Heat shock protein70

Overview
NameHeat shock protein70
Smed IDSMED30023936
Length (bp)2786
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock protein70 (SMED30023936) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock protein70 (SMED30023936) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023936

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30023936SMESG000016915.1 Contig6065_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock protein70 vs. Ensembl Human
Match: HSPA6 (heat shock protein family A (Hsp70) member 6 [Source:HGNC Symbol;Acc:HGNC:5239])

HSP 1 Score: 72.7886 bits (177), Expect = 1.984e-12
Identity = 76/366 (20.77%), Postives = 147/366 (40.16%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQT-VKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKA-------CELVSGIFYF---PLKL 1175
            P N   ++  LIG K  D   Q  +K +P+ ++ E     ++    R  +++    E+ + +L      A  +++   P K           AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D+    V A++    +G       + N+F  +  +   K    N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +          ++++GG + IP++  L+  F     + K ++    +A+GA  +A       CE V  +      PL L
Sbjct:   65 PHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGK-PKVRVCYRGEDKTFYPEEISSMVLSKMKETA--EAYLGQPVKH----------AVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA--------------YGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSL 403          
BLAST of Heat shock protein70 vs. Ensembl Human
Match: HSPA1A (heat shock protein family A (Hsp70) member 1A [Source:HGNC Symbol;Acc:HGNC:5232])

HSP 1 Score: 70.4774 bits (171), Expect = 1.077e-11
Identity = 72/348 (20.69%), Postives = 144/348 (41.38%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P+N   ++  LIG K  D   Q  +K +P+ +I +      Q+ +  + + ++    E+ + +L     IA  +++  YP             AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D     V A++    +G       + N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +          ++++GG + IP++  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   63 PQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSY--KGDTKAFYPEEISSMVLTKMKEIA--EAYLGYPVT----------NAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA--------------YGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMG 382          
BLAST of Heat shock protein70 vs. Ensembl Human
Match: HSPA1B (heat shock protein family A (Hsp70) member 1B [Source:HGNC Symbol;Acc:HGNC:5233])

HSP 1 Score: 69.707 bits (169), Expect = 1.866e-11
Identity = 72/348 (20.69%), Postives = 143/348 (41.09%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P+N   ++  LIG K  D   Q  +K +P+ +I +      Q+ +  +   ++    E+ + +L     IA  +++  YP             AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D     V A++    +G       + N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +          ++++GG + IP++  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   63 PQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSY--KGETKAFYPEEISSMVLTKMKEIA--EAYLGYPVT----------NAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA--------------YGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMG 382          
BLAST of Heat shock protein70 vs. Ensembl Human
Match: HSPA1A (heat shock protein family A (Hsp70) member 1A [Source:HGNC Symbol;Acc:HGNC:5232])

HSP 1 Score: 69.707 bits (169), Expect = 1.866e-11
Identity = 72/348 (20.69%), Postives = 143/348 (41.09%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P+N   ++  LIG K  D   Q  +K +P+ +I +      Q+ +  +   ++    E+ + +L     IA  +++  YP             AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D     V A++    +G       + N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +          ++++GG + IP++  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   63 PQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSY--KGETKAFYPEEISSMVLTKMKEIA--EAYLGYPVT----------NAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA--------------YGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMG 382          
BLAST of Heat shock protein70 vs. Ensembl Human
Match: HSPA1B (heat shock protein family A (Hsp70) member 1B [Source:HGNC Symbol;Acc:HGNC:5233])

HSP 1 Score: 69.707 bits (169), Expect = 1.866e-11
Identity = 72/348 (20.69%), Postives = 143/348 (41.09%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P+N   ++  LIG K  D   Q  +K +P+ +I +      Q+ +  +   ++    E+ + +L     IA  +++  YP             AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D     V A++    +G       + N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +          ++++GG + IP++  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   63 PQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSY--KGETKAFYPEEISSMVLTKMKEIA--EAYLGYPVT----------NAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA--------------YGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMG 382          
BLAST of Heat shock protein70 vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 76.2554 bits (186), Expect = 5.445e-14
Identity = 71/348 (20.40%), Postives = 146/348 (41.95%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPA-NPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG K  D   Q  +K +P+ +I    +  ++    +  N+  +  E+ + +L     +  K++   +       +    + AVV +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              +     V +++    +G       M N+F  +  +  K   A NP +  +L  AC R  R L SS  A ++I+ LF   D   ++ R++   L     +     V+K+L +     +    I+++GG + IP++  L++       + K ++    +A+GA  +A  ++SG
Sbjct:   63 PHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVL-----LKMKETAEAF-------LGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA--------------YGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAA-ILSG 383          
BLAST of Heat shock protein70 vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 76.2554 bits (186), Expect = 5.445e-14
Identity = 71/348 (20.40%), Postives = 146/348 (41.95%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPA-NPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG K  D   Q  +K +P+ +I    +  ++    +  N+  +  E+ + +L     +  K++   +       +    + AVV +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              +     V +++    +G       M N+F  +  +  K   A NP +  +L  AC R  R L SS  A ++I+ LF   D   ++ R++   L     +     V+K+L +     +    I+++GG + IP++  L++       + K ++    +A+GA  +A  ++SG
Sbjct:   63 PHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVL-----LKMKETAEAF-------LGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA--------------YGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAA-ILSG 383          
BLAST of Heat shock protein70 vs. Ensembl Celegans
Match: T14G8.3 (pep chromosome:WBcel235:X:12861237:12870018:1 gene:WBGene00011771.1 transcript:T14G8.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T14G8.3)

HSP 1 Score: 72.4034 bits (176), Expect = 1.318e-12
Identity = 77/364 (21.15%), Postives = 157/364 (43.13%), Query Frame = 3
Query:  108 YPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYG---VLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH---PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIFYFPLKLEE 1181
            +P++ Y     +I  K  D     + K FP+   + +     + F  ++  E  +V  L+A IL NA     K+    Y ++  +++       V+ +P+F  Q ER+ +    ++A + +LQLL   +AA+L+      +R +I++      + ++G    + TI ++   +S+ +  +     +  +   +   +G  +I   +R++       TVK       N  + GKL+    RV + L ++     ++  LF  ++    + R +L  +I     RI   +   +G      N    ++++G G+ +P++  ++   LK   I   L+    IA GA Y+A  L       P  + E
Sbjct:   69 HPQSSYNFLLSMIARKEGDDAFVTFQKTFPFTAFEFDEVRKTVVFPYKE--EKYNVETLLAMILWNA-----KKVTEAYADQTVKDV-------VITVPIFLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYG--VFRRKEITEKPTHMLIYDMGAVKTTATIVQY-VLESTRKDGKDKQPTLRTVGVGFDKTLGGLEITNRLRDHLEKVFRDTVKTSKDISTNARAIGKLHKEAERVKQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPRIAAPILDAIGMAQISTNDIDLVVLMGAGTRVPKVKEILKTILKDKEISNFLNTDEAIAMGAVYQAAHLSKSFKVLPFNVHE 415          
BLAST of Heat shock protein70 vs. Ensembl Celegans
Match: T14G8.3 (pep chromosome:WBcel235:X:12861237:12870025:1 gene:WBGene00011771.1 transcript:T14G8.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T14G8.3)

HSP 1 Score: 72.0182 bits (175), Expect = 1.485e-12
Identity = 79/367 (21.53%), Postives = 158/367 (43.05%), Query Frame = 3
Query:  108 YPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISD------IYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH---PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIFYFPLKLEE 1181
            +P++ Y     +I  K  D     + K FP+   + +     + F  ++  E  +V  L+A IL NA     K+    Y ++  +++       V+ +P+F  Q ER+ +    ++A + +LQLL   +AA+L+      +R +I++      IY   ++G    + TI ++   +S+ +  +     +  +   +   +G  +I   +R++       TVK       N  + GKL+    RV + L ++     ++  LF  ++    + R +L  +I     RI   +   +G      N    ++++G G+ +P++  ++   LK   I   L+    IA GA Y+A  L       P  + E
Sbjct:   85 HPQSSYNFLLSMIARKEGDDAFVTFQKTFPFTAFEFDEVRKTVVFPYKE--EKYNVETLLAMILWNA-----KKVTEAYADQTVKDV-------VITVPIFLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYG--VFRRKEITEKPTHMLIY---DMGAVKTTATIVQY-VLESTRKDGKDKQPTLRTVGVGFDKTLGGLEITNRLRDHLEKVFRDTVKTSKDISTNARAIGKLHKEAERVKQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPRIAAPILDAIGMAQISTNDIDLVVLMGAGTRVPKVKEILKTILKDKEISNFLNTDEAIAMGAVYQAAHLSKSFKVLPFNVHE 431          
BLAST of Heat shock protein70 vs. Ensembl Celegans
Match: hsp-70 (Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:O45246])

HSP 1 Score: 67.781 bits (164), Expect = 2.393e-11
Identity = 78/365 (21.37%), Postives = 153/365 (41.92%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILE-NAISIANKQSHNMYPNKFQENIE----FNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFR------FEHQQSS----FRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGI 1154
            PEN   ++  LIG +  ++  Q  +K +P+ +               K  + V  +E+     E NA  I+      M   K +E  E     + R AV+ +P ++   +RQ   +   +A +  ++++    AA+L+    Y     I+D   +L  ++G  +  ++I        FE + ++      G  FDS                     +++++ T    +T K   +NP +  +L  AC R  R L SS  A V+++ LF   D    + R++   L     ++  + V+K L +          ++++GG + IP+I  L+  F     +   ++    +A+GA  +A  ++SG+
Sbjct:   63 PENTVFDAKRLIGRRFDEETVQSDIKHWPFTVKG-------------KQGKPVVEVEVKGEKREFNAEEIS-----AMVLQKMKETAEAVLGHSVRDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALA----YGLDKGITDEKNILIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDS--------------------RVLQHFMTEFKRKTGKDISSNPRAIRRLRTACERAKRTLSSSTEATVEVDSLFDGTDFYSKITRARFEELCADLFRKTLEPVEKALRDAKTDKGRIDEVVLVGGSTRIPKIQKLLKEFFNGKDLNCSINPDEAVAFGAAVQAA-VLSGV 384          
BLAST of Heat shock protein70 vs. Ensembl Fly
Match: CG2918 (gene:FBgn0023529 transcript:FBtr0300792)

HSP 1 Score: 80.4925 bits (197), Expect = 4.879e-15
Identity = 81/330 (24.55%), Postives = 148/330 (44.85%), Query Frame = 3
Query:  180 YLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL---NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQ---LLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            Y KRFPYY I  +   + + F  + + +  SV ELVA +L  A   A            QE+++      V+ +P ++ Q ER+ LL   +LAN+ VLQL+  N+ A++++      R +I++        ++G    S  +  +  Q    +  R  +  + VL   Y   +G  +I   +R+Y   +   L +T      +P +  KL+    R+   L ++     +I  L  + D  + + R KL  L      R  + +++ L +     ++   +I+ GGG+ +P +   I   +K+  + K L+       GA YKA +L +G
Sbjct:  103 YRKRFPYYNIVGDPERNTVVFR-KSDTDEFSVEELVAQLLVKAKQFA------------QESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLI--NDYAAVALNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSY--QLVKDKQTREINPVVQVLGVGYDRTLGGLEIQLRLRDYLAQEFNALKKTKTDVTTSPRALAKLFKEAGRLKNVLSANTEFFAQIENLIEDIDFKLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLDVINQVILFGGGTRVPRVQETIKAVIKQ-ELGKNLNADESATMGAVYKAADLSAG 414          
BLAST of Heat shock protein70 vs. Ensembl Fly
Match: CG2918 (gene:FBgn0023529 transcript:FBtr0070411)

