Netrin-1

Overview
NameNetrin-1
Smed IDSMED30023928
Length (bp)2794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Netrin-1 (SMED30023928) t-SNE clustered cells

Violin plots show distribution of expression levels for Netrin-1 (SMED30023928) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Netrin-1 (SMED30023928) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Netrin-1 (SMED30023928) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023928

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30023928h1SMcG0005293 Contig4339newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023928h1SMcG0005293 Contig4339uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023928h1SMcG0011249 Contig39198uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023928h1SMcG0011249 Contig39198newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023928h1SMcG0011249 Contig4339newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023928h1SMcG0011249 Contig4339uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30023928h1SMcG0011249 dd_Smed_v4_8504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023928h1SMcG0011249 dd_Smed_v4_8504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023928h1SMcG0011249 dd_Smed_v4_8504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30023928h1SMcG0011249 dd_Smed_v4_8504_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023928h1SMcG0011249 dd_Smed_v4_8504_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Netrin-1 vs. Ensembl Human
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 338.191 bits (866), Expect = 2.538e-104
Identity = 208/616 (33.77%), Postives = 315/616 (51.14%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKY-----YSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +G    C P F+N A    + V+S+CG        P  +Y           R C +C+       +    LTD  N  N TCW S   Y Q   N V ++++  K FEV YV+LQFCS  P+S+ IYKS D G+ W+P+Q+YS  C+K +N P     PI +  E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+  SR                  H  G +  + S  + +       +Y VSDL VGGRC+C GH+ +C+ + D ++VCDC+HNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  GYYRD  KP++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K    +    T  S +     +  + +S CK    K K    K   +  +V + ++++ +  G   +F + I  V++      Q  S I +   +  LWI   ++ C CP I   + YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:   45 NGHPRRCIPDFVNAAFGKDVRVSSTCGR-------PPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQS-ENYLQFPHN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRP--HRAPITKQNEQEA--VCTDSHTDMRPLSGG----LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRL-----------------HTFGDENEDDSELARDS-----YFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKI--PVAPPTTAASSVE----EPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKA-GDWWKFTVNIISVYK------QGTSRIRRGDQS--LWIRSRDIACKCPKIKPLKKYLLLGNAE--DSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1 vs. Ensembl Human
Match: NTN3 (netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030])

HSP 1 Score: 292.738 bits (748), Expect = 1.554e-87
Identity = 186/625 (29.76%), Postives = 284/625 (45.44%), Query Frame = 3
Query:  711 LLLGFSFYFSVAISVLYENKQTTC-EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFN-LPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFS----STIGRKMNDTLI--KWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSY----LILMKYKIYHHRHREELLLDSRTVMLQWRPSW 2549
            LLL     F+ A+S         C +  G    C P  +N A   ++  +S+CG                        CD       +S   LT P    +  CW S     +  LN V +++   K FE+ +V+L+FCS  P S+ + KS D+G+ W P  ++S +C   +  LP     P   G E      CF     Q DG+      +L FS    S  G  ++ + +   W+T TD+R+ L+R     S+  D            RD+  +  +S          Y  +DL VGGRC+C GH+++C+++  G+++CDC+H TEG DC +CK  + D  W+RA+     +C  C CN H++ C+F   +Y  +G++SGGVC  C+HNTAG  CH+C  G+YRD  + LS   AC+ C CH VG+    +C++  GQC CK+GV G  C++C  G+ Q+RS + PCVKT   I       S +  +  D     S CKP     +    K   +  +V + V    E  G   RF + +  V+R          E    + +  LW+   +  C CP +  GR Y                    L+    +++L WR +W
Sbjct:    8 LLLTAGTLFA-ALSPGPPAPADPCHDEGGAPRGCVPGLVNAALGREVLASSTCGRPA------------------TRACDASDPRRAHSPALLTSPGGTASPLCWRSE-SLPRAPLN-VTLTVPLGKAFELVFVSLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPANGPAGPGPEA----LCFPAPLAQPDGS-----GLLAFSMQDSSPPGLDLDSSPVLQDWVTATDVRVVLTR----PSTAGDP-----------RDMEAVVPYS----------YAATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRATARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRALSDRRACRACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKT--PIPGPTEDSSPVQPQDCD-----SHCKPARGSYRISLKKFCKKDYAVQVAVGARGEARGAWTRFPVAVLAVFRS--------GEERARRGSSALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAGGRGPGLIAARGSLVLPWRDAW 561          
BLAST of Netrin-1 vs. Ensembl Human
Match: LAMC1 (laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:6492])

