbjct:    1 MKTVYVDSPQAWCTVIGGFVANFLLGGLGKSYGLIMDAFQEVYQSGSALFMLAGGLIYTLMFCLSLVNHYISQRYGSRPVVFAGAIGSCLSLLVAAFSPSIGLWVLAVGVGLGASLSCIYFTVFSVVGQCFRRYLGLANGISVAGVSVGQMAFPSLMTHLNEVYGTRGGAVIISALCLHLLITAALMPRYI-----VERNSSSEQVTKKQRDPARKRRLFRPRKSQRSVERVQLAEASLSNNSDFVNKKLGDTKLDQMYVELMDMEKPPPSQAAGDIPNQPAYPASETKTQSLKKTLSSMSLTTRFDAQLSRALLVVYILGKVFGDIGDVSISFVAPAHGTK-LGFSPTIISRAIAISGAVDLVARLGVGWLTDRPSCVGRRGPLLATVWLVTGINSLGFSTLTRLFSADPSKEAPTGLLAAYYFCFAVHGVCSGTAMTQMIVVLSDWVGPSRLPHSLALTMVVLGLAISPGQFAIGYVADVTHDYVWSLRICFLIMMTAGILLLMEFPVRVY 507          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: A0A419PSJ8 (Monocarboxylate transporter 1 OS=Clonorchis sinensis OX=79923 GN=SLC16A1 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 2.602e-79
Identity = 181/514 (35.21%), Postives = 271/514 (52.72%), Query Frame = 1
Query:   79 FMSTVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKD-----------SSDKEIEKVPLQE--MENGKVNHNEKLK--------------EKKPSTY-----------------------------------KRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWC--RRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXX--------------LCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKF 1386
             M TV +D   AW   IGGF+ANF++GGL KS+G+IM + QE+  S  A   LAGGLIYT M+CLS +   + Q++G R ++  G+ G  LS + A F+ ++ +WV+A+G G+G SL  IY  +F +VG+CFR  +G+A G+SVAGVS+GQ+AFPS++T L + Y  RG  ++ + +  H  +TAALMP YI     ++RN+ +    + ++D            S + +E+V L E  + N     N+KL               EK P +                                     ++   +LV+YI+ KVF D+GDV I+F  P +G K L  S   IS AIA++G VDL++R+ +G ++D+P C  RR  +L   WL+    +  F      +S                       +CSGTA+T M VVL+D VG   LP S A+ M  +GL I  GQ+ +GY+ADV+  Y  SL+   + M  A   + +E+PV+ +
Sbjct:   45 LMKTVYVDSPQAWCTVIGGFVANFLLGGLGKSYGLIMDAFQEVYQSGSALFMLAGGLIYTLMFCLSLVNHYISQRYGSRPVVFAGAIGSCLSLLVAAFSPSIGLWVLAVGVGLGASLSCIYFTVFSVVGQCFRRYLGLANGISVAGVSVGQMAFPSLMTHLNEVYGTRGGAVIISALCLHLLITAALMPRYI-----VERNSSSEQVTKKQRDPARKRRLFRPRKSQRSVERVQLAEASLSNNSDFVNKKLGDTKLDQMYVELMDMEKPPPSQAAGDIPNQPAYPASETKTQSLKKTLSSMSLTTRFDAQLSRALLVVYILGKVFGDIGDVSISFVAPAHGTK-LGFSPTIISRAIAISGAVDLVARLGVGWLTDRPSCVGRRGPLLATVWLVTGINSLGFSTLTRLFSADPSKEAPTGLLAAYYFCFAVHGVCSGTAMTQMIVVLSDWVGPSRLPHSLALTMVVLGLAISPGQFAIGYVADVTHDYVWSLRICFLIMMTAGILLLMEFPVRVY 552          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: A0A4E0R8E9 (Monocarboxylate transporter 2 OS=Fasciola hepatica OX=6192 GN=D915_007013 PE=4 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 4.092e-78
Identity = 180/523 (34.42%), Postives = 272/523 (52.01%), Query Frame = 1
Query:   82 MSTVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEK-------------------DSSDKEIEKVPLQE----------MENG-------------------------------KVNHNEKLKEKKP-----------STYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWC--RRSLILNAAWLLE-----AFTAFFFVWXXXXXXXXXXXXX----------XXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKF 1386
            MSTV +D   AW    GGF+ANF++GGLAKS+G++M + QE   S  A L LAGGLIYT MYCLS +   L  ++G R ++ +G+ G  +S + A ++ N+ +WVIAIG G+G SL  IY  +F ++G+CFR  +G+A G+SVAGVS+GQ+AFPS+IT L   Y  RG  +V + I  H  +TAAL+P +I + +    +++     ++ +                   +S D+E+ ++              +ENG                               K N  E L +                 + +   +L +YI+AK+F D+GDV ++F  P +G K L ++   +S AIA+ G VDL+SR+ +G ++D+P C  RR L+L   W++E     AFT  + +             +           G+CSGTA+T M VVL D VG   LP S A+ M  +GL I  GQ+ +GYLADV+  Y   L+     + +A F + +E+PV+ F
Sbjct:    1 MSTVYVDSPSAWFTVAGGFVANFLLGGLAKSYGLVMEAFQEEFQSGTAYLLLAGGLIYTLMYCLSLVNHYLSLRYGSRPIVLVGAIGSCVSLLVAAYSPNIALWVIAIGLGVGASLSCIYFTVFSVIGQCFRRYLGLANGISVAGVSVGQMAFPSLITYLNQTYGTRGGTVVMSAICLHLLITAALLPRHIVDPDAPPPSSEKKAAAKLGQNRRPRRRFKLRRKLREKSVNSQDREVVELTANSTLVSLDAVDLLENGGSAFGGADKTTSLLELDGKALTTAMGDVPADKSNDTEVLSQNGSVCRGSVRSFGTRHARSLSHALLAVYILAKIFGDIGDVSVSFIAPTHGTK-LGLNGVTVSRAIAIGGGVDLVSRLGVGWLTDRPGCVGRRGLLLAITWIVEGLNTLAFTELYRLKPVDAQIQETPTALIVGYFICFGIHGVCSGTAMTQMVVVLADWVGSARLPHSLALTMLVLGLLISPGQFAIGYLADVAMNYVWPLRLCFFILIIAGFLLLMEFPVRWF 522          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: A0A4V3S7R6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011287 PE=4 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.155e-77
Identity = 180/512 (35.16%), Postives = 266/512 (51.95%), Query Frame = 1
Query:   82 MSTVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYI----XXXXXXKRNNKNTCNNR--IEKDSSDKEIEKVPLQE------MENGKVNHNEKLKEKK-----------------------------PSTYKRIHVV--------------------MLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWC--RRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXX--------------LCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKF 1386
            M TV +D   AW   IGGF+ANF++GGL KS+G+IM + QE+  S  A   LAGGLIYT M+CLS +   + Q++G R ++  G+ G  LS + A F+ ++ +WV+A+G G+G SL  IY  +F +VG+CFR  +G+A G+SVAGVS+GQ+AFPS++T L + Y  RG  ++ + +  H  +TAALMP YI       E + +  ++    R       S + +E   L E      + N     N+KL + K                             PS+  +   +                    +LV+YI+ KVF D+GDV I+F  P +G K L  S   IS AIA++G VDL++R+ +G ++D+P C  RR  +L   WL+    A  F      +S                       +CSGTA+T M VVL+D VG   LP S A+ M  +GL I  GQ+ +GY+ADV+  Y  SL+   + M  A   + +E+PV+ +
Sbjct:    1 MKTVYVDSPQAWCTVIGGFVANFLLGGLGKSYGLIMDAFQEVYQSGSALFMLAGGLIYTLMFCLSLVNHYISQRYGSRPVVFAGAIGSCLSLLVAAFSPSIGLWVVAVGVGLGASLSCIYFTVFSVVGQCFRRYLGLANGISVAGVSVGQMAFPSLMTHLNEVYGTRGGAVIISALCLHLLITAALMPRYIVERGSSSEQVTKKQRDPARKRRLFRPRKSQRSVEGAKLTEDSTLASLSNNCEFVNKKLGDTKLDQMYVELMDMEKPPPSQAAGDIPTQPAYPSSETKTQSLKKTLSSMSLTTRFDAEFSRALLVVYILGKVFGDIGDVCISFVAPAHGTK-LGFSPTIISRAIAISGAVDLVARLGVGWLTDRPSCVGRRGPLLATVWLVTGINALGFSTLTRLFSADPSKEAPTGLLAAYYFCFAVHGVCSGTAMTQMIVVLSDWVGPSRLPHSLALTMVVLGLAISPGQFAIGYVADVTHDYVWSLRICFLIMMTAGILLLMEFPVRAY 511          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: A0A068WHJ8 (Monocarboxylate transporter OS=Echinococcus granulosus OX=6210 GN=EgrG_000489100 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 2.442e-77
Identity = 178/482 (36.93%), Postives = 266/482 (55.19%), Query Frame = 1
Query:   82 MSTVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKR--NNKNTCNNRIEKDSSDKEIEKVP------LQEMENGKVNHNEKLKEKKPSTYK----------RIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWC--RRSLILNAAWLLEAFTAFFF------VWXXXXXXXXXXX--------------------XXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKFV 1389
            M+TV +D   AWG  +GGFIANF++GGL KS+GIIM + Q+   +  A  TL GG+IY  M+ LS     + Q+ G R ++ IG     +S + A  A  V +W IAIGGG+G S   +Y  IF +VGRCFR ++G+A GLSVAGVS+GQ+AFPS++T ++ +Y VR   L+ +  + H  VTAALMP ++ +         + ++ + R+E++  +     +P        ++E  +++   + ++    TY           R+   +L+IY+I KVFAD GDVGI+F  PPYG + +  S    + AIAVAG VDL SR+  G ++D+P C  RR   L A WL+E+  A  F       W P  +S F                        + G+CSGTA+T M +VL+D VG   L  S AIMM ++GL     Q  +GYL D++ +Y  S++  G+ + V      LE P+++ +
Sbjct:    1 MATVVVDSPRAWGTVLGGFIANFLLGGLGKSYGIIMDAFQDEFEAPTAIFTLTGGIIYMLMFILSLPNHFVVQRIGDRAVVMIGGISACISLLVASVAPTVTVWAIAIGGGVGFSFSCVYFNIFSVVGRCFREKLGLANGLSVAGVSVGQMAFPSLVTFVLQRYGVRMGTLIMSAFSLHLCVTAALMPRHVVDAVSEADIAPSSSSISRRMEEEQEEPYSSVIPSPLGGSADDIETKEIDSMLQHRDDASVTYSHSPVRGHKGARLATALLIIYVIGKVFADNGDVGISFIAPPYGSQ-IGFSAHTTNLAIAVAGVVDLFSRLSFGWLTDKPMCKGRRGTFLAATWLVESAVAIAFGQITGIGWTPKTFSSFSNQGRLLKGSPTNAQTAAYYICFALQGVCSGTAMTQMIIVLSDWVGPERLAKSLAIMMVNLGLLYVPAQAVIGYLNDLTGSYVWSMRLCGLWLLVGGLVFLLESPIRRLL 481          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: zgc:165507 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:103037399])