HSP 1 Score: 80.4925 bits (197), Expect = 4.879e-15
Identity = 81/330 (24.55%), Postives = 148/330 (44.85%), Query Frame = 3
Query:  180 YLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL---NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQ---LLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            Y KRFPYY I  +   + + F  + + +  SV ELVA +L  A   A            QE+++      V+ +P ++ Q ER+ LL   +LAN+ VLQL+  N+ A++++      R +I++        ++G    S  +  +  Q    +  R  +  + VL   Y   +G  +I   +R+Y   +   L +T      +P +  KL+    R+   L ++     +I  L  + D  + + R KL  L      R  + +++ L +     ++   +I+ GGG+ +P +   I   +K+  + K L+       GA YKA +L +G
Sbjct:  103 YRKRFPYYNIVGDPERNTVVFR-KSDTDEFSVEELVAQLLVKAKQFA------------QESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLI--NDYAAVALNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSY--QLVKDKQTREINPVVQVLGVGYDRTLGGLEIQLRLRDYLAQEFNALKKTKTDVTTSPRALAKLFKEAGRLKNVLSANTEFFAQIENLIEDIDFKLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLDVINQVILFGGGTRVPRVQETIKAVIKQ-ELGKNLNADESATMGAVYKAADLSAG 414          
BLAST of Heat shock protein70 vs. Ensembl Fly
Match: Hsp68 (gene:FBgn0001230 transcript:FBtr0084589)

HSP 1 Score: 70.4774 bits (171), Expect = 4.461e-12
Identity = 78/355 (21.97%), Postives = 150/355 (42.25%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA-SKYLKRAKISDIYGVLNVGFESVSMTI-------FRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P+N   ++  LIG +  D + QE +K +P+ +I +N    ++    +  N+  S  E+ + +L        K++   Y       +    + AV+ +P ++   +RQ   +   +A I VL+++    AA+L+    K LK  +   I+ +    F+   +TI        R     +   G  FD+  +N  A             E  R Y         K   +NP +  +L  A  R  R L SS  A ++I+ L+   D    ++R++   L     +   + V+K L +     +    I+++GG + IP++  L+  F     +   ++    +A+GA  +A  ++SG
Sbjct:   60 PKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGK-PKISVEFKGANKCFSPEEISSMVLTKM-----KETAEAY-------LGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAE------------EFKRKY--------KKDLRSNPRALRRLRTAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEKALKDAKMDKSQIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAA-ILSG 380          
BLAST of Heat shock protein70 vs. Ensembl Fly
Match: Hsp70Ab (gene:FBgn0013276 transcript:FBtr0082482)

HSP 1 Score: 68.9366 bits (167), Expect = 1.499e-11
Identity = 71/348 (20.40%), Postives = 155/348 (44.54%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA-SKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG K  D +  E +K +P+ ++ +     ++    +  ++  +  E+ + +L        K++   Y     E+I      AV+ +P ++   +RQ   +   +A + VL+++    AA+L+    K LK  +   I+ +    F+   +TI      + S    R  + + ++    +      N+++  + + F  +  + ++   +NP +  +L  A  R  R L SS  A ++I+ LF  +D    ++R++   L     +   Q V+K L +          I+++GG + IP++ +L+  F     +   ++    +A+GA  +A  ++SG
Sbjct:   60 PRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGK-PKIGVEYKGESKRFAPEEISSMVLTKM-----KETAEAY---LGESI----TDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTI-----DEGSLFEVRSTAGDTHLGGEDFD-----NRLVTHLADEFKRKYKKDLR---SNPRALRRLRTAAERAKRTLSSSTEATIEIDALFEGQDFYTKVSRARFEELCADLFRNTLQPVEKALNDAKMDKGQIHDIVLVGGSTRIPKVQSLLQDFFHGKNLNLSINPDEAVAYGAAVQAA-ILSG 380          
BLAST of Heat shock protein70 vs. Ensembl Fly
Match: Hsp70Aa (gene:FBgn0013275 transcript:FBtr0082512)

HSP 1 Score: 68.9366 bits (167), Expect = 1.499e-11
Identity = 71/348 (20.40%), Postives = 155/348 (44.54%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA-SKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG K  D +  E +K +P+ ++ +     ++    +  ++  +  E+ + +L        K++   Y     E+I      AV+ +P ++   +RQ   +   +A + VL+++    AA+L+    K LK  +   I+ +    F+   +TI      + S    R  + + ++    +      N+++  + + F  +  + ++   +NP +  +L  A  R  R L SS  A ++I+ LF  +D    ++R++   L     +   Q V+K L +          I+++GG + IP++ +L+  F     +   ++    +A+GA  +A  ++SG
Sbjct:   60 PRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGK-PKIGVEYKGESKRFAPEEISSMVLTKM-----KETAEAY---LGESI----TDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTI-----DEGSLFEVRSTAGDTHLGGEDFD-----NRLVTHLADEFKRKYKKDLR---SNPRALRRLRTAAERAKRTLSSSTEATIEIDALFEGQDFYTKVSRARFEELCADLFRNTLQPVEKALNDAKMDKGQIHDIVLVGGSTRIPKVQSLLQDFFHGKNLNLSINPDEAVAYGAAVQAA-ILSG 380          
BLAST of Heat shock protein70 vs. Ensembl Zebrafish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 68.9366 bits (167), Expect = 1.774e-11
Identity = 73/348 (20.98%), Postives = 149/348 (42.82%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG K  D+  Q  +K +P+ +I E+     Q+ +  +  N++    E+ + +L     IA     +   N            AV+ +P ++   +RQ   +   +A + VL+++    AA+++      ++ + + +  + ++G  +  ++I   E           D +   V A++    +G       M  +F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L  +  +     V+K L +     +  + I+++GG + IP+I  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   63 PNNTIFDAKRLIGRKFDDQVVQSDMKLWPFKVISEDGKPKVQVEY--KGENKTFYPEEISSMVLVKMREIAEAYLGHRVNN------------AVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGRKGERNVL--IFDLGGGTFDVSILTIE-----------DGI-FEVKATAGDTHLGGEDFDNRMVKHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSITRARFEELNAELFRGTLDPVEKALRDAKMDKSQIQDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMG 382          
BLAST of Heat shock protein70 vs. Ensembl Zebrafish
Match: hsc70 (heat shock cognate 70 [Source:ZFIN;Acc:ZDB-GENE-040426-1221])

HSP 1 Score: 68.9366 bits (167), Expect = 1.952e-11
Identity = 77/356 (21.63%), Postives = 146/356 (41.01%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIA---NKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKL----FVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG +  D   Q  +K +P+ +I + S         +   E     E+  F  E   S+     K+    Y  K   N       AV+ +P ++   +RQ   +   +A + VL+++    AA+++    Y    K+     VL  ++G  +  ++I   E           D +   V +++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++       L   T++ +E+ ++    +  Q  +I    +++GG + IP+I  L+  F     + K ++    +A+GA  +A  L  
Sbjct:   63 PSNTVFDAKRLIGRRFDDPVVQSDMKHWPFKVISDGS---------KPKMEVEYKGEIKTFFPEEVSSMVLTKMKEISEAYLGKTVSN-------AVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA----YGLDKKVGGERNVLIFDLGGGTFDVSILTIE-----------DGI-FEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADFYTSITRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDI----VLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILTG 382          
BLAST of Heat shock protein70 vs. Ensembl Zebrafish
Match: hsc70 (heat shock cognate 70 [Source:ZFIN;Acc:ZDB-GENE-040426-1221])

HSP 1 Score: 68.9366 bits (167), Expect = 1.952e-11
Identity = 77/356 (21.63%), Postives = 146/356 (41.01%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIA---NKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKL----FVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG +  D   Q  +K +P+ +I + S         +   E     E+  F  E   S+     K+    Y  K   N       AV+ +P ++   +RQ   +   +A + VL+++    AA+++    Y    K+     VL  ++G  +  ++I   E           D +   V +++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++       L   T++ +E+ ++    +  Q  +I    +++GG + IP+I  L+  F     + K ++    +A+GA  +A  L  
Sbjct:   63 PSNTVFDAKRLIGRRFDDPVVQSDMKHWPFKVISDGS---------KPKMEVEYKGEIKTFFPEEVSSMVLTKMKEISEAYLGKTVSN-------AVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA----YGLDKKVGGERNVLIFDLGGGTFDVSILTIE-----------DGI-FEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADFYTSITRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDI----VLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILTG 382          
BLAST of Heat shock protein70 vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 67.3958 bits (163), Expect = 5.192e-11
Identity = 77/355 (21.69%), Postives = 153/355 (43.10%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKL----FVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG +  D   Q  +K +P+ +I +NS    Q+ +  +  ++S    E+ + +L     IA       Y  K   N       AV+ +P ++   +RQ   +   ++ + VL+++    AA+++    Y    K+     VL  ++G  +  ++I   E           D +   V +++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++       L   T+  +E+ ++    +  Q  +    I+++GG + IP+I  L+  +     + K ++    +A+GA  +A  ++SG
Sbjct:   68 PTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEY--KGESKSFYPEEISSMVLTKMKEIA-----EAYLGKTVSN-------AVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA----YGLDKKVGAERNVLIFDLGGGTFDVSILTIE-----------DGI-FEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHD----IVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAA-ILSG 387          
BLAST of Heat shock protein70 vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 67.3958 bits (163), Expect = 6.183e-11
Identity = 77/355 (21.69%), Postives = 153/355 (43.10%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKL----FVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG +  D   Q  +K +P+ +I +NS    Q+ +  +  ++S    E+ + +L     IA       Y  K   N       AV+ +P ++   +RQ   +   ++ + VL+++    AA+++    Y    K+     VL  ++G  +  ++I   E           D +   V +++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++       L   T+  +E+ ++    +  Q  +    I+++GG + IP+I  L+  +     + K ++    +A+GA  +A  ++SG
Sbjct:   63 PTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEY--KGESKSFYPEEISSMVLTKMKEIA-----EAYLGKTVSN-------AVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA----YGLDKKVGAERNVLIFDLGGGTFDVSILTIE-----------DGI-FEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHD----IVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAA-ILSG 382          
BLAST of Heat shock protein70 vs. Ensembl Xenopus
Match: tmed10 (transmembrane emp24-like trafficking protein 10 (yeast) [Source:Xenbase;Acc:XB-GENE-968508])

HSP 1 Score: 69.707 bits (169), Expect = 1.452e-11
Identity = 71/347 (20.46%), Postives = 141/347 (40.63%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG K  +   Q  +K +P+ +I +     ++    +   +S S  E+ + +L        K++   Y       + +    AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D     V A++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L     +   + V+K + +     +    I+++GG + IP++  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   64 PHNTVFDAKRLIGRKYDEPVVQSDMKHWPFKVISDGGK-PKVTVEYKGEGKSFSPEEISSMVLTKM-----KETAEAY-------LGYKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA--------------YGLDKSGRGERNILIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNCMVNHFVEEFKRKHKKDISPNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELCADLFRGTLEPVEKAMRDAKLDKSQIHEIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILMG 383          
BLAST of Heat shock protein70 vs. Ensembl Xenopus
Match: pawr (PRKC, apoptosis, WT1, regulator [Source:Xenbase;Acc:XB-GENE-987162])

HSP 1 Score: 69.3218 bits (168), Expect = 2.572e-11
Identity = 104/492 (21.14%), Postives = 210/492 (42.68%), Query Frame = 3
Query:  141 LIGLKLKDKRSQEYLKRFP-YYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFE---------HQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACEL----------VSGIFYFPLKLEENYFKSIQLILTSGNYKENRXXXXXXXXXXXSSHLI--RNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIF 1550
            L+G +  +   + +  RFP Y ++K+    + L+ L  +   + S  EL+  +L  + S+A            +E  E   +  V+ +P F+ Q ER+ +L+  +L+++ VLQL+  N A +L+      +R  I++I     +G  S   TI  ++           Q   RG  FD            MD+   ++ + +   F  Q  ++ K    N  +  KL     RV   L +++    +I  L  + D    + R +L  L      R+   VQ  L +          +I++GG + +P++  L+   + +  + K ++     A GA Y+A  L          V     FP+++E  + + ++    S + K N++I+  +        +I     T NF   I +  ++  G  ++   K+  +++++  K  +  +  + QK  +       +  KG++   ++D + ++TLD +EA+F
Sbjct:   80 LLGKRADNPHVKAFEARFPEYQLVKDEHRETVLFKLSEEL--TYSPEELLGMMLNYSRSLA------------EEFAEQPVKDVVITVPAFFNQAERRAVLQAAQLSDLKVLQLINDNTAVALNYG--VFRRKDINNIM-FYEMGSRSTICTIVTYQSVKTKDSGMQPQLQIRGVGFDRT-----LGGIEMDL---RLRDHLAKLFNEQ-KKSKKDVRENQRAMSKLLKEANRVKTILSANNDHMAQIEGLMDDIDFKAKVTRQELEDLCADLFNRVSAPVQHALSSAEMKMEEIDQVILVGGATRVPKVQELLLKVVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFIVRDAAIFPIQVE--FTREVEEEDHSKSLKHNKRILFQRLAPYPQRKVITFNRYTDNFAFSINYGDLSYLGPDDL---KVFGSLNLTTVK--LNGVGESFQKRSD-------YESKGIKAHFNMDESGLLTLDRVEAVF 531          
BLAST of Heat shock protein70 vs. Ensembl Xenopus
Match: ENSXETT00000025573.1 (heat shock protein family A (Hsp70) member 1B [Source:NCBI gene;Acc:100485441])