HSP 1 Score: 217.624 bits (553), Expect = 1.898e-57
Identity = 141/445 (31.69%), Postives = 214/445 (48.09%), Query Frame = 3
Query:  792 GKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNH---VNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQ-TRSMLKPC 2096
            G+   C P F+N A    +  T++CG   P++ C       +   + C +CD  + +  +    LTD  NQ + T W S  +    G+ +   +N+++   K F++ YV L+F +  P+S  IYK       WIP+QYYS +C+  ++             + +L    F        GN+        FS+  GR        +  L +W+T TD+R+TL+R                  +  G ++ N      + K +   YY +SD +VGGRC+C GH+++C+ N    +VC+CKHNT G DC+KC   F+D  W RA+  +   C  C CN  SQ C F+  +Y  TG   GG C  CQ NT G  C  C   ++R     L ++ AC  C C  VGS +   CD   G+C CK GV+G KCD+C+ G+   T +  +PC
Sbjct:   45 GRPQRCMPEFVNAAFNVTVVATNTCG-TPPEEYCVQTGV--TGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTML--AGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVA-------FSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRL-----------------NTFGDEVFN------DPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGH--GGHCTNCQDNTDGAHCERCRENFFR-----LGNNEACSSCHCSPVGSLST-QCD-SYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPC 445          

HSP 2 Score: 68.1662 bits (165), Expect = 7.092e-11
Identity = 51/175 (29.14%), Postives = 73/175 (41.71%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLA---CKKCKCHA-VGSTNVNSCDKKLGQCF-CKEGVIGRKCDKCKIGYLQTRSMLKPCVK 2102
            C C GHS  C   +    VC+C+ NT G  C+KC +G++       S      C+ C C   S      K   +        VC  C   T G +C  CD+GY+ D   PL  +     C+ C+C   +    V +C++  G+C  C     G  CD+CK G+        P  K
Sbjct:  724 CACNGHSETC---DPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSS----DCQPCPCPGGSSCAVVPKTKEV--------VCTNCPTGTTGKRCELCDDGYFGD---PLGRNGPVRLCRLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADK 880          

HSP 3 Score: 68.1662 bits (165), Expect = 7.918e-11
Identity = 54/183 (29.51%), Postives = 81/183 (44.26%), Query Frame = 3
Query: 1548 SKVYYGVSDLSVGGRCQ---CYGHSNKCIINNDGNIVC-DCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGST-NVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRS 2081
            S  YYG S       CQ   C G S+  ++     +VC +C   T G  C+ C +G+      R   +    C+ CQC+ +      + N      + +G  C KC +NTAG  C  C +G++ +   P   D  CK C C+  G+    +SC+   GQC C   V G+ C  C  G+   +S
Sbjct:  755 SDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVR--LCRLCQCSDN-----IDPNAVGNCNRLTG-ECLKCIYNTAGFYCDRCKDGFFGNPLAPNPAD-KCKACNCNLYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGFYNLQS 928          

HSP 4 Score: 63.5438 bits (153), Expect = 1.762e-9
Identity = 47/141 (33.33%), Postives = 59/141 (41.84%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYL 2069
            C C     G  C+ C  G+          L P+S C  C CN HS+ C  E            GVC  C+ NTAG  C  C +GYY D T   S D  C+ C C    S  V    K++    C  G  G++C+ C  GY 
Sbjct:  690 CTCPVGYGGQFCEMCLSGYR----RETPNLGPYSPCVLCACNGHSETCDPET-----------GVC-NCRDNTAGPHCEKCSDGYYGDSTAGTSSD--CQPCPCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYF 812          

HSP 5 Score: 63.5438 bits (153), Expect = 2.141e-9
Identity = 59/214 (27.57%), Postives = 83/214 (38.79%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCK---HNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFC-----------------------------------------------KEGVIGRKCDKCKIGYLQTRS 2081
            CQC  + +   + N   +  +C    +NT G  CD+CK+GF    +      NP   CK C CNL+    K + +    TGQ     C +C  +  G  C  CD G+Y      L     C++C CHA+GSTN   CD + GQC C                                               +EG +G +CD+C+  Y   RS
Sbjct:  828 CQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGF----FGNPLAPNPADKCKACNCNLYGTM-KQQSSCNPVTGQ-----C-ECLPHVTGQDCGACDPGFYN-----LQSGQGCERCDCHALGSTN-GQCDIRTGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRS 1024          
BLAST of Netrin-1 vs. Ensembl Human
Match: LAMC3 (laminin subunit gamma 3 [Source:HGNC Symbol;Acc:HGNC:6494])