HSP 1 Score: 76.2554 bits (186), Expect = 2.875e-14
Identity = 112/467 (23.98%), Postives = 180/467 (38.54%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKL-KEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSL--ILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTY-------ATSLKFLGINMFVAFF--FMSLEYPVKKFVFDTTSTTTDPPYIKKSVENEENEQ 1461
            D GW W V  G FI+        K+  +     Q +  +S + +     ++   MY   PI+ +L   +G R ++  G   C L  I A F T+VI   I IG   G  L F   P   M+G+ F  +  IA G ++AG  +       +   LI+ +  RG++L+  G+  +  V  +LM PL                  +  K   D+E   VP  + E  K+   E L K    S +K       +IY+   +   +G       L PY  K   +     +  +++   VD+ +R  +G++++  W R  +    + A L              Y    ++   FG   G    ++   L DLVG      +  +        +  G    G L DV+K+Y        T + F  I +F+  F  +  LE   KK      + T DP   K   E E N +
Sbjct:   14 DGGWGWAVVCGAFISIGFSYAFPKATTVFFKDIQRIFDASYSQVAWISSIMLAVMYAGGPISSILVNTYGSRPVMMAGGVLCSLGMIAASFCTSVIQLYICIGVIGGFGLAFNLQPALTMIGKYFYKKRPIANGFAMAGSPVFLSTLAPLNQYLINAFGWRGSFLILGGLLLNCCVAGSLMRPL-----------------PQPPKKDKDEETAVVPATKTE--KLTAWETLNKYLDLSLFKHRG---FLIYLSGNMIMFLGFFAPIVFLSPYA-KDNGVDEYSAAFLLSILAFVDMFARPSMGLLANSRWVRPRIQYFFSFAVLYNGVCHLLCPLAEGYTGMVVYAVFFGFAFGMVSAVLFETLMDLVGAQRFSSAVGLTTIVECGPVLIGPPLAGRLVDVTKSYKYMYICCGTVVIFASIWLFIGNFINYRLLEKERKKEEMYKRTETEDPDKDKDRAEAEPNTE 457          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: zgc:165507 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:103037399])