HSP 1 Score: 68.5514 bits (166), Expect = 3.627e-11
Identity = 71/347 (20.46%), Postives = 141/347 (40.63%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG K  +   Q  +K +P+ +I +     ++    +   +S S  E+ + +L        K++   Y       + +    AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D     V A++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L     +   + V+K + +     +    I+++GG + IP++  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   64 PHNTVFDAKRLIGRKYDEPVVQSDMKHWPFKVISDGGK-PKVTVEYKGEGKSFSPEEISSMVLTKM-----KETAEAY-------LGYKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA--------------YGLDKSGRGERNILIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISPNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELCADLFRGTLEPVEKAMRDAKLDKSQIHEIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILMG 383          
BLAST of Heat shock protein70 vs. Ensembl Xenopus
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:NCBI gene;Acc:100496396])

HSP 1 Score: 65.855 bits (159), Expect = 2.507e-10
Identity = 69/351 (19.66%), Postives = 142/351 (40.46%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSF--RGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG +  D   Q  +K +P+ ++ +      ++ F  +  N++    E+ + +L     +A        PN            AV+ +P ++   +RQ   +   ++ I VL+++    AA+++              YG+   G       +  F+    +F       D     V +++    +G       M  +F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   ++ R++   L     +   + V+K L +        + I+++GG + IP++  L+  F     + K ++    +A+GA  +A  ++SG
Sbjct:   63 PANTIFDAKRLIGRRFDDPTVQADMKHWPFTVVSDGGKPKVKVEF--KGENKTFFPEEISSMVLSKMKEVAEAYLGVKVPN------------AVITVPAYFNDSQRQATKDAGVISGINVLRIINEPTAAAIA--------------YGLDKKGAGHGETNVLIFDLGGGTFDVSVLTIDGGIFEVKSTAGDTHLGGEDFDNRMVAHFVEEFKRKNKKDISGNKRAVRRLRTACERAKRTLSSSTQASLEIDSLYEGADFYTAITRARFEELCADLFRGTLEPVEKALRDAKLDKAQIREIVLVGGSTRIPKVQKLLQDFFNGRELNKSINPDEAVAYGAAVQAA-ILSG 384          
BLAST of Heat shock protein70 vs. Ensembl Xenopus
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:NCBI gene;Acc:100496396])

HSP 1 Score: 65.855 bits (159), Expect = 2.594e-10
Identity = 69/351 (19.66%), Postives = 142/351 (40.46%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSF--RGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG +  D   Q  +K +P+ ++ +      ++ F  +  N++    E+ + +L     +A        PN            AV+ +P ++   +RQ   +   ++ I VL+++    AA+++              YG+   G       +  F+    +F       D     V +++    +G       M  +F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   ++ R++   L     +   + V+K L +        + I+++GG + IP++  L+  F     + K ++    +A+GA  +A  ++SG
Sbjct:   63 PANTIFDAKRLIGRRFDDPTVQADMKHWPFTVVSDGGKPKVKVEF--KGENKTFFPEEISSMVLSKMKEVAEAYLGVKVPN------------AVITVPAYFNDSQRQATKDAGVISGINVLRIINEPTAAAIA--------------YGLDKKGAGHGETNVLIFDLGGGTFDVSVLTIDGGIFEVKSTAGDTHLGGEDFDNRMVAHFVEEFKRKNKKDISGNKRAVRRLRTACERAKRTLSSSTQASLEIDSLYEGADFYTAITRARFEELCADLFRGTLEPVEKALRDAKLDKAQIREIVLVGGSTRIPKVQKLLQDFFNGRELNKSINPDEAVAYGAAVQAA-ILSG 384          
BLAST of Heat shock protein70 vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 66.6254 bits (161), Expect = 1.033e-10
Identity = 77/360 (21.39%), Postives = 147/360 (40.83%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA------SKYLKRAKISDIYG-VLNVGFESVSMTIFRFEH--QQSSFRGYRFDSMNINVLASSYSM----DIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG K +D   Q  +K +P+ ++ E      Q+ +  +   ++    E+ + +L     IA          K Q        +AV+ +P ++   +RQ   +   +  + VL+++    AA+++        +   K   I D+ G   +V   ++   IF  +     +   G  FD+  ++ LA  +      DIG NK              + V+          +L  AC R  R L SS  A ++I+ L+   D   S+ R++   L     +   + V+K L +        + I+++GG + IP+I  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   64 PTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEY--KGEMKTFFPEEISSMVLTKMKEIA----EAYLGGKVQ--------SAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNK--------------RAVR----------RLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIG 385          
BLAST of Heat shock protein70 vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 66.6254 bits (161), Expect = 1.033e-10
Identity = 77/360 (21.39%), Postives = 147/360 (40.83%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA------SKYLKRAKISDIYG-VLNVGFESVSMTIFRFEH--QQSSFRGYRFDSMNINVLASSYSM----DIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG K +D   Q  +K +P+ ++ E      Q+ +  +   ++    E+ + +L     IA          K Q        +AV+ +P ++   +RQ   +   +  + VL+++    AA+++        +   K   I D+ G   +V   ++   IF  +     +   G  FD+  ++ LA  +      DIG NK              + V+          +L  AC R  R L SS  A ++I+ L+   D   S+ R++   L     +   + V+K L +        + I+++GG + IP+I  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   64 PTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEY--KGEMKTFFPEEISSMVLTKMKEIA----EAYLGGKVQ--------SAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNK--------------RAVR----------RLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIG 385          
BLAST of Heat shock protein70 vs. Ensembl Mouse
Match: Hspa1a (heat shock protein 1A [Source:MGI Symbol;Acc:MGI:96244])

HSP 1 Score: 66.2402 bits (160), Expect = 1.445e-10
Identity = 70/348 (20.11%), Postives = 140/348 (40.23%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P+N   ++  LIG K  D   Q  +K +P+ ++ +      Q+ +  +  + S    E+ + +L     IA     +   N            AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D     V A++    +G       + ++F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +          ++++GG + IP++  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   63 PQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNY--KGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTN------------AVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA--------------YGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMG 382          
BLAST of Heat shock protein70 vs. Ensembl Mouse
Match: Hspa1b (heat shock protein 1B [Source:MGI Symbol;Acc:MGI:99517])