HSP 1 Score: 201.06 bits (510), Expect = 4.200e-52
Identity = 131/433 (30.25%), Postives = 197/433 (45.50%), Query Frame = 3
Query:  792 GKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGP--VYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGR------KMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY 2066
            G+   C P F N A       + +CG   P+D CPH     +     C  CD       ++   LTD  +  + + W+  P   +       VNI++   K +E+ YV L+F +  P+S  IYK       W P+Q+YS +CQK +  P  Q     E    +   + F        GN+        FS+  GR      + +  L +W+T T+L I+L    D+++++ D             DI        + K +   YY VSD SVGGRC+C GH+++C  +  G + C C+HNT G DC++C   F D  W R +      C  C C+  S+ C F++ ++  TG   GG C  C+ +TAG  C  C   +Y  W       + C+ C C + GS ++  CD   G C CK  V G KCD+C  G+
Sbjct:   30 GRPQRCLPVFENAAFGRLAQASHTCGSP-PEDFCPHVGAAGAGAH--CQRCDAADPQRHHNASYLTD-FHSQDESTWWQSPSMAFGVQYPTSVNITLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLRPGEDERVAFCTSEFSDISPLSGGNVA-------FSTLEGRPSAYNFEESPGLQEWVTSTELLISL----DRLNTFGD-------------DIFK------DPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTDCERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGH--GGRCHHCRDHTAGPHCERCQENFYH-WDP----RMPCQPCDCQSAGSLHLQ-CDDT-GTCACKPTVTGWKCDRCLPGF 419          

HSP 2 Score: 73.9442 bits (180), Expect = 1.344e-12
Identity = 53/166 (31.93%), Postives = 77/166 (46.39%), Query Frame = 3
Query: 1590 RCQCYGHSNKCIINN----DGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQ-CNLHSQHCKFEK-NVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYL 2069
            +CQC G+ +   + N     G+ +  C HNT G  C+ C+EGF+       S L P    +C  C+ H Q    E+      TGQ S      C  +     C  C  G++      L     C+ CKCH +GS   + C  K GQC C+ GV G+ CD+C++G+ 
Sbjct:  809 QCQCSGNVDPNAVGNCDPLSGHCL-RCLHNTTGDHCEHCQEGFY------GSALAPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCS------CLPHVTARDCSRCYPGFFD-----LQPGRGCRSCKCHPLGSQE-DQCHPKTGQCTCRPGVTGQACDRCQLGFF 955          

HSP 3 Score: 66.2402 bits (160), Expect = 3.009e-10
Identity = 47/179 (26.26%), Postives = 69/179 (38.55%), Query Frame = 3
Query: 1602 YGHSNKCIINNDGNI-----VCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFS-----CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHA-VGSTNVNSCDKKLGQCF-CKEGVIGRKCDKCKIGYLQTRSMLKPCVK 2102
            Y     C  N  G       +C C H+TEG  C++C  GF+          NPF+     C+ C C   S      ++  +        VC  C     G +C  CD+G++ D      H   C +C+C   V    V +CD   G C  C     G  C+ C+ G+  +    +P  K
Sbjct:  701 YASCVPCTCNQHGTCDPNTGICVCSHHTEGPSCERCLPGFYG---------NPFAGQADDCQPCPCPGQSACTTIPESREV--------VCTHCPPGQRGRRCEVCDDGFFGDPLGLFGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTTGDHCEHCQEGFYGSALAPRPADK 862          

HSP 4 Score: 57.3806 bits (137), Expect = 1.661e-7
Identity = 46/165 (27.88%), Postives = 70/165 (42.42%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCN-LHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTR--SMLKPCVKTYDIIESSQTK 2135
            C C  +    DC +C  GF DLQ  R        C+ C+C+ L SQ    E   + KTGQ +      C+    G  C  C  G++    K       C+ C+C  +G+ +   C +  G C C+ G  G KCD+C   +  T   +  + C   Y +++    K
Sbjct:  887 CSCLPHVTARDCSRCYPGFFDLQPGRG-------CRSCKCHPLGSQ----EDQCHPKTGQCT------CRPGVTGQACDRCQLGFFGFSIK------GCRACRCSPLGAASAQ-CHEN-GTCVCRPGFEGYKCDRCHDNFFLTADGTHCQQCPSCYALVKEEAAK 1026          
BLAST of Netrin-1 vs. Ensembl Human
Match: NTN5 (netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208])