HSP 1 Score: 76.2554 bits (186), Expect = 2.875e-14
Identity = 112/467 (23.98%), Postives = 180/467 (38.54%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKL-KEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSL--ILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTY-------ATSLKFLGINMFVAFF--FMSLEYPVKKFVFDTTSTTTDPPYIKKSVENEENEQ 1461
            D GW W V  G FI+        K+  +     Q +  +S + +     ++   MY   PI+ +L   +G R ++  G   C L  I A F T+VI   I IG   G  L F   P   M+G+ F  +  IA G ++AG  +       +   LI+ +  RG++L+  G+  +  V  +LM PL                  +  K   D+E   VP  + E  K+   E L K    S +K       +IY+   +   +G       L PY  K   +     +  +++   VD+ +R  +G++++  W R  +    + A L              Y    ++   FG   G    ++   L DLVG      +  +        +  G    G L DV+K+Y        T + F  I +F+  F  +  LE   KK      + T DP   K   E E N +
Sbjct:   14 DGGWGWAVVCGAFISIGFSYAFPKATTVFFKDIQRIFDASYSQVAWISSIMLAVMYAGGPISSILVNTYGSRPVMMAGGVLCSLGMIAASFCTSVIQLYICIGVIGGFGLAFNLQPALTMIGKYFYKKRPIANGFAMAGSPVFLSTLAPLNQYLINAFGWRGSFLILGGLLLNCCVAGSLMRPL-----------------PQPPKKDKDEETAVVPATKTE--KLTAWETLNKYLDLSLFKHRG---FLIYLSGNMIMFLGFFAPIVFLSPYA-KDNGVDEYSAAFLLSILAFVDMFARPSMGLLANSRWVRPRIQYFFSFAVLYNGVCHLLCPLAEGYTGMVVYAVFFGFAFGMVSAVLFETLMDLVGAQRFSSAVGLTTIVECGPVLIGPPLAGRLVDVTKSYKYMYICCGTVVIFASIWLFIGNFINYRLLEKERKKEEMYKRTETEDPDKDKDRAEAEPNTE 457          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: slc16a8 (solute carrier family 16 member 8 [Source:ZFIN;Acc:ZDB-GENE-121128-1])

HSP 1 Score: 71.633 bits (174), Expect = 8.661e-13
Identity = 74/319 (23.20%), Postives = 130/319 (40.75%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEM---ENGKVNHN----EKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V +GGF+         K+  +             +       ++   +Y   P++ ++  ++G R ++  G        I A F TN+I   +  G   G+ L   + P  +M+G  F  R  +A GL+ AG  +       +  VL+++Y  RG +L+  G+  +     A+M PL                  R+   ++  E   + L+EM   + G+ N N      L++K            LVIYIIAK    +G       L  Y  K   + ++D +  +++ G +D+ +R   G+V+   W R
Sbjct:   13 DGGWGWIVLLGGFVITGFSYAFPKAISVYFKELMRDFGCGYSDTAWISSIMLAMLYGSGPVSSIMVNRYGCRPVMLFGGLLASAGMIGASFTTNIIQLYLTAGVITGLGLALNFQPSLIMLGCYFDKRRPLANGLAAAGSPVFLSVLSPLGQVLLERYGWRGGFLIMGGLLLNCCTCGAVMRPL----------------RCRVRTTAARGEANALELKEMLPSKPGQENSNLLDFSVLRDKG-----------LVIYIIAKFIVVLGLFVPTILLVNY-AKDQGIPDKDAAFLLSIIGFIDIFARPTCGIVAGLKWVR 303          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: slc16a7 (monocarboxylate transporter 2-like [Source:NCBI gene;Acc:103047734])

HSP 1 Score: 67.3958 bits (163), Expect = 1.981e-11
Identity = 74/321 (23.05%), Postives = 136/321 (42.37%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNN-KNTCNNRIEKDSSDKEIEKVPL----QEMENG----KVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V  G FI+        KS  I     QE    S + +     ++   MY   P++ +L  ++G R ++ +G     +  + A F T ++   I +G   GI L F   P   ++G+ F  +  IA GL++AG  +       +   L D +  +G++ +   I  +  V  ALM P+ ++ +  + +++  +     + +   D + + V L    Q+ + G    +VN    L   K   Y        +IY++A V    G       L PY  K   +     +  +++   VD+++R   G+V++  W R
Sbjct:   15 DGGWGWAVVFGSFISIGFSYAFPKSLTIYFKEIQEYFSISYSEIAWVSSIMLATMYAGGPVSSILVNRYGSRPVVMVGGLLVGVGMVAASFGTTIMHLYICVGVIGGIGLAFNLQPALTIIGKYFHVKRPIANGLAMAGSPVFLSTLAPLNQFLFDTFGWQGSFFILGAIVLNCCVAGALMRPINVKAKPAVSQSSGGDRSAGEVGEGEGDVDPQAVGLVSEKQQPKRGGCAARVNQFIDLSLFKHRGY--------LIYLVANVGMFFGFFAPVVFLAPYA-KHQGIDEYSAAFLLSIFALVDMVARPGTGLVANTKWIR 326          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 67.0106 bits (162), Expect = 2.783e-11
Identity = 86/417 (20.62%), Postives = 176/417 (42.21%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLI-YTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAK---VFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR--RSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFV-----GYLADVSKTYATS 1314
            D GW W +  G F+       + +   I     Q       +       L+  T M C +P+  L+      R+ + +G     +  + + FAT++    +++G   G+     Y+P   MVG  F  R  +A G++++G  IG      ++ +LI+ Y+ RGA L+  G+  +  V  AL+ P+ ++EEE       + C    +   +    E+   +++E  +       K++   + +  H +++  +++     +F   G       L PY    + +S+   +  +++ G +D++  +  G ++D+   +  R +    A  +E    F      ++     F  ++G   G  + L+ VV +D+VG   L  +  ++      F+ A  Y V     G+L D + TY  +
Sbjct:   15 DGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDYSGTAWIHSLVDCTTMLC-APLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVLTGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKEEEACPLPVDSECGYSTKPLVAISPAEE---KQLEAERSKQQRDSKQRCLQSMQEYHFLLMPDFLVLAGSFLFLASGCSLPFVYLVPYA-LDVGVSHHHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRGICYMVAVGMEGLCCFLIPLLHTFALLVPFSVLYGYFDGAYVALIPVVTSDVVGTTYLSSALGVVY-----FLHAIPYLVSPPIGGWLVDTTGTYTAT 421          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: zgc:165507 (solute carrier family 16 member 7 [Source:HGNC Symbol;Acc:HGNC:10928])