HSP 1 Score: 66.2402 bits (160), Expect = 1.603e-10
Identity = 70/348 (20.11%), Postives = 140/348 (40.23%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P+N   ++  LIG K  D   Q  +K +P+ ++ +      Q+ +  +  + S    E+ + +L     IA     +   N            AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D     V A++    +G       + ++F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +          ++++GG + IP++  L+  F     + K ++    +A+GA  +A  L+ 
Sbjct:   63 PQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNY--KGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTN------------AVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA--------------YGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMG 382          
BLAST of Heat shock protein70 vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 65.855 bits (159), Expect = 1.681e-10
Identity = 76/354 (21.47%), Postives = 150/354 (42.37%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKL----FVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG +  D   Q  +K +P+ ++  ++   ++    +   +S    E+ + +L     IA       Y  K   N       AVV +P ++   +RQ   +   +A + VL+++    AA+++    Y    K+     VL  ++G  +  ++I   E           D +   V +++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++       L   T+  +E+ ++    +  Q  +    I+++GG + IP+I  L+  F     + K ++    +A+GA  +A  ++SG
Sbjct:   63 PTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVN-DAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAE-----AYLGKTVTN-------AVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA----YGLDKKVGAERNVLIFDLGGGTFDVSILTIE-----------DGI-FEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHD----IVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAA-ILSG 382          
BLAST of Heat shock protein70 vs. UniProt/SwissProt
Match: sp|P09446|HSP7A_CAEEL (Heat shock 70 kDa protein A OS=Caenorhabditis elegans OX=6239 GN=hsp-1 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 6.926e-13
Identity = 71/348 (20.40%), Postives = 146/348 (41.95%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPA-NPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG K  D   Q  +K +P+ +I    +  ++    +  N+  +  E+ + +L     +  K++   +       +    + AVV +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              +     V +++    +G       M N+F  +  +  K   A NP +  +L  AC R  R L SS  A ++I+ LF   D   ++ R++   L     +     V+K+L +     +    I+++GG + IP++  L++       + K ++    +A+GA  +A  ++SG
Sbjct:   63 PHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVL-----LKMKETAEAF-------LGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA--------------YGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAA-ILSG 383          
BLAST of Heat shock protein70 vs. UniProt/SwissProt
Match: sp|P05456|HSP70_TRYCR (Heat shock 70 kDa protein OS=Trypanosoma cruzi OX=5693 GN=HSP70 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.125e-12
Identity = 72/352 (20.45%), Postives = 147/352 (41.76%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTG-----KLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG K  D   Q  +K +P+ +I +      +    R   ++ +  E+ + +L     IA       Y  K         + AVV +P ++   +RQ   +   +A + VL+++    AA+++     ++  K  ++  + ++G  +  +T+               D     V A++    +G       +  +FT +  +  K      +ST      +L  AC R  R L S+  A ++I+ LF N D   ++ R++   L  +  +   Q V++ L +          ++++GG + IP++  L++ F +   + K +     +A+GA  +A  L  G
Sbjct:   63 PRNTVFDAKRLIGRKFSDPVVQSDMKHWPFKVITKGDDKPVIQVQFRGETKTFNPEEVSSMVLSKMKEIAES-----YLGK-------QVKKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINEPTAAAIAYGLDKVEDGKERNVL-IFDLGGGTFDVTLLTI------------DGGIFEVKATNGDTHLGGEDFDNRLVAHFTDEFKRKNK---GKDLSTNLRALRRLRTACERAKRTLSSAAQATIEIDALFDNVDFQATITRARFEELCGELFRGTLQPVERVLQDAKMDKRAVHDVVLVGGSTRIPKVMQLVSDFFRGKELKKSIQPDEAVAYGAAVQAFILTGG 386          
BLAST of Heat shock protein70 vs. UniProt/SwissProt
Match: sp|P17066|HSP76_HUMAN (Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 9.526e-12
Identity = 76/366 (20.77%), Postives = 147/366 (40.16%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQT-VKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKA-------CELVSGIFYF---PLKL 1175
            P N   ++  LIG K  D   Q  +K +P+ ++ E     ++    R  +++    E+ + +L      A  +++   P K           AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D+    V A++    +G       + N+F  +  +   K    N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +          ++++GG + IP++  L+  F     + K ++    +A+GA  +A       CE V  +      PL L
Sbjct:   65 PHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGK-PKVRVCYRGEDKTFYPEEISSMVLSKMKETA--EAYLGQPVKH----------AVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA--------------YGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSL 403          
BLAST of Heat shock protein70 vs. UniProt/SwissProt
Match: sp|Q04967|HSP76_PIG (Heat shock 70 kDa protein 6 OS=Sus scrofa OX=9823 GN=HSPA6 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.029e-11
Identity = 79/366 (21.58%), Postives = 148/366 (40.44%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQT-VKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKA-------CELVSGIFYF---PLKL 1175
            P+N   ++  LIG K  D   Q  LK +P+ ++ E     ++    R  +++    E+ + +L        K++   Y  +         R AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF              D+    V A++    +G       + N+F  +  +   K    N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +          I+++GG + IP+I  L+  F     + K ++    +A+GA  +A       CE V  +      PL L
Sbjct:   65 PQNTVFDAKRLIGRKFADPTVQSDLKHWPFQVVSEGGK-PKVRVSYRGEDKAFYPEEISSMVLSKM-----KETAEAYLGQPV-------RHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA--------------YGLDRRGAGERNVLIFDLGGGTFDVSVLTIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHRKDLSRNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSL 403          
BLAST of Heat shock protein70 vs. UniProt/SwissProt
Match: sp|P27541|HSP70_BRUMA (Heat shock 70 kDa protein OS=Brugia malayi OX=6279 GN=HSP70 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.289e-11
Identity = 73/357 (20.45%), Postives = 150/357 (42.02%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLA--------SSYSMDIGVNKIIE-IMRNYFTVQLLQTVKFHPA-NPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG K  D   Q  +K +P+ ++       ++    +   ++ +  E+ + +L     +  K++   +       +    + AV+ +P ++   +RQ   +   +A + VL+++    AA+++              YG+   G    ++ IF          G  FD   +++L          S + D  + +  +  M N+F  +  +  K   A NP +  +L  AC R  R L SS  A ++I+ LF   D   ++ R++   L     +     V+K L +          I+++GG + IP++  L++ F     + K ++    +A+GA  +A  ++SG
Sbjct:   62 PHNTVFDANRLIGRKFDDGSVQSDMKHWPFKVVNAGGGKPKVQVEYKGETKTFTPEEISSMVL-----VKMKETAEAF-------LGHAVKDAVITVPAYFNDSQRQATKDSGAIAGLNVLRIINEPTAAAIA--------------YGLDKKGHGERNVLIF-------DLGGGTFD---VSILTIEDGIFEVKSTAGDTHLGEDFDNRMVNHFVAEFKRNDKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKALRDAKMDKAQVHDIVLVGGSTRIPKVQKLLSDFFSGKELNKSINPDEAVAYGAAVQAA-ILSG 381          
BLAST of Heat shock protein70 vs. TrEMBL
Match: A0A267G9A3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028204g1 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.050e-21
Identity = 122/506 (24.11%), Postives = 222/506 (43.87%), Query Frame = 3
Query:  108 YPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFND---RTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA---SKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNY----FTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQF-WNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG----------IFYFPL----KLEENYFKSIQLILTSGNYKENRXXXXXXXXXXXSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIF 1550
            +P+N ++  P LIG  L     + + +RFPYY + E++    +      NN+ ++V E++A +LENA   A K               F D   + AV+ +P +++Q ER  +L     A ITVLQL+ SN A +L+     SK     K +  Y   ++G  S   T+  ++  +    G   +   + VL   Y   +G +  I  +R++    F  + L + K    N  +  KL+    RV R L ++     +I  +F +KD  + + R +L  + +   +R+ + ++  L NM Q   ++ K ++++GGG+  P++ + +     R  + K ++     A GA Y+A  L  G             FPL    K  E+  +  +L+   GN+   RK++                T +F   + +  +    L+E +   +    D   YK +++ +     +++   +       KGV+    +D+N IV LD  EA F
Sbjct:   82 FPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEG--VLTFTTVNNKKLTVEEILAMLLENAQETAQK---------------FADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFN--KTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKL-SKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESAL-NMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVDFKTAEDGKEIKRLLFNLGNHYPQRKVMT-----------FNKHTQDFDFSVGYTSL--NHLNEFQQKAL---GDPLLYKFSLKGVA----QAIGKYDGQPGASSKGVKAHFRMDDNGIVHLDRAEAQF 546          
BLAST of Heat shock protein70 vs. TrEMBL
Match: A0A267FLJ4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034201g1 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.413e-21
Identity = 122/506 (24.11%), Postives = 222/506 (43.87%), Query Frame = 3
Query:  108 YPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFND---RTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA---SKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNY----FTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQF-WNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG----------IFYFPL----KLEENYFKSIQLILTSGNYKENRXXXXXXXXXXXSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIF 1550
            +P+N ++  P LIG  L     + + +RFPYY + E++    +      NN+ ++V E++A +LENA   A K               F D   + AV+ +P +++Q ER  +L     A ITVLQL+ SN A +L+     SK     K +  Y   ++G  S   T+  ++  +    G   +   + VL   Y   +G +  I  +R++    F  + L + K    N  +  KL+    RV R L ++     +I  +F +KD  + + R +L  + +   +R+ + ++  L NM Q   ++ K ++++GGG+  P++ + +     R  + K ++     A GA Y+A  L  G             FPL    K  E+  +  +L+   GN+   RK++                T +F   + +  +    L+E +   +    D   YK +++ +     +++   +       KGV+    +D+N IV LD  EA F
Sbjct:   82 FPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEG--VLTFTTVNNKKLTVEEILAMLLENAQETAQK---------------FADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFN--KTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKL-SKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESAL-NMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVDFKTAEDGKEIKRLLFNLGNHYPQRKVMT-----------FNKHTQDFDFSVGYTSL--NHLNEFQQKAL---GDPLLYKFSLKGVA----QAIGKYDGQPGASSKGVKAHFRMDDNGIVHLDRAEAQF 546          
BLAST of Heat shock protein70 vs. TrEMBL
Match: A0A267DVT4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013664g1 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.965e-21
Identity = 122/506 (24.11%), Postives = 222/506 (43.87%), Query Frame = 3
Query:  108 YPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFND---RTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA---SKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNY----FTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQF-WNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG----------IFYFPL----KLEENYFKSIQLILTSGNYKENRXXXXXXXXXXXSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIF 1550
            +P+N ++  P LIG  L     + + +RFPYY + E++    +      NN+ ++V E++A +LENA   A K               F D   + AV+ +P +++Q ER  +L     A ITVLQL+ SN A +L+     SK     K +  Y   ++G  S   T+  ++  +    G   +   + VL   Y   +G +  I  +R++    F  + L + K    N  +  KL+    RV R L ++     +I  +F +KD  + + R +L  + +   +R+ + ++  L NM Q   ++ K ++++GGG+  P++ + +     R  + K ++     A GA Y+A  L  G             FPL    K  E+  +  +L+   GN+   RK++                T +F   + +  +    L+E +   +    D   YK +++ +     +++   +       KGV+    +D+N IV LD  EA F
Sbjct:   82 FPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEG--VLTFTTVNNKKLTVEEILAMLLENAQETAQK---------------FADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFN--KTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKL-SKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESAL-NMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVDFKTAEDGKEIKRLLFNLGNHYPQRKVMT-----------FNKHTQDFDFSVGYTSL--NHLNEFQQKAL---GDPLLYKFSLKGVA----QAIGKYDGQPGASSKGVKAHFRMDDNGIVHLDRAEAQF 546          
BLAST of Heat shock protein70 vs. TrEMBL
Match: A0A1I8ILP9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.416e-21
Identity = 122/506 (24.11%), Postives = 222/506 (43.87%), Query Frame = 3
Query:  108 YPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFND---RTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA---SKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNY----FTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQF-WNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG----------IFYFPL----KLEENYFKSIQLILTSGNYKENRXXXXXXXXXXXSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIF 1550
            +P+N ++  P LIG  L     + + +RFPYY + E++    +      NN+ ++V E++A +LENA   A K               F D   + AV+ +P +++Q ER  +L     A ITVLQL+ SN A +L+     SK     K +  Y   ++G  S   T+  ++  +    G   +   + VL   Y   +G +  I  +R++    F  + L + K    N  +  KL+    RV R L ++     +I  +F +KD  + + R +L  + +   +R+ + ++  L NM Q   ++ K ++++GGG+  P++ + +     R  + K ++     A GA Y+A  L  G             FPL    K  E+  +  +L+   GN+   RK++                T +F   + +  +    L+E +   +    D   YK +++ +     +++   +       KGV+    +D+N IV LD  EA F
Sbjct:  557 FPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEG--VLTFTTVNNKKLTVEEILAMLLENAQETAQK---------------FADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFN--KTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKL-SKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESAL-NMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVDFKTAEDGKEIKRLLFNLGNHYPQRKVMT-----------FNKHTQDFDFSVGYTSL--NHLNEFQQKAL---GDPLLYKFSLKGVA----QAIGKYDGQPGASSKGVKAHFRMDDNGIVHLDRAEAQF 1021          
BLAST of Heat shock protein70 vs. TrEMBL
Match: A0A1I8ISK3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 5.219e-21
Identity = 122/506 (24.11%), Postives = 222/506 (43.87%), Query Frame = 3
Query:  108 YPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFND---RTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA---SKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNY----FTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQF-WNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG----------IFYFPL----KLEENYFKSIQLILTSGNYKENRXXXXXXXXXXXSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIF 1550
            +P+N ++  P LIG  L     + + +RFPYY + E++    +      NN+ ++V E++A +LENA   A K               F D   + AV+ +P +++Q ER  +L     A ITVLQL+ SN A +L+     SK     K +  Y   ++G  S   T+  ++  +    G   +   + VL   Y   +G +  I  +R++    F  + L + K    N  +  KL+    RV R L ++     +I  +F +KD  + + R +L  + +   +R+ + ++  L NM Q   ++ K ++++GGG+  P++ + +     R  + K ++     A GA Y+A  L  G             FPL    K  E+  +  +L+   GN+   RK++                T +F   + +  +    L+E +   +    D   YK +++ +     +++   +       KGV+    +D+N IV LD  EA F
Sbjct:  451 FPQNAFIFIPTLIGQSLNSPAVKLFQERFPYYKLSEDNEG--VLTFTTVNNKKLTVEEILAMLLENAQETAQK---------------FADQPIKDAVITVPPYFSQAERLAVLRAADYAGITVLQLMNSNAAVALNFGIFRSKSFN--KTAQYYMFYDMGSSSTIATVVSYQVARIREHGMAEEHPQLQVLGVGYDETLGASAFILRLRDHLAKEFNAKKL-SKKDITGNARAMAKLFKEAGRVYRVLSANKEVYAQIESVFEDKDFKVKVTREELENICSDLFERVTRPIESAL-NMAQISMDLIKEVLLMGGGTRNPKVQSALLKATGRTELGKSINTDEAAALGAVYQAAHLSPGFRVKRFVVKDAVLFPLAVDFKTAEDGKEIKRLLFNLGNHYPQRKVMT-----------FNKHTQDFDFSVGYTSL--NHLNEFQQKAL---GDPLLYKFSLKGVA----QAIGKYDGQPGASSKGVKAHFRMDDNGIVHLDRAEAQF 915          
BLAST of Heat shock protein70 vs. Ensembl Cavefish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 70.8626 bits (172), Expect = 4.449e-12
Identity = 84/381 (22.05%), Postives = 167/381 (43.83%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESV--SVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKI-SDIYGVL--NVGFESVSMTIFRFE---------HQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQV-KINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACE----------LVSGIFYFPLKLE 1178
            P+ VY     L+G   ++ +  +Y K FP + I ++     +YF   K +E +  S +E++  +L  +  +A            Q+  E   + AV+ +P F+ Q ER+ +L+  ++A + VLQL+  N A +L+      +R  I S    V+  ++G  S + T+  ++           Q   RG  FD          + M++   ++ + +   F  Q   T      N  +  KL    +R L+ ++S+++  V +I  L  + D    + R++   L     +R+   VQ+ L +     +  + +I++GG + +P++  ++   + R  + K ++     A GA Y+A            LV     FP+++E
Sbjct:   95 PKVVYRYIQNLLGKTAENPQVAQYQKHFPEHQIVKDEKRGTVYF---KYSEEMQYSPVEILGMVLNYSSGLA------------QDFAEQPIKDAVITVPAFFNQAERRAVLQAAQMAGLKVLQLINDNTAVALNYG--VFRRKDINSTAQNVMFYDMGSGSTTATVVTYQTVKTKESGTQPQLQIRGVGFDRT-----LGGFEMEL---RLRDHLAKLFNEQKKSTKDVR-ENLRAMAKLLKEAQR-LKTVLSANAEHVAQIEGLMDDIDFKAKVTRAEFEALCPDLFERVPGPVQQALASSEMSMDEIEQVILVGGATRVPKVQEVLLKAVGREELAKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPVQVE 448          
BLAST of Heat shock protein70 vs. Ensembl Cavefish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 70.8626 bits (172), Expect = 5.828e-12
Identity = 84/381 (22.05%), Postives = 167/381 (43.83%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESV--SVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKI-SDIYGVL--NVGFESVSMTIFRFE---------HQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQV-KINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACE----------LVSGIFYFPLKLE 1178
            P+ VY     L+G   ++ +  +Y K FP + I ++     +YF   K +E +  S +E++  +L  +  +A            Q+  E   + AV+ +P F+ Q ER+ +L+  ++A + VLQL+  N A +L+      +R  I S    V+  ++G  S + T+  ++           Q   RG  FD          + M++   ++ + +   F  Q   T      N  +  KL    +R L+ ++S+++  V +I  L  + D    + R++   L     +R+   VQ+ L +     +  + +I++GG + +P++  ++   + R  + K ++     A GA Y+A            LV     FP+++E
Sbjct:   85 PKVVYRYIQNLLGKTAENPQVAQYQKHFPEHQIVKDEKRGTVYF---KYSEEMQYSPVEILGMVLNYSSGLA------------QDFAEQPIKDAVITVPAFFNQAERRAVLQAAQMAGLKVLQLINDNTAVALNYG--VFRRKDINSTAQNVMFYDMGSGSTTATVVTYQTVKTKESGTQPQLQIRGVGFDRT-----LGGFEMEL---RLRDHLAKLFNEQKKSTKDVR-ENLRAMAKLLKEAQR-LKTVLSANAEHVAQIEGLMDDIDFKAKVTRAEFEALCPDLFERVPGPVQQALASSEMSMDEIEQVILVGGATRVPKVQEVLLKAVGREELAKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPVQVE 438          
BLAST of Heat shock protein70 vs. Ensembl Cavefish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 70.8626 bits (172), Expect = 6.011e-12
Identity = 84/381 (22.05%), Postives = 167/381 (43.83%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESV--SVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKI-SDIYGVL--NVGFESVSMTIFRFE---------HQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQV-KINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACE----------LVSGIFYFPLKLE 1178
            P+ VY     L+G   ++ +  +Y K FP + I ++     +YF   K +E +  S +E++  +L  +  +A            Q+  E   + AV+ +P F+ Q ER+ +L+  ++A + VLQL+  N A +L+      +R  I S    V+  ++G  S + T+  ++           Q   RG  FD          + M++   ++ + +   F  Q   T      N  +  KL    +R L+ ++S+++  V +I  L  + D    + R++   L     +R+   VQ+ L +     +  + +I++GG + +P++  ++   + R  + K ++     A GA Y+A            LV     FP+++E
Sbjct:   98 PKVVYRYIQNLLGKTAENPQVAQYQKHFPEHQIVKDEKRGTVYF---KYSEEMQYSPVEILGMVLNYSSGLA------------QDFAEQPIKDAVITVPAFFNQAERRAVLQAAQMAGLKVLQLINDNTAVALNYG--VFRRKDINSTAQNVMFYDMGSGSTTATVVTYQTVKTKESGTQPQLQIRGVGFDRT-----LGGFEMEL---RLRDHLAKLFNEQKKSTKDVR-ENLRAMAKLLKEAQR-LKTVLSANAEHVAQIEGLMDDIDFKAKVTRAEFEALCPDLFERVPGPVQQALASSEMSMDEIEQVILVGGATRVPKVQEVLLKAVGREELAKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPVQVE 451          
BLAST of Heat shock protein70 vs. Ensembl Cavefish
Match: hyou1 (hypoxia up-regulated 1 [Source:NCBI gene;Acc:327133])