HSP 1 Score: 81.2629 bits (199), Expect = 1.556e-16
Identity = 76/322 (23.60%), Postives = 135/322 (41.93%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKV-NHNEKLKEKKPSTYKRIHVVML----------VIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V +G FI+        K+  +     QE+ +++ + +     ++   MY   PI+ +L  K+G R ++  G        I A F   +      IG   G+ L F   P   ++G+ F  +  IA G+S+AG  +G      +  VLI+ +  RG++L+ A +  +  V  +LM                       KD+  K  E+VP   +EN  +   N + K+K   ++    + +L          +IY+   V    G       L PY  K + + N   +  ++V   VD+++R   G++++ P  R
Sbjct:   15 DGGWGWAVVVGAFISIGFSYAFPKAITVFFKDIQEIFHTTYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPIVIAGGILAGTGMIAASFCNTIFQLYFCIGVIGGLGLAFNLQPALTIIGKYFYKKRPIANGISMAGSPVGLSTIAPLNQVLINNFGWRGSFLILAALLFNCCVAGSLM---------------RPVGPTPAKDARKKGKEEVP-NNLENPLLATSNSEAKDKNGDSFSSRFMQLLDLTLFKHRGFLIYLSGNVIMFFGFFAPVVFLAPYA-KHMGIENYSAAFLLSVMAFVDMVARPTTGLLANHPRIR 319          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001631.1 (pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 gene:ENSPMAG00000001470.1 transcript:ENSPMAT00000001631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 4.899e-13
Identity = 47/181 (25.97%), Postives = 87/181 (48.07%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM 642
            D GW W + +  F+   +V G+ +S G+      E    S   ++    +        SPI   L  +FG R ++ +G     + F+CA FA  ++   +++G   G     ++SP    + + F  R  +A+G++ +GV +   AF  +  +L++ YT RGA ++ AG+  +  V  AL+
Sbjct:    9 DGGWGWLIVLAAFVQVSLVFGVVRSVGVFFIEFTEYFQESSTAISWITSIALCVHQFASPIASTLSNQFGSRSVVIVGGISACIGFLCASFAHCLLHLYLSLGLLTGFGWAMVFSPSISTLSKYFDKRRSLALGIAFSGVGMSSFAFSPLFQMLVETYTWRGALMILAGLELNLCVCGALL 189          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009308.1 (pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 gene:ENSPMAG00000008418.1 transcript:ENSPMAT00000009308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 2.714e-12
Identity = 64/311 (20.58%), Postives = 128/311 (41.16%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V +G FI+        K+  +     QE+  ++ + +     ++   MY   P++ +L  ++G R ++  G        + A F T+++     IG   G  L     P   ++G+ F  +  IA GL++AG  +       +  +L++ +  RG++++  G+  +  V  ALM           +   +        +S+ +EI          G++   ++ KE    T  + H   L IY+   V   +G       L PY  + + +     +  + +   VD++ R   G++++  W R
Sbjct:   15 DGGWGWAVVVGAFISIGFSYAFPKAITVFFSEIQEIFQTTYSEIAWISSIMLAIMYAGGPVSSILVNRYGSRPVVVAGGVLAGTGMVLASFCTSILQLYFCIGVIGGFGLAMNLQPALTIIGKYFYKKRPIANGLAMAGSPVMLSTLAPLNQLLLNNFGWRGSFMILGGLLLNCCVAGALM--------RPVKPPPSAPAALTATESATREI----------GRLRKQKRFKELLDLTLFK-HRGFL-IYLSGNVVMFLGFFSPIVFLAPY-ARHMGIEKYSAAFLLTILAIVDMVCRPTCGLIANSRWIR 304          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 67.0106 bits (162), Expect = 5.558e-12
Identity = 52/186 (27.96%), Postives = 80/186 (43.01%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYI 654
            D GW W V +  FI N     + +   I     Q       A       ++       +PI  LL   FG R  +  G       FI A FAT++ M  + +G   G      YSP  VMV + FR R  +A GL+++G  +G      ++  L+D ++ RGA L+      +  V  AL+ P+++
Sbjct:    7 DGGWGWMVVLACFIVNVCTRAVTRCISIFFMEFQSHFQKDYATTAWINSMVDCLTMLCAPIGSLLSSHFGCRATVMAGGLFSSAGFIMASFATSIEMLYVFLGVFAGFGFSLCYSPSIVMVTKYFRRRRALATGLAMSGSGVGTFLLAPLVQYLLDVFSWRGALLLLGAFVSNLCVCGALLRPIHL 192          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009306.1 (pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 gene:ENSPMAG00000008418.1 transcript:ENSPMAT00000009306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.289e-11
Identity = 62/319 (19.44%), Postives = 129/319 (40.44%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-----PLYIXXXXXXKRNNKNTCNNRIEKDSSDK---EIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V +G FI+        K+  +     QE+  ++ + +     ++   MY   P++ +L  ++G R ++  G        + A F T+++     IG   G  L     P   ++G+ F  +  IA GL++AG  +       +  +L++ +  RG++++  G+  +  V  ALM     P           +       R +K S  +      K+   + + G +   ++L +     ++       +IY+   V   +G       L PY  + + +     +  + +   VD++ R   G++++  W R
Sbjct:   15 DGGWGWAVVVGAFISIGFSYAFPKAITVFFSEIQEIFQTTYSEIAWISSIMLAIMYAGGPVSSILVNRYGSRPVVVAGGVLAGTGMVLASFCTSILQLYFCIGVIGGFGLAMNLQPALTIIGKYFYKKRPIANGLAMAGSPVMLSTLAPLNQLLLNNFGWRGSFMILGGLLLNCCVAGALMRPVKPPPSAPAALTATESATEIGRLRKQKHSVSRCGNSPVKINPHDTKEGFLQRFKELLDLTLFKHRG-----FLIYLSGNVVMFLGFFSPIVFLAPYA-RHMGIEKYSAAFLLTILAIVDMVCRPTCGLIANSRWIR 327          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO30043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1X2])

HSP 1 Score: 75.8702 bits (185), Expect = 9.605e-15
Identity = 64/235 (27.23%), Postives = 106/235 (45.11%), Query Frame = 1
Query:   97 IDKGWAWGVPIGGFIANFIVGGLAKSFGII----MGSTQELLYSSIA-----PLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAAL-MPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGK 771
            +D GWAW V    F   FIV G  +SFGII    +   Q   Y ++      PL   G + Y  ++ + P+T  L    G R M+ IG+   +L  + + FAT++ +  +  G    I   F Y P  +++   F   +  A GLS+ G  IG I   S+I  +  +Y  R    +  G++   FV  ++ +P          +     C++ IEK  S K+ ++VP+    + +
Sbjct:    1 MDAGWAWVVCAASFFIQFIVFGTIQSFGIIFVSLLNEFQASEYETVVVVPRFPLACVGSMAYGMLFFIGPVTTALTDHVGCRKMVMIGTCLIILGLVTSSFATSLSVLYVTFGVLWSIGASFAYFPAILVLRFYFFGNLSFANGLSMTGAGIGTIVLNSVINYVNQRYGWRTGMRMLGGVSAVMFVCGSIYLP--------PPQEGTPLCSHGIEKKYSSKQ-KRVPISRFIDPR 226          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO46207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQQ5])

HSP 1 Score: 70.8626 bits (172), Expect = 5.498e-13
Identity = 86/370 (23.24%), Postives = 145/370 (39.19%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDK----YTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVG 1197
            D+GWAW V  G F+  FIV G+  SFG+++ +     + S A     G +   F++  SP+T  + +++G R +  +G     L      +A N+++  I  G   G       +   ++    F   + +A G+  AG SIG +     +  L++K    Y VR   + G  IAC  FV               +R  +   N+R  +                   +N N+K +    S  +       +++I     A  G     F L  Y E  L +     S  I+  G    + R++ G +SD    R   I  A  LL    +       +Y     +    G+  G+ I LM++V  ++VG
Sbjct:   47 DRGWAWMVCAGSFLIMFIVYGIHTSFGVLLNALLNHFHESKAKTAWVGSIGLNFLFLGSPVTSRVAERYGIRTVTILGGVFISLGLFLTSYAPNIVVIYITYGLLFGSGTSLCGTMALIISVDYFDKHLSLATGIVAAGCSIGTLVLAPTLQFLVEKLGWRYAVRILAMSGVFIACAGFVYRP-----------HERRRETFSNDRATRS------------------LNENKKCEFFDCSVLRN---KAFILWIFTTSIAGFGYFIPHFFLVRYSED-LGIPPSTGSWLISYLGIASAVGRILFGKLSDICCIRNLHIYKACMLLSGLASALCSVATTYGGLITYVVALGILDGSYIGLMSIVTLEIVG 383          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO35238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM28])

HSP 1 Score: 70.0922 bits (170), Expect = 7.108e-13
Identity = 57/207 (27.54%), Postives = 91/207 (43.96%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIG----SAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAG-IACHFFVTAALMPLYIXXXXXXKRNNKNTCNNR 705
            D GW W V +  FI  FIV G   +FG+I     +      A     G + Y  M+ L P+   LC+K G RL   +G    + GC+L  +    A N+ +  +  G   G+     Y P  +++G  F  R+ +A GL+ AG  +G +A   I+  +I+   +R    + A  I+    V+A   P+        K   K+   N+
Sbjct:   20 DGGWGWLVCLAAFITQFIVLGTMNNFGVIYVELLQEFKVGKAEAAWVGSITYGMMFLLGPLGTTLCKKIGCRLTTVVGCIIAAGGCLLGSV----APNIYIMDLTYGLMFGVGASMCYFPSVIILGTYFNKRLSLANGLTSAGSGVGSLAMGPILQKVIEAVGMRNTMRISAAMISSIVLVSAIYRPINTPFLNAAKYETKHQEANK 222          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO26449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DV36])

HSP 1 Score: 67.0106 bits (162), Expect = 1.611e-12
Identity = 55/190 (28.95%), Postives = 87/190 (45.79%), Query Frame = 1
Query:   97 IDKGWAWGVPIGGFIANFIVGGLAKSFGII----MGSTQELLYSSIA-----PLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAAL 639
            +D GWAW V    F   FIV G  +SFGII    +   Q   Y ++      PL   G + Y  ++ + P+T  L    G R M+ IG+   +L  + + FAT++ +  +  G    I   F Y P  +++   F   +  A GLS+ G  IG I   S+I  +  +Y  R    +  G++   FV  ++
Sbjct:    1 MDAGWAWVVCAASFFIQFIVFGTIQSFGIIFVSLLNEFQASEYETVVVVPRFPLACVGSMAYGMLFFIGPVTTALTDHVGCRKMVMIGTCLIILGLVTSSFATSLSVLYVTFGVLWSIGASFAYFPAILVLRFYFFGNLSFANGLSMTGAGIGTIVLNSVINYVNQRYGWRTGMRMLGGVSAVMFVCGSI 190          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO32800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU29])

HSP 1 Score: 67.3958 bits (163), Expect = 2.265e-12
Identity = 55/190 (28.95%), Postives = 87/190 (45.79%), Query Frame = 1
Query:   97 IDKGWAWGVPIGGFIANFIVGGLAKSFGII----MGSTQELLYSSIA-----PLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAAL 639
            +D GWAW V    F   FIV G  +SFGII    +   Q   Y ++      PL   G + Y  ++ + P+T  L    G R M+ IG+   +L  + + FAT++ +  +  G    I   F Y P  +++   F   +  A GLS+ G  IG I   S+I  +  +Y  R    +  G++   FV  ++
Sbjct:    1 MDAGWAWVVCAASFFIQFIVFGTIQSFGIIFVSLLNEFQASEYETVVVVPRFPLACVGSMAYGMLFFIGPVTTALTDHVGCRKMVMIGTCLIILGLVTSSFATSLSVLYVTFGVLWSIGASFAYFPAILVLRFYFFGNLSFANGLSMTGAGIGTIVLNSVINYVNQRYGWRTGMRMLGGVSAVMFVCGSI 190          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: ENSORLT00000025268.2 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:101161384])

HSP 1 Score: 73.9442 bits (180), Expect = 1.650e-13
Identity = 77/325 (23.69%), Postives = 144/325 (44.31%), Query Frame = 1
Query:  439 YSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAF-------ALP-----PYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQ----PWCRRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMS 1362
            Y+P   +VG  F+ R  +A G++++G  IG      ++ +LI+ Y+ RGA L+ + +  +  V  ALM P+ +      ++  + TC    E  S D E+   P +E E G +      ++  PS  KR        Y    +  D   + ++F       +LP     PY   S  +S+Q  +  +++ G +D++  +  G ++DQ    P      IL+ A  +E     F     S+     F  ++G   G  + L+ VV +D+VG  +L ++  ++ F   +         G L D++++Y  +    G  +  + F +S
Sbjct:  128 YTPAIALVGCYFQQRKALAYGIAMSGSGIGTFVLAPVLQLLIELYSWRGALLIMSAVVANLCVCGALMRPITV-----QEQTEEATCG---EVSSQDTELSIKPPKETEVGLLPLTLPGEKPNPSPKKRRFSFSRTEYSFL-LQPDFLGLAVSFLFLASGCSLPFVYLVPYA-LSAGISHQHAAFLMSILGVIDIVGNITFGWLTDQRCLKPHRLSCYILSVA--MEGLCCIFAPLLRSFRLLLPFAILYGYFDGAYVALIPVVTSDVVGAKHLSLALGVVYFLHAIPYLLSPPIGGLLVDITESYTGTFLLSGTALLASAFILS 440          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: slc16a3 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:101173471])

HSP 1 Score: 72.0182 bits (175), Expect = 6.878e-13
Identity = 76/315 (24.13%), Postives = 126/315 (40.00%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSL--EMSNQDISNA--IAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V  G F+         K+  +      +      +       ++   +Y   P+  +L  +FG R ++ +G     L  I + FATN+I   +  G   G+ L   + P  +M+ R F  +  +A GLS AG  +       +  VL   Y  RG +L+  GI  +  V  ALM   ++               +++K   +KE      Q  E  K+    KL +   S +K       VIY +A     +G       +PP    S   E+ N+D  +A  + + G VD+ +R   G+++   W R
Sbjct:   17 DGGWGWAVLAGCFVITGFSYAFPKAVSVFFKELTKEFDVGYSDTAWISSILLAMLYGTGPLCSILVNRFGCRPVMMVGGLFASLGMILSSFATNIIHIYLTTGVITGLGLALNFQPSLIMLNRYFSEKRPLANGLSAAGSPVALCCLSPLGQVLQYHYGWRGGFLILGGILLNCCVCGALMKPLVD-------------PKKVKKQDHNKE------QSPEEEKMKAKAKLLDF--SVFKDCG---FVIYTVAASIMVLG-----LFVPPVFVVSYAKELGNEDTKSALLLTILGFVDMFARPTCGVIAGLKWVR 302          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: slc16a3 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:101173471])