HSP 1 Score: 70.8626 bits (172), Expect = 6.080e-12
Identity = 84/381 (22.05%), Postives = 167/381 (43.83%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESV--SVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKI-SDIYGVL--NVGFESVSMTIFRFE---------HQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQV-KINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACE----------LVSGIFYFPLKLE 1178
            P+ VY     L+G   ++ +  +Y K FP + I ++     +YF   K +E +  S +E++  +L  +  +A            Q+  E   + AV+ +P F+ Q ER+ +L+  ++A + VLQL+  N A +L+      +R  I S    V+  ++G  S + T+  ++           Q   RG  FD          + M++   ++ + +   F  Q   T      N  +  KL    +R L+ ++S+++  V +I  L  + D    + R++   L     +R+   VQ+ L +     +  + +I++GG + +P++  ++   + R  + K ++     A GA Y+A            LV     FP+++E
Sbjct:   85 PKVVYRYIQNLLGKTAENPQVAQYQKHFPEHQIVKDEKRGTVYF---KYSEEMQYSPVEILGMVLNYSSGLA------------QDFAEQPIKDAVITVPAFFNQAERRAVLQAAQMAGLKVLQLINDNTAVALNYG--VFRRKDINSTAQNVMFYDMGSGSTTATVVTYQTVKTKESGTQPQLQIRGVGFDRT-----LGGFEMEL---RLRDHLAKLFNEQKKSTKDVR-ENLRAMAKLLKEAQR-LKTVLSANAEHVAQIEGLMDDIDFKAKVTRAEFEALCPDLFERVPGPVQQALASSEMSMDEIEQVILVGGATRVPKVQEVLLKAVGREELAKNINADEAAAMGAVYQAAALSKAFKVKPFLVRDAAVFPVQVE 438          
BLAST of Heat shock protein70 vs. Ensembl Cavefish
Match: hspa4l (heat shock protein family A (Hsp70) member 4 like [Source:NCBI gene;Acc:103032590])

HSP 1 Score: 68.5514 bits (166), Expect = 2.738e-11
Identity = 62/263 (23.57%), Postives = 122/263 (46.39%), Query Frame = 3
Query:  387 AVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLS--IASKYLKRAKISDIYGV-LNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKIN-QLFPNK-DVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIF 1157
             V+++P F+T  ER+ L++ C++A +  L+L+    A +L+  I  + L  A+      V +++G  S  +++              F+   + VLA+S+   +G     E++  YF  +     K +   NP +  +LY  C + L++L+S++S+ + +N + F N  DV   +NR     +    + R+E  ++  L       +    +  +GG + IP I   I+ F  +  I   L+    +A G   + C ++S  F
Sbjct:  140 CVISVPSFFTDAERRSLMDACQIAGLNCLRLINDTTAVALAYGIYKQDLPNAEEKPRNVVFVDIGHSSYQVSVV------------SFNKGKLKVLATSFDPYLGGRNFDEVLVEYFCEEFKARYKLNVKENPRALLRLYQECEK-LKKLMSANSSDLPLNIECFMNDIDVTGKMNRGHFEEMCAHFLMRVEAPLKAVLEQSKLSRDEVYAVEAVGGATRIPVIKERISKFFGK-DISTTLNADEAVARGCALQ-CAILSPAF 387          
BLAST of Heat shock protein70 vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 53.5286 bits (127), Expect = 1.863e-7
Identity = 71/352 (20.17%), Postives = 146/352 (41.48%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIE--FNDRT--AVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIE-IMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            PEN   ++  LIG    D   Q  +K +P+ +            L++K    + V E++A     + + A ++   M   K +E  E     +   AVV +P ++   +RQ   +   +A + VL+++  N   + +IA    K+    +I  V ++G  +  +++   +H                V+A++    +G     + +M ++  +   +T K    +  +  KL     +  R L + H A++ I   +   D   +L R+K   L     +   + VQK + +          I+++GG + IP+I  L+          + ++    +A+GA  +A  ++SG
Sbjct:   93 PENTVFDAKRLIGRSWTDPTVQHDIKFWPFTV------------LEKKGKPHIQV-EVIAG---ESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRII--NEPTAAAIAYGLDKKEGEKNIL-VFDLGGGTFDVSLLTIDHGV------------FEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAG-VLSG 412          
BLAST of Heat shock protein70 vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 68.1662 bits (165), Expect = 3.880e-12
Identity = 80/364 (21.98%), Postives = 149/364 (40.93%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYII-KENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIE------FNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAK----ISDI-YGVLNVGFESVSMTIF--RFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKL----FVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG K  D       K FP+ +I ++     Q+ +  +   ++ +  E+ + +L                +K +E  E       ND  AVV +P ++   +RQ   +   +A + VL+++    AA+++       RA+    I D+  G  +V   S+   +F  +     +   G  FD+  +N LA+ +                      +T K    N  S  +L  A  R  R L SS    ++I+ LF   D   SL R++       L   T++ +E+V++ +  +  Q       I+++GG + IP+I  L++ F       + ++    +A+GA  +A  L  
Sbjct:   61 PHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEY--KGETKTFTPEEISSMVL----------------SKMKETAENYLGTTVND--AVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKR--------------------KTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDE----IVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTG 380          
BLAST of Heat shock protein70 vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 64.3142 bits (155), Expect = 5.559e-11
Identity = 80/358 (22.35%), Postives = 141/358 (39.39%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIE------FNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTG-----KLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG    D   Q  +K FP+ +I  +     Q+ F     N          F  E        Q  +M   K +E  E       ND  AVV +P ++   +RQ   +   +A + VL+++    AA  +IA    K+ K   +  + ++G  +  +++   E           D +   V A++    +G       + N+F    +Q  K      +ST      +L  AC R  R L SS    V+I+ LF   D   S+ R++   L     +     V+K L +     +    I+++GG + IP++  L+  +       + ++    +A+GA  +A  L  
Sbjct:   61 PSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKN----------FTPE--------QISSMVLGKMKETAESYLGAKVND--AVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAA--AIAYGLDKKGKEEHVL-IFDLGGGTFDVSLLSIE-----------DGI-FEVKATAGDTHLGGEDFDNRLVNHF----IQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTG 379          
BLAST of Heat shock protein70 vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 63.5438 bits (153), Expect = 8.584e-11
Identity = 80/358 (22.35%), Postives = 141/358 (39.39%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIE------FNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTG-----KLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG    D   Q  +K FP+ +I  +     Q+ F     N          F  E        Q  +M   K +E  E       ND  AVV +P ++   +RQ   +   +A + VL+++    AA  +IA    K+ K   +  + ++G  +  +++   E           D +   V A++    +G       + N+F    +Q  K      +ST      +L  AC R  R L SS    V+I+ LF   D   S+ R++   L     +     V+K L +     +    I+++GG + IP++  L+  +       + ++    +A+GA  +A  L  
Sbjct:   61 PANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGETKN----------FTPE--------QISSMVLGKMKETAESYLGAKVND--AVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAA--AIAYGLDKKGKEEHVL-IFDLGGGTFDVSLLSIE-----------DGI-FEVKATAGDTHLGGEDFDNRLVNHF----IQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTG 379          
BLAST of Heat shock protein70 vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 62.003 bits (149), Expect = 2.789e-10
Identity = 75/354 (21.19%), Postives = 144/354 (40.68%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYII-KENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA----SKYLKRAKISDI-YGVLNVGFESVSMTIF--RFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG K  D       K +P+ +I K      Q+ +  +   ++ +  E+ + IL      A     N    + ++        AVV +P ++   +RQ   +   +A + VL+++    AA+++      S+      I D+  G  +V   S+   +F  +     +   G  FDS  +N LA  +      NK  ++  N  +++ L+T                A  R  R L SS    ++I+ LF   D   S+ R++   L     +   + V+K L +     +    I+++GG + IP++  L++ F       + ++    +A+GA  +A  L  
Sbjct:   61 PHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEY--KGETKTFTPEEISSMILTKMKETA----ENFLGTEVKD--------AVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRK---NK-KDLTTNQRSLRRLRT----------------AAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTG 380          
BLAST of Heat shock protein70 vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 55.0694 bits (131), Expect = 3.731e-8
Identity = 74/360 (20.56%), Postives = 146/360 (40.56%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIA-----NKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA-SKYLKRAKISDIY----GVLNVGFESVSMTIFRFE--HQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKL----FVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACEL 1142
            P+N   +   LIGLK  D+  Q+ +K  P+ ++ ++   +    + +   +  +  E+   IL     IA      K +H                 AVV +P ++   +RQ   +   +A + VL+++    AA+++    K  K  +I  +Y    G  +V   S+   +F  +     +   G  FD          Y +   V ++I+  +    + +    K       +  KL     +  R L S  S +++I+      D+  +L R+K       L  KT+K +E+V+Q +        +    I+++GG + IP++  L+  +       K ++    +A+GA  +A  L
Sbjct:  109 PQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSV-KGEKKVFTPEEISGMILGKMKQIAEDYLGTKVTH-----------------AVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDKSDKEHQII-VYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFD----------YKI---VRQLIKAFKKKHGIDVSDNNK-------ALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDLFKKTLKPVEKVLQDSGLEKKDVDD----IVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVL 425          
BLAST of Heat shock protein70 vs. Ensembl Nematostella
Match: EDO35204 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM46])