HSP 1 Score: 71.633 bits (174), Expect = 8.281e-13
Identity = 76/315 (24.13%), Postives = 126/315 (40.00%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSL--EMSNQDISNA--IAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V  G F+         K+  +      +      +       ++   +Y   P+  +L  +FG R ++ +G     L  I + FATN+I   +  G   G+ L   + P  +M+ R F  +  +A GLS AG  +       +  VL   Y  RG +L+  GI  +  V  ALM   ++               +++K   +KE      Q  E  K+    KL +   S +K       VIY +A     +G       +PP    S   E+ N+D  +A  + + G VD+ +R   G+++   W R
Sbjct:   17 DGGWGWAVLAGCFVITGFSYAFPKAVSVFFKELTKEFDVGYSDTAWISSILLAMLYGTGPLCSILVNRFGCRPVMMVGGLFASLGMILSSFATNIIHIYLTTGVITGLGLALNFQPSLIMLNRYFSEKRPLANGLSAAGSPVALCCLSPLGQVLQYHYGWRGGFLILGGILLNCCVCGALMKPLVD-------------PKKVKKQDHNKE------QSPEEEKMKAKAKLLDF--SVFKDCG---FVIYTVAASIMVLG-----LFVPPVFVVSYAKELGNEDTKSALLLTILGFVDMFARPTCGVIAGLKWVR 302          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: si:dkey-246g23.4 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101159501])

HSP 1 Score: 67.0106 bits (162), Expect = 2.749e-11
Identity = 101/465 (21.72%), Postives = 180/465 (38.71%), Query Frame = 1
Query:   91 VKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNN--RIEKD----------------------------SSDKEIEKVPLQ--EMENGKVNHNEKLKEKKPST-------YKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNL--PISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFM 1359
            V  D G+AW + +  F    +  G+ KSFG+     Q+   ++ A  +    +    ++  +P+   L  ++ +R ++  G   C +  I   F  N++   + +G   G      ++P   M+G  F  R  +A  L+ AG  I       +  +LI+ ++ RGA L+   +  +  V   L+ PL        K     TC N  + E+D                             S++E  K  L   E+E      +  L+E+   T       Y  I     +IY +  VFA +G    +  L PY  +S  +     +  ++++  +DLI RVV G V++         L A  +L            ++Y    F    GL  G  + +   VL ++VG   L   + F +++ S G  +G      G+  D   +Y T     G+ +  +  F+
Sbjct:   18 VAPDGGYAWFILVSCFFVFGLTFGVVKSFGVFYVEIQQYFGTTAAGTSWITSIAVATIHVAAPLASALSSRYSHRSVVIAGGLICSVGAILGSFGNNLVQLYLTVGFLNGFGYALTWTPTVTMLGMYFDKRRPVANALASAGECILTFILTPMFQLLINSFSWRGALLIMGALQLNLCVCGLLLRPL--------KSTRDVTCVNEGKAEEDGLSRKMLLKDILDEVKSSIQEEKELYTEESNQETSKKCLDDTEVEPSLAEDSTSLRERDLRTRVQQYVDYTLITNPRFMIYSMFGVFAALGFFAPSLFLVPYA-RSKGIEEYQAAALMSISAVLDLIGRVVFGWVANLRLVETVQQLTATVVLLGAVLLLCPLASTFYELVAFSAAHGLVYGATVAIHITVLPEVVGVQRLGSALGFFMLIRSSGGLLGPP--IAGFFIDKMDSYGTGFLMSGVALLTSALFL 471          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: zgc:165507 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:101155977])

HSP 1 Score: 66.6254 bits (161), Expect = 3.042e-11
Identity = 71/311 (22.83%), Postives = 130/311 (41.80%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCR 1032
            D GW W V +  FI+        K+  +     Q +  +S + +     ++   MY   PI+ +L   +G R ++ +G   C +  I A F TNV+   + IG   G+ L F   P   M+GR F  +  IA GL++AG  +       +   L +++  RG++L+  G+  +  V  +LM          K++   T      K       EK  L +  N  ++     K +    Y   +V+M + +    VF        A+A      K + +     +  +++   VD+ +R  +G++++  W R
Sbjct:   15 DGGWGWAVVLASFISIGFSYAFPKAITVFFKEIQIIFDASYSQIAWISSIMLAVMYAAGPISSILVNTYGCRPIVMMGGCLCAVGMISASFCTNVLQLYMCIGVIGGLGLAFNLQPALTMIGRYFFKKRPIANGLAMAGSPVFLSTLAPLNQYLFNRFGWRGSFLILGGLLLNCCVAGSLMRPLGPPPGKAKKDEALTPIATTTK-------EKRSLWKTVNKYLDLT-LFKHRGFLIYLSGNVIMFLGFFAPIVFL------TAYA------KDMGVDEYSAAFLLSILAFVDMFARPSMGLLANSRWVR 305          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000004625.1 (SMESG000004625.1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 465/470 (98.94%), Postives = 466/470 (99.15%), Query Frame = 1
Query:  145 NFIVGGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKFVFDTTSTTTDPPYIKKSVENEENEQFVTVIDPTKDXXXXXXXXXXXXHVEVKDMFG 1554
             F   GLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVIAIGGGIGISLGFIYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIEEEE+MKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWFPSYYSYFIFYGIFGLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKFVFDTTSTTTDPPYIKKSVENEENEQFVTVIDPTKDLRSRLSSISTLSHVEVKDMFG
Sbjct:   11 QFYCWGLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVIAIGGGIGISLGFIYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIEEEEVMKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWFPSYYSYFIFYGIFGLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKFVFDTTSTTTDPPYIKKSVENEENEQFVTVIDPTKDLRSRLSSISTLSHVEVKDMFG 480          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000049052.1 (SMESG000049052.1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.027e-15
Identity = 110/430 (25.58%), Postives = 183/430 (42.56%), Query Frame = 1
Query:  100 DKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQEL--LYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAAL--MPLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQ--DISNAIAV-----AGCVDLISRVVIGMVSDQPWCR--RSLILNAAWLLEAFT-AFFFVWXXXXXXXXXXXXXXXLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGYLADVSKTYATSLKFLGINMFVA 1347
            D+ WAW    GGFI+  ++  +  S+ II    +    + S+IA      G I  F   L P  ++    F    +   G+A   L    +  A N+I+++I  G  +GI L F ++   +++   F  + G+A G++ +GVS+G I FP +  +LI  Y  R A +V +  + +  V   L   P +I        NNK     ++E  +  KE   +  +     ++   E     KP  ++ ++ ++ +          VG+      L P+    ++ SN   +I+  IAV      G     +R++ G++ D    R  R +I   +    A +     V  PS  S+       G   G  I+   V+L DL     L IS  IM F  G+    G +  G + D SK+Y  +  FLG N F A
Sbjct:    6 DQKWAWKSVAGGFISFAMILSIDLSYSIIFKDVKNFYDVNSTIASSLF--GFIIGFRLLLGPFVVIAISLFDCDKVSIFGAALIGLGLFVSSCAPNMIIFMIGYGALVGIGLSFCFTATLIVLSENFYKKKGLAFGIASSGVSVGLIVFPHVFALLIRYYEFRSALMVFSAFSLNIVVIGLLYRRPYFIT-------NNKTEV--QMEPKAPPKEYNILKPKPKNKLEIIIKESFLNSKP--WRNLNFLIFI----------VGNSWFLMGLVPWTIFIVDFSNSIGEINLNIAVLTFTIEGISQFFARILSGVIFDIRHVRRIRGIICAVSCFFSALSCVLLIVIPPSISSFLSISLFRGFSIGIFISQNVVILGDLCNPSFLSISIGIMSFMKGIGCLMGSFLSGVIRDNSKSYFETFMFLGANQFFA 412          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000077590.1 (SMESG000077590.1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.598e-11
Identity = 64/246 (26.02%), Postives = 107/246 (43.50%), Query Frame = 1
Query:   97 IDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQE-LLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXX--XXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEME-NGKVNHNEKLKEKKPSTYKR 822
            +D  W W V  G  I    V G+  ++G+     +   L S I+   L G L+       SP+   L   FGYR +  +GS    +S   + F  + I++V+  G   GI  G +Y P   +V   F  +  +A+G+++ G  IG      ++  LI+     G+ ++ + + C   V  AL   Y   +  + M+++ K  C    E     K ++K   Q +    +    EKL +KKP   KR
Sbjct:  119 VDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLLSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQKRREKLVKKKPIVIKR 364          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000077590.1 (SMESG000077590.1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.150e-11
Identity = 64/246 (26.02%), Postives = 107/246 (43.50%), Query Frame = 1
Query:   97 IDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQE-LLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIXXX--XXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEME-NGKVNHNEKLKEKKPSTYKR 822
            +D  W W V  G  I    V G+  ++G+     +   L S I+   L G L+       SP+   L   FGYR +  +GS    +S   + F  + I++V+  G   GI  G +Y P   +V   F  +  +A+G+++ G  IG      ++  LI+     G+ ++ + + C   V  AL   Y   +  + M+++ K  C    E     K ++K   Q +    +    EKL +KKP   KR
Sbjct:  119 VDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLLSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQKRREKLVKKKPIVIKR 364          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000010271.1 (SMESG000010271.1)