HSP 1 Score: 90.5077 bits (223), Expect = 1.894e-18
Identity = 79/359 (22.01%), Postives = 159/359 (44.29%), Query Frame = 3
Query:  108 YPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNE-SVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFND---RTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDI----YGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPIST---GKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            +P+  Y+    L+G KL +   + Y +RFP+Y ++E+ +T  + F  R +++ + +  EL+  IL ++  I                 +F D   +  V+ +P F+ Q ER+ LL   +L  + VLQ++ SN A +L+      ++   +D     +   ++G  S   TI  +   ++  RG    +  + +    +   +G + I   +R++      +  KF      S+    K Y    RV + L +++    +I  +F  KD  + + R +L  +      R+   V + L +     N    ++++GGG  +P++   +   +K+  + K ++     A GA Y+A  L  G
Sbjct:   86 HPDKSYIYLHDLLGKKLDNPHVKNYQQRFPWYKLEEDKTTGNVVF--RHDSDVTFTPEELMGMILNHSRFIGE---------------QFADHPIKDVVLTVPPFFNQAERRALLRAAELVGLNVLQIMNSNTAVALNYG--LFQQKSFNDTLEKHFMFYDMGASSTVATIVGYSMTKTKDRGISETAPQLVIKGIGFDRTLGGHAIDMRLRDHLVQLFKKNYKFKGEVTQSSRAMAKFYKEALRVKQVLSANNEIFAQIEGVFDGKDFRVKVTREELEEMCQDLFDRVAGPVNRALKSASMTMNDIDSVVLVGGGIRVPKVQDALLRAVKKPELAKNINADEAAALGAVYQAAHLGKG 425          
BLAST of Heat shock protein70 vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 70.8626 bits (172), Expect = 1.333e-12
Identity = 77/357 (21.57%), Postives = 146/357 (40.90%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNN---ESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFV----LINKTIKRIEQVVQKTLGNMPQFWNIPKG------IIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKAC 1136
            PEN   ++  LIG K  D      +  +P+++I+E      Q+ F   K +   E +S + L             K++   Y       +      AVV +P ++   +RQ   +   +A + VL+++  N   + +IA    K+  +     + ++G  +  +++   E           D +   V +++    +G       M ++F  Q  Q  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++       L  KT + +EQ ++ +         IP G      I+++GG + IP+I  ++        + K ++    +A+GA  +A 
Sbjct:   63 PENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKM----------KETAEAY-------LGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRII--NEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIE-----------DGI-FEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDS--------KIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAA 380          
BLAST of Heat shock protein70 vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 62.7734 bits (151), Expect = 5.431e-10
Identity = 74/355 (20.85%), Postives = 150/355 (42.25%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QL-YFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEF----NDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA-SKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPA-NPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            PEN   ++  LIG +  D   Q  +K +P+ II +N+    Q+ Y  +RK                   + A ++  +M   K +E  E        +AV+ +P ++   +RQ   +   +A + VL+++    AA+L+    K L   K   I+   ++G  +  ++I   +           D     V +++    +G       + N+F  +  +  K   + N  +  +L  AC R  R L SS  A ++++ LF   D    ++R++   L +         V K L +     +    ++++GG + +P+I  ++  +     + K ++    +A+GA  +A  ++SG
Sbjct:   63 PENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERK-------------------TFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIF---DLGGGTFDVSILTID-----------DGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAA-ILSG 383          
BLAST of Heat shock protein70 vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 60.8474 bits (146), Expect = 2.024e-9
Identity = 78/358 (21.79%), Postives = 149/358 (41.62%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIE----FNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA-SKYLKRAK---ISDIYG-VLNVGFESVSMTIFRFE--HQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKL----FVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKAC 1136
            P N   ++  LIG +  D   ++ +K + + ++                NE+      V +  E     A + S +M  NK +E  E         AVV +P ++   +RQ   +   ++ + VL+++    AA+++    K + + +   I D+ G   +V   S+   IF  +  H  +   G  FD+                      M ++F  Q  Q  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++       L  KT++ +E+ ++ +   +     I + I+++GG + IP+I +L+  F     + K ++    +A+GA  +A 
Sbjct:   63 PTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVV----------------NEAGRPKVKVEYKGETKTFFAEEIS-SMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNN---------------------MVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDS--KLESKEKIDE-IVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAA 379          
BLAST of Heat shock protein70 vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 60.8474 bits (146), Expect = 2.088e-9
Identity = 74/346 (21.39%), Postives = 147/346 (42.49%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIE-IMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACEL 1142
            PEN   ++  LIG    D   Q  LK FP+ ++ +N     Q+   D    ++ +  E+ A +L        K++   Y  K   +       AVV +P ++   +RQ   +   +A +TV++++  N   + +IA    K+    +I  V ++G  +  +++               D+    V+A++    +G     + +M ++  +   +  K    +  +  KL     +  R L + H A+V+I   F  +D    L R++   L  K  K   + VQK L +     +    I+++GG + IP++  L+  F +     + ++    +A+GA  +A  L
Sbjct:   93 PENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEI--KTFAAEEISAMVLTKM-----KETAEAYLGKKVTH-------AVVTVPAYFNDAQRQATKDAGAIAGLTVMRII--NEPTAAAIAYGMDKKEGEKNIL-VFDLGGGTFDVSLL------------TIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVL 409          
BLAST of Heat shock protein70 vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 68.9366 bits (167), Expect = 1.509e-11
Identity = 77/351 (21.94%), Postives = 149/351 (42.45%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG +  D   Q  +K +P+ +I +N+    Q+ +  +   +S    E+ + +L     IA       Y  K   N       AV+ +P ++   +RQ   +   ++ + VL+++    AA+++    Y    K+     VL  ++G  +  ++I   E           D +   V +++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++   L     +     V+K+L +          I+++GG + IP+I  L+  F     + K ++    +A+GA  +A  ++SG
Sbjct:   60 PTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEY--KGETKSFYPEEISSMVLTKMKEIAE-----AYLGKTVNN-------AVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA----YGLDKKVGSERNVLIFDLGGGTFDVSILTIE-----------DGI-FEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAA-ILSG 379          
BLAST of Heat shock protein70 vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 68.5514 bits (166), Expect = 2.125e-11
Identity = 77/351 (21.94%), Postives = 149/351 (42.45%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG +  D   Q  +K +P+ +I +N+    Q+ +  +   +S    E+ + +L     IA       Y  K   N       AV+ +P ++   +RQ   +   ++ + VL+++    AA+++    Y    K+     VL  ++G  +  ++I   E           D +   V +++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++   L     +     V+K+L +          I+++GG + IP+I  L+  F     + K ++    +A+GA  +A  ++SG
Sbjct:   84 PTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEY--KGETKSFYPEEISSMVLTKMKEIAE-----AYLGKTVNN-------AVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA----YGLDKKVGSERNVLIFDLGGGTFDVSILTIE-----------DGI-FEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAA-ILSG 403          
BLAST of Heat shock protein70 vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 68.5514 bits (166), Expect = 2.514e-11
Identity = 77/351 (21.94%), Postives = 149/351 (42.45%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTS-QLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG +  D   Q  +K +P+ +I +N+    Q+ +  +   +S    E+ + +L     IA       Y  K   N       AV+ +P ++   +RQ   +   ++ + VL+++    AA+++    Y    K+     VL  ++G  +  ++I   E           D +   V +++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++   L     +     V+K+L +          I+++GG + IP+I  L+  F     + K ++    +A+GA  +A  ++SG
Sbjct:  113 PTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEY--KGETKSFYPEEISSMVLTKMKEIAE-----AYLGKTVNN-------AVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA----YGLDKKVGSERNVLIFDLGGGTFDVSILTIE-----------DGI-FEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAA-ILSG 432          
BLAST of Heat shock protein70 vs. Ensembl Medaka
Match: hsp70-5 (Oryzias latipes heat shock protein 70 (hsp70-5), mRNA. [Source:RefSeq mRNA;Acc:NM_001104914])

HSP 1 Score: 66.2402 bits (160), Expect = 1.075e-10
Identity = 76/350 (21.71%), Postives = 146/350 (41.71%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAIS---IANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG    D   Q  +K +P+ +I +N        +D K        E  AF  E   S   +  K+    Y  +   N+       V+ +P ++   +RQ   +   +A + V++++    AA+++      KR + + +  + ++G  +  ++I   E           D +   V A+S    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ LF   D   S+ R++   L +   +   + V+K L +     +    I+++GG + IP+I  L+ +      + K ++    +A+GA  +A  L+ 
Sbjct:   63 PSNTVFDAKRLIGRNFNDPIVQSDMKLWPFKVINDNGKPK--IQVDYKG-------ETKAFYPEEISSMVLVKMKEIAEAYLGQRVSNV-------VITVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKGKRGEQNVL--IFDLGGGTFDVSILTIE-----------DGI-FEVKATSGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSSQASIEIDSLFDGIDFYTSITRARFEELNSDLFRGTLEPVEKALRDAKLDKSKIHEIVLVGGSTRIPKIQKLLQVLFNGRELNKSINPDEAVAYGAAVQAAILMG 382          
BLAST of Heat shock protein70 vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 66.2402 bits (160), Expect = 1.131e-10
Identity = 78/356 (21.91%), Postives = 147/356 (41.29%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIA---NKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKL----FVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS 1148
            P N   ++  LIG K  D   Q  +K +P+ ++  N S+     ++ K        E+  F  E   S+     K+    Y  K   N       AV+ +P ++   +RQ   +   +A + VL+++    AA+++    Y    K+     VL  ++G  +  ++I   E           D +   V A++    +G       M N+F  +  +  K     N  +  +L  AC R  R L SS  A ++I+ L+   D   S+ R++       L   TI+ +E+ ++    +  Q  +    ++++GG + IP+I  L+        + K ++    +A+GA  +A  L  
Sbjct:   80 PANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVV--NDSSKPKVEVEYKG-------EIKTFYPEEISSMVLTKMKEISEAYLGKSVTN-------AVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA----YGLDKKVGGERNVLIFDLGGGTFDVSILTIE-----------DGI-FEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHD----VVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAG 399          
BLAST of Heat shock protein70 vs. Planmine SMEST
Match: SMESG000016915.1 (SMESG000016915.1)

HSP 1 Score: 1552.73 bits (4019), Expect = 0.000e+0
Identity = 806/806 (100.00%), Postives = 806/806 (100.00%), Query Frame = 3
Query:   99 MYYYPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIFYFPLKLEENYFKSIQLILTSGNYKENRXXXXXXXXXXXSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIFVRKSLLKLTESDYYEDSLNNSKRIIINATQHEIVKYNIKYKNNEPKKVENFQEIFLKYNRFXXXXXXXXXXXXXXXXXXYYTNEMRKNFGDQDYMECTTKYDRELIWSFLEENERFIRSHPITAVSTPEYLRRFDYIINITSKVEFRVHEQKNRPILMKRLGQILDTTQHFIMNMFVTSGPSTVSKGLFTSHETKFLRSLNKEITLWFKSANNKLKAIKPNDDPPVXXXXXXXXXXXXXXQHKELLNLLAQRTDPSAKNQKNNNQIESSPKEKDTCDNSDQKSCSDSLNSNKTDTRDNKNTEASPDCGRQQPHLINQTNNMC 2516
            MYYYPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIFYFPLKLEENYFKSIQLILTSGNYKENRKIIKLKNNIKLSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIFVRKSLLKLTESDYYEDSLNNSKRIIINATQHEIVKYNIKYKNNEPKKVENFQEIFLKYNRFKKKLEESLEKENVKNELEYYTNEMRKNFGDQDYMECTTKYDRELIWSFLEENERFIRSHPITAVSTPEYLRRFDYIINITSKVEFRVHEQKNRPILMKRLGQILDTTQHFIMNMFVTSGPSTVSKGLFTSHETKFLRSLNKEITLWFKSANNKLKAIKPNDDPPVICDEIIDKIKILDKQHKELLNLLAQRTDPSAKNQKNNNQIESSPKEKDTCDNSDQKSCSDSLNSNKTDTRDNKNTEASPDCGRQQPHLINQTNNMC
Sbjct:   78 MYYYPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIFYFPLKLEENYFKSIQLILTSGNYKENRKIIKLKNNIKLSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIFVRKSLLKLTESDYYEDSLNNSKRIIINATQHEIVKYNIKYKNNEPKKVENFQEIFLKYNRFKKKLEESLEKENVKNELEYYTNEMRKNFGDQDYMECTTKYDRELIWSFLEENERFIRSHPITAVSTPEYLRRFDYIINITSKVEFRVHEQKNRPILMKRLGQILDTTQHFIMNMFVTSGPSTVSKGLFTSHETKFLRSLNKEITLWFKSANNKLKAIKPNDDPPVICDEIIDKIKILDKQHKELLNLLAQRTDPSAKNQKNNNQIESSPKEKDTCDNSDQKSCSDSLNSNKTDTRDNKNTEASPDCGRQQPHLINQTNNMC 883          
BLAST of Heat shock protein70 vs. Planmine SMEST
Match: SMESG000016915.1 (SMESG000016915.1)