HSP 1 Score: 65.4698 bits (158), Expect = 7.508e-11
Identity = 68/234 (29.06%), Postives = 111/234 (47.44%), Query Frame = 1
Query:   97 IDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPLTL--AGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVXXXXXXXXXXXXXXYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALM-PLYIXXXXXXKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEK 789
            ID GW W + IG FI  F++ G+  S+G+ + +  E  + ++  L +  AG  I      + P    L  ++G+R++I IGS    LS   + F  N+  +VI  G G GI    IY P   ++   F      A G+++ G   G  AF  II  LI+ YT RG  ++ A + C+  V A L  P+      +         +N +   + +K I  + L+ +E+  + H+EK
Sbjct:   54 IDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNAL-ESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVLIIIGSIISSLSLFVSAFMYNITAFVIIYGLGGGIGYSLIYLPGCTIIALWFEKYRATATGIAICGSGCGAAAFSVIIPYLIELYTWRGCLMILAALNCNCLVAAVLFRPMKSVAPMITL---TQPLDNELSDPNLEKMISDMALKTVES-NIGHDEK 282          
The following BLAST results are available for this feature:
BLAST of Monocarboxylate transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A41.481e-1521.66solute carrier family 16 member 4 [Source:HGNC Sym... [more]
SLC16A12.189e-1224.46solute carrier family 16 member 1 [Source:HGNC Sym... [more]
SLC16A12.189e-1224.46solute carrier family 16 member 1 [Source:HGNC Sym... [more]
SLC16A12.940e-1224.46solute carrier family 16 member 1 [Source:HGNC Sym... [more]
SLC16A12.940e-1224.46solute carrier family 16 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mct-61.356e-1130.77MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.765e-828.39MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.765e-828.39MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.765e-828.39MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-42.019e-828.39MonoCarboxylate Transporter family [Source:UniPro... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrm1.383e-1429.28gene:FBgn0033028 transcript:FBtr0086072[more]
hrm1.383e-1429.28gene:FBgn0033028 transcript:FBtr0345359[more]
Sln3.711e-1426.12gene:FBgn0033657 transcript:FBtr0088032[more]
CG139072.041e-1329.83gene:FBgn0035173 transcript:FBtr0072593[more]
CG139072.041e-1329.83gene:FBgn0035173 transcript:FBtr0345005[more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a85.491e-1924.23solute carrier family 16 member 8 [Source:ZFIN;Acc... [more]
slc16a85.491e-1924.23solute carrier family 16 member 8 [Source:ZFIN;Acc... [more]
slc16a41.152e-1022.49solute carrier family 16 member 4 [Source:ZFIN;Acc... [more]
slc16a41.152e-1022.49solute carrier family 16 member 4 [Source:ZFIN;Acc... [more]
si:ch211-234h8.71.872e-1021.94si:ch211-234h8.7 [Source:ZFIN;Acc:ZDB-GENE-061009-... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a77.862e-1424.29solute carrier family 16 member 7 [Source:NCBI gen... [more]
slc16a71.271e-1324.29solute carrier family 16 member 7 [Source:NCBI gen... [more]
mad2l19.271e-1221.82mitotic arrest deficient 2 like 1 [Source:Xenbase;... [more]
slc16a123.233e-1122.29solute carrier family 16 member 12 [Source:NCBI ge... [more]
atf6b1.267e-924.80activating transcription factor 6 beta [Source:Xen... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc16a121.149e-1219.95solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a41.650e-1219.63solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a16.839e-1122.91solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a42.357e-918.84solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a77.064e-920.90solute carrier family 16 (monocarboxylic acid tran... [more]
back to top
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15374|MOT5_HUMAN7.112e-1521.66Monocarboxylate transporter 5 OS=Homo sapiens OX=9... [more]
sp|Q6GM59|MOT12_XENLA9.399e-1520.75Monocarboxylate transporter 12 OS=Xenopus laevis O... [more]
sp|Q3MHW6|MOT1_BOVIN1.896e-1223.62Monocarboxylate transporter 1 OS=Bos taurus OX=991... [more]
sp|Q8BGC3|MOT12_MOUSE8.035e-1219.95Monocarboxylate transporter 12 OS=Mus musculus OX=... [more]
sp|P53985|MOT1_HUMAN1.412e-1124.46Monocarboxylate transporter 1 OS=Homo sapiens OX=9... [more]
back to top
BLAST of Monocarboxylate transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YEU61.684e-7935.28Monocarboxylate transporter 2 OS=Clonorchis sinens... [more]
A0A419PSJ82.602e-7935.21Monocarboxylate transporter 1 OS=Clonorchis sinens... [more]
A0A4E0R8E94.092e-7834.42Monocarboxylate transporter 2 OS=Fasciola hepatica... [more]
A0A4V3S7R62.155e-7735.16Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A068WHJ82.442e-7736.93Monocarboxylate transporter OS=Echinococcus granul... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1655072.875e-1423.98solute carrier family 16 member 7 [Source:NCBI gen... [more]
zgc:1655072.875e-1423.98solute carrier family 16 member 7 [Source:NCBI gen... [more]