HSP 1 Score: 1549.26 bits (4010), Expect = 0.000e+0
Identity = 806/806 (100.00%), Postives = 806/806 (100.00%), Query Frame = 3
Query:   99 MYYYPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIFYFPLKLEENYFKSIQLILTSGNYKENRXXXXXXXXXXXSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIFVRKSLLKLTESDYYEDSLNNSKRIIINATQHEIVKYNIKYKNNEPKKVENFQEIFLKYNRFXXXXXXXXXXXXXXXXXXYYTNEMRKNFGDQDYMECTTKYDRELIWSFLEENERFIRSHPITAVSTPEYLRRFDYIINITSKVEFRVHEQKNRPILMKRLGQILDTTQHFIMNMFVTSGPSTVSKGLFTSHETKFLRSLNKEITLWFKSANNKLKAIKPNDDPPVXXXXXXXXXXXXXXQHKELLNLLAQRTDPSAKNQKNNNQIESSPKEKDTCDNSDQKSCSDSLNSNKTDTRDNKNTEASPDCGRQQPHLINQTNNMC 2516
            MYYYPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIFYFPLKLEENYFKSIQLILTSGNYKENRKIIKLKNNIKLSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIFVRKSLLKLTESDYYEDSLNNSKRIIINATQHEIVKYNIKYKNNEPKKVENFQEIFLKYNRFKKKLEESLEKENVKNELEYYTNEMRKNFGDQDYMECTTKYDRELIWSFLEENERFIRSHPITAVSTPEYLRRFDYIINITSKVEFRVHEQKNRPILMKRLGQILDTTQHFIMNMFVTSGPSTVSKGLFTSHETKFLRSLNKEITLWFKSANNKLKAIKPNDDPPVICDEIIDKIKILDKQHKELLNLLAQRTDPSAKNQKNNNQIESSPKEKDTCDNSDQKSCSDSLNSNKTDTRDNKNTEASPDCGRQQPHLINQTNNMC
Sbjct:   78 MYYYPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIFYFPLKLEENYFKSIQLILTSGNYKENRKIIKLKNNIKLSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVEISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIFVRKSLLKLTESDYYEDSLNNSKRIIINATQHEIVKYNIKYKNNEPKKVENFQEIFLKYNRFKKKLEESLEKENVKNELEYYTNEMRKNFGDQDYMECTTKYDRELIWSFLEENERFIRSHPITAVSTPEYLRRFDYIINITSKVEFRVHEQKNRPILMKRLGQILDTTQHFIMNMFVTSGPSTVSKGLFTSHETKFLRSLNKEITLWFKSANNKLKAIKPNDDPPVICDEIIDKIKILDKQHKELLNLLAQRTDPSAKNQKNNNQIESSPKEKDTCDNSDQKSCSDSLNSNKTDTRDNKNTEASPDCGRQQPHLINQTNNMC 883          
BLAST of Heat shock protein70 vs. Planmine SMEST
Match: SMESG000054253.1 (SMESG000054253.1)

HSP 1 Score: 102.834 bits (255), Expect = 5.102e-22
Identity = 112/504 (22.22%), Postives = 223/504 (44.25%), Query Frame = 3
Query:  108 YPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRA--KISDIYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTV---QLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSGIFYFPLKLEENYFKSIQLILTSGNY-----KENRXXXXXXXXXXXSSHLIRNLTSNFQLEIRFIPIAATGLSEIEVPKIVYNVDVS----DYKTTI----ENIIRNHQKSVEIS--NFTESFIYKGVRVMHSVDNNFIVTLDSIEAIFVRK 1559
            +P+ +Y +   L+G  L     +++ K FPYY IK + +    +  D K     +V EL+A +LENA  IA   S            E   +  ++ +P ++TQ+ER  +L   ++A   VLQL+ SN A +L+    + ++A    +  Y   + G  + +++I  ++  +    G   ++  ++++   Y   +G ++ I  ++ +      +L +  K     P S  KLY    RVL+ L +++    ++  +  +KD+ + + R++   +     +R  + + K L +        K +I++GGG+ IP+   ++    +   + K ++     A GA Y+A  +  G      K++    K   L+  + ++      EN+++           H    +  +F   + + P+              +NV +     D KT I    +N+   H   +E S  + TE   +KGV+    +D   IV+L+ IEA+F R+
Sbjct:   82 FPKYLYHSITLLVGKTLDHPVVKQFQKDFPYYEIKMDENNQLAFQHDEKT--VFTVEELLAMVLENAKHIAETYS------------EMPMKGGIIVVPPYFTQEERLAILRAARIAGTNVLQLMNSNTAVALNYGI-FRRKAFNTTAQYYMFYDFGSSATTVSIVSYQMVKVKEFGMMVENPQLSIVGIGYDRTLGASQFILRLQAHLAHAFNKLKKPSKDVTTVPRSMAKLYKEASRVLKVLSANNEIYAQVENVLDDKDLKVKVTRAEFEEMCKDLFERFVEPIHKALESAQLPMPTIKEVILMGGGTRIPKFQEILLKTTEMQELGKSINTDESAALGAVYQAAFISPG-----FKVKTFVVKDANLVPIAVDFFRFKTMENKEV----------PHFTSRVIFDF---MNYFPMKRVLTFNKHTKNFDFNVTIGTQDIDKKTLIFVEVKNLTEVHSGYLESSEKHVTE---FKGVKAHFGLDAGGIVSLNYIEALFERQ 549          

HSP 2 Score: 55.4546 bits (132), Expect = 2.252e-7
Identity = 52/239 (21.76%), Postives = 106/239 (44.35%), Query Frame = 3
Query: 1803 MRKNFGDQDYMECTTKYDREL-IWSFLEENERFIRSHPITAVSTPEYLRRFDYIINITSKVEFRVHEQKNRPILMKRLGQILDTTQHFIMNMFVTSGPSTVSKGLFTSHETKFLRSLNKEITLWFKSANNKLKAIKPNDDPPVXXXXXXXXXXXXXXQHKELLNLLA--------QRTDPSAKNQKNNNQIESSPKEKDTCDNSDQKSCSDSLNSNKTDTRDNKNTEASPDCGRQQPHL 2492
            ++  F  + Y  C+T+ +R+L + S     E +    P  A    +Y+ R++ +  +   ++FRV E   RP  + RL  +L+++  F+ N+   +G   +    FT  E+  L  L  + T WF++AN    +++ N +P +   +     + L+++   LLN ++            P   NQ +  + + S ++KD    S+    +   +  K    D  +T    +  R+  H+
Sbjct:  684 VKSQFDKEIYTRCSTETERKLAVDSAQALGEWYEEQGP--ATPKEDYITRYNELRKLMGDIDFRVREYNLRPEAISRLNSVLNSSNGFLENIKNLTGEGKI----FTQAESDSLSKLIVDTTKWFEAANKTFNSMQLNVNPKITISDFEPHGRALEREIGYLLNKISIWKSQPPPPTQSPPTDNQTSKEETKESSEKKDNQSKSESAKDAGKKDEPKPSLPDENDTTKFQETPRKDEHV 916          
BLAST of Heat shock protein70 vs. Planmine SMEST
Match: SMESG000080711.1 (SMESG000080711.1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.308e-12
Identity = 77/351 (21.94%), Postives = 151/351 (43.02%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIK-ENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISDIYGVL--NVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFH-PANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG K  +   Q  +K F + ++  E     Q+ F  +  +++ S  E+ + +L     +  K++   Y  K  +N       AVV +P ++   +RQ   +   +A + VL+++    AA+++    Y    K SD   VL  ++G  +  ++I               D     V +++    +G       M ++F  +  +  K     N  +  +L  AC R  R L SS  A ++++ LF   D   S+ R++   L     +     V+K+L +     N    I+++GG + IP++  L+  +     + K ++    +A+GA  +A  ++SG
Sbjct:   62 PANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEF--KGESKTFSAEEISSMVL-----LKMKETAEAYIGKEVKN-------AVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA----YGLDKKSSDEKNVLIFDLGGGTFDVSILSI------------DDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEAVAYGAAVQAA-ILSG 381          
BLAST of Heat shock protein70 vs. Planmine SMEST
Match: SMESG000077989.1 (SMESG000077989.1)

HSP 1 Score: 64.3142 bits (155), Expect = 3.149e-10
Identity = 80/355 (22.54%), Postives = 146/355 (41.13%), Query Frame = 3
Query:  111 PENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIK-ENSSTSQLYFLDRKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVAIPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIA----SKYLKRAKISDI-YGVLNVGFESVSMTIFRFEHQ--QSSFRGYRFDSMNINVLASSYSMDIGVNKIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQVKINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPKGIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVSG 1151
            P N   ++  LIG K  D   Q  LK F Y ++  +N    Q+ FL     +  S  E+ + +L     +  K++   Y        E  D  AVV +P ++   +RQ   +   +A + VL+++    AA+++       K ++   I D+  G  +V   ++   IF  +     +   G  FD                 N++++     F  +  + +     N  S  +L   C R  R L SS  A ++++ LF   D   S+ R++   L     K     V+K L +          I+++GG + IP++  L+  F     + K ++    +A+GA  +A  ++SG
Sbjct:   62 PINTVFDAKRLIGRKFNDPSVQNDLKHFSYKVVDVDNLPKIQVEFLGEI--KVFSPEEISSMVL-----LKMKETAEAYLGS-----EVKD--AVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKNEKKIRNVLIFDLGGGTFDVSVLAIENGIFEVKSTAGDTHLGGEDFD-----------------NRMVDFFIQEFKRKHKKDIS---DNKKSLRRLRTVCERAKRTLSSSAVANIEVDSLFDGIDFYTSITRARFEELCADLFKSTLDPVEKALKDAKIDKKNINEIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAA-ILSG 381          
The following BLAST results are available for this feature:
BLAST of Heat shock protein70 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA61.984e-1220.77heat shock protein family A (Hsp70) member 6 [Sour... [more]
HSPA1A1.077e-1120.69heat shock protein family A (Hsp70) member 1A [Sou... [more]
HSPA1B1.866e-1120.69heat shock protein family A (Hsp70) member 1B [Sou... [more]
HSPA1A1.866e-1120.69heat shock protein family A (Hsp70) member 1A [Sou... [more]
HSPA1B1.866e-1120.69heat shock protein family A (Hsp70) member 1B [Sou... [more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-15.445e-1420.40Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-15.445e-1420.40Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
T14G8.31.318e-1221.15pep chromosome:WBcel235:X:12861237:12870018:1 gene... [more]
T14G8.31.485e-1221.53pep chromosome:WBcel235:X:12861237:12870025:1 gene... [more]
hsp-702.393e-1121.37Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG29184.879e-1524.55gene:FBgn0023529 transcript:FBtr0300792[more]
CG29184.879e-1524.55gene:FBgn0023529 transcript:FBtr0070411[more]
Hsp684.461e-1221.97gene:FBgn0001230 transcript:FBtr0084589[more]
Hsp70Ab1.499e-1120.40gene:FBgn0013276 transcript:FBtr0082482[more]
Hsp70Aa1.499e-1120.40gene:FBgn0013275 transcript:FBtr0082512[more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa1b1.774e-1120.98heat shock protein family A (Hsp70) member 1B [Sou... [more]
hsc701.952e-1121.63heat shock cognate 70 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
hsc701.952e-1121.63heat shock cognate 70 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
hspa85.192e-1121.69heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa86.183e-1121.69heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed101.452e-1120.46transmembrane emp24-like trafficking protein 10 (y... [more]
pawr2.572e-1121.14PRKC, apoptosis, WT1, regulator [Source:Xenbase;Ac... [more]
ENSXETT00000025573.13.627e-1120.46heat shock protein family A (Hsp70) member 1B [Sou... [more]
HSPA22.507e-1019.66heat shock protein family A (Hsp70) member 2 [Sour... [more]
HSPA22.594e-1019.66heat shock protein family A (Hsp70) member 2 [Sour... [more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa21.033e-1021.39heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa21.033e-1021.39heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa1a1.445e-1020.11heat shock protein 1A [Source:MGI Symbol;Acc:MGI:9... [more]
Hspa1b1.603e-1020.11heat shock protein 1B [Source:MGI Symbol;Acc:MGI:9... [more]
Hspa81.681e-1021.47heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Heat shock protein70 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09446|HSP7A_CAEEL6.926e-1320.40Heat shock 70 kDa protein A OS=Caenorhabditis eleg... [more]
sp|P05456|HSP70_TRYCR1.125e-1220.45Heat shock 70 kDa protein OS=Trypanosoma cruzi OX=... [more]
sp|P17066|HSP76_HUMAN9.526e-1220.77Heat shock 70 kDa protein 6 OS=Homo sapiens OX=960... [more]
sp|Q04967|HSP76_PIG1.029e-1121.58Heat shock 70 kDa protein 6 OS=Sus scrofa OX=9823 ... [more]
sp|P27541|HSP70_BRUMA1.289e-1120.45Heat shock 70 kDa protein OS=Brugia malayi OX=6279... [more]
back to top
BLAST of Heat shock protein70 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G9A32.050e-2124.11Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FLJ42.413e-2124.11Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DVT42.965e-2124.11Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8ILP94.416e-2124.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8ISK35.219e-2124.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hyou14.449e-1222.05hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hyou15.828e-1222.05hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hyou16.011e-1222.05hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hyou16.080e-1222.05hypoxia up-regulated 1 [Source:NCBI gene;Acc:32713... [more]
hspa4l2.738e-1123.57heat shock protein family A (Hsp70) member 4 like ... [more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hspa51.863e-720.17heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA33.880e-1221.98ATPase involved in protein folding and the respons... [more]
SSA15.559e-1122.35ATPase involved in protein folding and NLS-directe... [more]
SSA28.584e-1122.35HSP70 family ATP-binding protein; involved in prot... [more]
SSA42.789e-1021.19Heat shock protein that is highly induced upon str... [more]
KAR23.731e-820.56ATPase involved in protein import into the ER; als... [more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352041.894e-1822.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372801.333e-1221.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445305.431e-1020.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303232.024e-921.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332962.088e-921.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock protein70 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsc701.509e-1121.94heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsc702.125e-1121.94heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsc702.514e-1121.94heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsp70-51.075e-1021.71Oryzias latipes heat shock protein 70 (hsp70-5), m... [more]
hsp70-31.131e-1021.91heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
back to top
BLAST of Heat shock protein70 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016915.10.000e+0100.00SMESG000016915.1[more]
SMESG000016915.10.000e+0100.00SMESG000016915.1[more]
SMESG000054253.15.102e-2222.22SMESG000054253.1[more]
SMESG000080711.12.308e-1221.94SMESG000080711.1[more]
SMESG000077989.13.149e-1022.54SMESG000077989.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023936 ID=SMED30023936|Name=Heat shock protein70|organism=Schmidtea mediterranea sexual|type=transcript|length=2786bp
AATGAATAAATCATTTTTAGTGCATTGCTTCACTATATTTGCTTTGGCAC
TTTCGTACCTTATTTCAACCTCTTGCAGAATTTTATAATTAATTTTAGAT
GTACTATTATCCCGAAAACGTATATTTGAACTCACCGTGCTTGATAGGAT
TAAAACTAAAAGACAAAAGAAGCCAAGAATACCTGAAACGATTTCCATAT
TACATAATCAAAGAAAATTCTTCAACAAGTCAATTATACTTTCTAGATCG
AAAAAACAACGAATCAGTGTCCGTAATAGAATTGGTAGCGTTTATCCTTG
AAAATGCTATAAGTATAGCAAATAAACAAAGTCACAATATGTATCCAAAT
AAATTTCAAGAAAACATTGAATTTAATGATCGGACAGCTGTAGTGGCTAT
TCCTATGTTTTATACTCAGAAAGAGAGACAAATTCTTTTAGAAATTTGTA
AGCTGGCAAATATAACAGTATTGCAGTTATTGGAGTCCAATAATGCAGCC
TCGTTATCAATAGCGTCCAAATACCTAAAACGGGCAAAGATTTCGGATAT
TTATGGCGTTCTTAATGTTGGATTTGAATCTGTTTCAATGACAATATTTA
GATTTGAGCACCAGCAATCAAGTTTCCGCGGCTACCGCTTTGATAGCATG
AACATCAATGTGCTTGCGTCAAGCTATTCGATGGACATCGGTGTCAACAA
AATAATTGAAATAATGCGCAATTATTTCACTGTCCAGCTGTTGCAAACTG
TGAAATTCCATCCGGCAAATCCGATTAGTACTGGGAAATTGTACATGGCA
TGTCGTAGGGTTTTGCGTCGTTTGATTTCGTCGCACTCTGCTCAAGTGAA
AATAAATCAACTATTTCCCAATAAAGATGTCGTGATTTCATTGAACAGAT
CGAAATTGTTTGTTTTAATTAATAAGACAATTAAACGAATCGAGCAAGTC
GTTCAAAAGACATTAGGAAATATGCCACAGTTCTGGAATATCCCTAAGGG
AATCATTGTAATTGGGGGAGGAAGTTTTATCCCTGAAATTGACACATTAA
TAAATATATTTTTGAAAAGAATTCCAATTCTAAAAGTGCTCGATCGATTC
ACAGACATTGCATGGGGTGCAACATATAAAGCTTGTGAATTGGTATCAGG
AATATTTTATTTTCCTTTAAAATTGGAGGAAAATTATTTTAAATCAATTC
AACTTATTTTGACTTCAGGAAATTATAAGGAGAACAGAAAAATTATCAAA
TTAAAAAATAATATCAAATTATCTTCGCATTTGATTCGAAATTTAACATC
GAACTTTCAGTTGGAAATCCGCTTTATCCCAATAGCGGCAACAGGATTGT
CTGAGATTGAAGTGCCGAAAATCGTGTACAATGTTGACGTGTCAGATTAC
AAAACTACAATTGAAAATATTATTCGAAATCATCAGAAATCTGTAGAAAT
ATCAAATTTCACCGAAAGCTTCATCTACAAAGGGGTACGGGTCATGCATT
CGGTTGACAACAATTTCATTGTTACATTGGATTCAATTGAGGCAATTTTC
GTTAGAAAATCTCTACTAAAATTAACGGAAAGTGATTATTATGAAGATTC
TCTCAACAATTCTAAGAGGATCATTATAAACGCTACCCAACATGAAATTG
TGAAGTATAATATTAAATACAAAAATAATGAACCGAAAAAAGTCGAAAAC
TTTCAAGAGATCTTTCTCAAGTATAATCGGTTCAAGAAGAAATTAGAGGA
AAGTCTGGAAAAGGAAAATGTGAAAAATGAATTAGAATATTACACCAATG
AAATGAGAAAGAATTTCGGTGATCAAGACTACATGGAATGCACTACAAAG
TATGACCGAGAGTTGATTTGGTCATTCCTAGAAGAGAATGAACGATTCAT
CAGATCCCACCCGATCACAGCCGTTTCTACGCCAGAATATTTGAGAAGGT
TTGATTACATTATCAATATAACTTCCAAAGTTGAATTCCGAGTTCATGAA
CAGAAAAACCGCCCGATATTAATGAAAAGACTTGGTCAAATTTTGGATAC
CACCCAGCATTTTATTATGAATATGTTTGTCACAAGCGGACCAAGCACTG
TGAGCAAAGGATTATTCACGTCGCATGAAACGAAATTCCTTAGATCATTA
AATAAAGAGATAACATTATGGTTTAAGAGCGCTAATAATAAATTGAAAGC
CATCAAACCAAATGATGATCCCCCGGTTATCTGTGATGAAATTATTGATA
AAATCAAAATATTAGATAAACAACACAAGGAATTATTAAATTTGCTGGCA
CAAAGAACCGATCCAAGTGCAAAAAATCAGAAAAATAACAATCAAATTGA
AAGTAGTCCGAAAGAGAAAGACACGTGCGATAACAGTGACCAAAAGTCCT
GTTCCGATTCTTTAAACTCAAATAAAACTGATACTCGGGATAACAAAAAT
ACCGAGGCCTCGCCTGACTGCGGCCGGCAGCAGCCACATTTGATAAATCA
AACAAATAACATGTGCAAATCGAAAGAAAATCAAAAATCGGAAGAAAATT
CTAATAATAAATAAAATTAAGAATAAATTGTTTTTGTTTTTGATTTTGGT
AATTCCCATTTTCGCTGGAATCAAATACTTTTGTTATCAGATGTTTGCGA
TTAGGATTTTGTTAATGTTTATTTGTTTTGTTGATAAGTTTAGCTGAAAA
TTCTAAATAAATAATGGCGGTCCCTCGTTTTGATTCTACATTTTTTATTC
AATTTATTTACCAAAATTACAAATCTATTCAAAACG
back to top

protein sequence of SMED30023936-orf-1

>SMED30023936-orf-1 ID=SMED30023936-orf-1|Name=SMED30023936-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=822bp
MYYYPENVYLNSPCLIGLKLKDKRSQEYLKRFPYYIIKENSSTSQLYFLD
RKNNESVSVIELVAFILENAISIANKQSHNMYPNKFQENIEFNDRTAVVA
IPMFYTQKERQILLEICKLANITVLQLLESNNAASLSIASKYLKRAKISD
IYGVLNVGFESVSMTIFRFEHQQSSFRGYRFDSMNINVLASSYSMDIGVN
KIIEIMRNYFTVQLLQTVKFHPANPISTGKLYMACRRVLRRLISSHSAQV
KINQLFPNKDVVISLNRSKLFVLINKTIKRIEQVVQKTLGNMPQFWNIPK
GIIVIGGGSFIPEIDTLINIFLKRIPILKVLDRFTDIAWGATYKACELVS
GIFYFPLKLEENYFKSIQLILTSGNYKENRKIIKLKNNIKLSSHLIRNLT
SNFQLEIRFIPIAATGLSEIEVPKIVYNVDVSDYKTTIENIIRNHQKSVE
ISNFTESFIYKGVRVMHSVDNNFIVTLDSIEAIFVRKSLLKLTESDYYED
SLNNSKRIIINATQHEIVKYNIKYKNNEPKKVENFQEIFLKYNRFKKKLE
ESLEKENVKNELEYYTNEMRKNFGDQDYMECTTKYDRELIWSFLEENERF
IRSHPITAVSTPEYLRRFDYIINITSKVEFRVHEQKNRPILMKRLGQILD
TTQHFIMNMFVTSGPSTVSKGLFTSHETKFLRSLNKEITLWFKSANNKLK
AIKPNDDPPVICDEIIDKIKILDKQHKELLNLLAQRTDPSAKNQKNNNQI
ESSPKEKDTCDNSDQKSCSDSLNSNKTDTRDNKNTEASPDCGRQQPHLIN
QTNNMCKSKENQKSEENSNNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR029048HSP70_C_sf
IPR013126Hsp_70_fam
IPR013032EGF-like_CS
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 799..819
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 145..328
e-value: 3.0E-44
score: 153.2
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 4..345
e-value: 3.0E-44
score: 153.2
NoneNo IPR availableGENE3DG3DSA:3.30.30.30coord: 10..65
e-value: 3.0E-44
score: 153.2
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 199..280
e-value: 3.0E-44
score: 153.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 734..821
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 736..750
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 788..808
NoneNo IPR availablePANTHERPTHR45639FAMILY NOT NAMEDcoord: 3..800
NoneNo IPR availablePANTHERPTHR45639:SF3HYPOXIA UP-REGULATED PROTEIN 1coord: 3..800
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 6..345
e-value: 4.4E-16
score: 58.2
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 179..345
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 3..138
IPR029048Heat shock protein 70kD, C-terminal domain superfamilySUPERFAMILYSSF100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 558..638