slc16a88.661e-1323.20solute carrier family 16 member 8 [Source:ZFIN;Acc... [more]
slc16a71.981e-1123.05monocarboxylate transporter 2-like [Source:NCBI ge... [more]
slc16a12b2.783e-1120.62solute carrier family 16 member 12 [Source:NCBI ge... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1655071.556e-1623.60solute carrier family 16 member 7 [Source:HGNC Sym... [more]
ENSPMAT00000001631.14.899e-1325.97pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 g... [more]
ENSPMAT00000009308.12.714e-1220.58pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 ... [more]
SLC16A125.558e-1227.96solute carrier family 16 member 12 [Source:HGNC Sy... [more]
ENSPMAT00000009306.11.289e-1119.44pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 ... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO300439.605e-1527.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462075.498e-1323.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352387.108e-1327.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264491.611e-1228.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO328002.265e-1228.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000025268.21.650e-1323.69solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a36.878e-1324.13solute carrier family 16 member 3 [Source:NCBI gen... [more]
slc16a38.281e-1324.13solute carrier family 16 member 3 [Source:NCBI gen... [more]
si:dkey-246g23.42.749e-1121.72monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
zgc:1655073.042e-1122.83solute carrier family 16 member 7 [Source:NCBI gen... [more]
back to top
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004625.10.000e+098.94SMESG000004625.1[more]
SMESG000049052.16.027e-1525.58SMESG000049052.1[more]
SMESG000077590.13.598e-1126.02SMESG000077590.1[more]
SMESG000077590.14.150e-1126.02SMESG000077590.1[more]
SMESG000010271.17.508e-1129.06SMESG000010271.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023945 ID=SMED30023945|Name=Monocarboxylate transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1781bp
CCTTTACAAAGGCAGTTTAATAAAATTTCAGAACGAGTGATTTTGTAGAA
TTTATTAAATCAGTTAACAAAAATATAATTTATGTCAACAGTTAAAATTG
ATAAAGGCTGGGCATGGGGAGTTCCAATAGGTGGATTTATTGCCAATTTT
ATTGTTGGGGGACTTGCAAAATCATTTGGGATTATTATGGGGTCAACACA
AGAACTTTTATATTCCAGTATAGCTCCTCTGACTTTGGCTGGTGGATTGA
TCTACACATTTATGTATTGTCTTTCTCCAATCACAATTCTCTTGTGTCAA
AAGTTTGGTTATAGACTCATGATTAACATTGGTTCAGCTGGTTGTGTTCT
CAGTTTCATTTGTGCCTATTTTGCTACGAATGTCATCATGTGGGTTATAG
CGATCGGCGGCGGAATCGGCATATCACTTGGTTTCATTTATTCACCAATT
TTTGTTATGGTTGGGCGATGTTTTCGAAATAGAGTTGGAATCGCTATGGG
TCTTTCAGTGGCTGGAGTAAGTATTGGACAAATAGCTTTTCCATCAATTA
TAACAGTTCTCATTGACAAATATACCGTTCGAGGTGCTTACTTAGTAGGT
GCTGGAATTGCTTGTCACTTTTTCGTTACAGCTGCACTGATGCCTTTATA
TATTGAAGAAGAGGAGATGATGAAAAGAAATAATAAAAACACTTGTAATA
ATAGAATAGAAAAAGATTCATCAGATAAAGAAATAGAAAAGGTTCCTTTA
CAAGAAATGGAAAACGGAAAAGTTAACCATAATGAAAAGTTAAAAGAAAA
AAAACCATCAACATACAAAAGAATTCATGTCGTAATGCTGGTTATATATA
TAATCGCTAAGGTTTTTGCCGATGTCGGAGATGTTGGAATTGCATTTGCA
TTGCCGCCTTATGGTGAAAAAAGCTTAGAAATGAGTAATCAAGATATCAG
TAATGCCATTGCAGTTGCCGGTTGCGTCGATTTGATTTCTCGTGTTGTCA
TTGGAATGGTTAGTGATCAACCATGGTGTCGTCGAAGCCTTATCCTAAAC
GCAGCTTGGTTATTGGAAGCTTTTACTGCCTTTTTCTTTGTTTGGTTTCC
AAGTTATTACAGTTATTTTATATTCTACGGCATTTTTGGATTGTGCTCCG
GTACGGCTATTACTTTAATGACAGTAGTGCTCACGGATCTAGTTGGTCAA
GTTAATTTGCCTATTTCTTTTGCTATTATGATGTTTTCTATTGGTCTATT
TATTGGAGCTGGCCAATATTTTGTCGGCTATCTTGCCGATGTGAGTAAAA
CATATGCAACTTCTTTGAAATTTCTCGGGATTAACATGTTTGTCGCTTTC
TTTTTTATGAGTTTGGAATATCCAGTAAAGAAATTTGTTTTTGACACTAC
GTCAACGACAACTGATCCTCCATATATCAAGAAGTCAGTTGAAAATGAAG
AAAATGAACAGTTTGTGACGGTGATTGATCCTACCAAAGATCTTAGATCA
AGGTTGTCATCAATCAGTACTTTATCTCATGTTGAAGTTAAAGATATGTT
TGGTTGATTAAAAAATCTGTTGCAATTTTTTTAACATCCCTTGAGATTGT
TATTTGTTCAAATTTTTCCAAAGTCCGTAAATATTTGCAAGGGCTATCAT
ATTTATATTGTATACTAATTATTGGAATCATAAGCATTGTAAATAAACTG
TTAAATTGTGTCAAATTTTCATTTCATTCTTTAAGAAAATTGAAAAGGTT
TTTTATGTAGAAATTATTTTTTCCAATTTAA
back to top

protein sequence of SMED30023945-orf-1

>SMED30023945-orf-1 ID=SMED30023945-orf-1|Name=SMED30023945-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=492bp
MSTVKIDKGWAWGVPIGGFIANFIVGGLAKSFGIIMGSTQELLYSSIAPL
TLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATN
VIMWVIAIGGGIGISLGFIYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQ
IAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIEEEEMMKRN
NKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHV
VMLVIYIIAKVFADVGDVGIAFALPPYGEKSLEMSNQDISNAIAVAGCVD
LISRVVIGMVSDQPWCRRSLILNAAWLLEAFTAFFFVWFPSYYSYFIFYG
IFGLCSGTAITLMTVVLTDLVGQVNLPISFAIMMFSIGLFIGAGQYFVGY
LADVSKTYATSLKFLGINMFVAFFFMSLEYPVKKFVFDTTSTTTDPPYIK
KSVENEENEQFVTVIDPTKDLRSRLSSISTLSHVEVKDMFG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: INTERPRO
TermDefinition
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 7..29