HSP 1 Score: 184.882 bits (468), Expect = 1.214e-49
Identity = 99/338 (29.29%), Postives = 164/338 (48.52%), Query Frame = 3
Query: 1587 GRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCE 2600
            GRCQC+GH+ +C           C+H+T G  C+ C+    D  W  A+  +P  C  C CN H++ C+F   ++  +G +SGGVC +C+H+TAG  CH+C  G++RD ++P+    AC+ C+CH +G+T   +C++  GQC CK GV G  C++C  GY Q+RS   PC +    I  + T  +     Y   P  ++ C   D +      +   +   +   V+ S+       R  +++  V++   + +Q +    Q+      W+   ++ C C  +  G  YL+L             L+LD   + L WRP W R L++ Q +     C 
Sbjct:  155 GRCQCHGHAARCAARARPPRC-HCRHHTTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPIGATG-GTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQR----IPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSLRRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYK---QRAQPVRRGDQDA-----WVPRADLTCGCLRLQPGTDYLLLG--SAVGDPDPTRLILDRHGLALPWRPRWARPLKRLQQEERAGGCR 476          
BLAST of Netrin-1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 332.413 bits (851), Expect = 1.822e-102
Identity = 196/653 (30.02%), Postives = 315/653 (48.24%), Query Frame = 3
Query:  696 LFNSILLLGFSFYFSVAIS--------VLYENKQTTCEFH-GKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKT---YDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKK 2618
            +  S+L    + YF + I+         +       C  H G+   C P FIN A    +  + +CG   PD  C   +         C  CD       +    LTD  +  N TCW S P  +     +V+++++  K FE+ YV++ FCS LPDS+ +YKS D GK W P+Q+YS  C++ F   P  +  I +  E      C   +     GN      +    S    + +  L  W+T TD+++  SR     +  +              + +N      +D+   + +Y + +L+VGGRC+C GH+++CI +  G   CDCKHNT G +C+ CK   +D  W RA+  +  SC  C CN H++ C+F+  ++  +G +SGGVC  C+HNTAG  CH C  G+ RD + P++H  ACK C CH VGS    SC++  GQC CK GV G  C++C  GY Q+RS + PC+K     D I SS +++ D  SK   +P   ++ K C               D     V+ S+E+     ++++ ++ V++   +        + ++    LWIS + V C CP + +GR YL+L K    H   R+ L+++ +TV+++W      ++ +F  K    +C +    +
Sbjct:    1 MITSVLRYVLALYFCMGIAHGAYFSQFSMRAPDHDPCHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVSTPSLSPQ---NVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRDP--DVSITKSNEQEA--VCTASHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTATDIKVVFSRLSPDQAELYGLS-----------NDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLG-KSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKR-------------DHAVQMVVVSREMVDGWAKYKIVVESVFKRGTE--------NMQRGETSLWISPQGVICKCPKLRVGRRYLLLGKNDSDH--ERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHR 611          
BLAST of Netrin-1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 332.413 bits (851), Expect = 1.822e-102
Identity = 196/653 (30.02%), Postives = 315/653 (48.24%), Query Frame = 3
Query:  696 LFNSILLLGFSFYFSVAIS--------VLYENKQTTCEFH-GKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKT---YDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKK 2618
            +  S+L    + YF + I+         +       C  H G+   C P FIN A    +  + +CG   PD  C   +         C  CD       +    LTD  +  N TCW S P  +     +V+++++  K FE+ YV++ FCS LPDS+ +YKS D GK W P+Q+YS  C++ F   P  +  I +  E      C   +     GN      +    S    + +  L  W+T TD+++  SR     +  +              + +N      +D+   + +Y + +L+VGGRC+C GH+++CI +  G   CDCKHNT G +C+ CK   +D  W RA+  +  SC  C CN H++ C+F+  ++  +G +SGGVC  C+HNTAG  CH C  G+ RD + P++H  ACK C CH VGS    SC++  GQC CK GV G  C++C  GY Q+RS + PC+K     D I SS +++ D  SK   +P   ++ K C               D     V+ S+E+     ++++ ++ V++   +        + ++    LWIS + V C CP + +GR YL+L K    H   R+ L+++ +TV+++W      ++ +F  K    +C +    +
Sbjct:    1 MITSVLRYVLALYFCMGIAHGAYFSQFSMRAPDHDPCHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVSTPSLSPQ---NVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRDP--DVSITKSNEQEA--VCTASHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTATDIKVVFSRLSPDQAELYGLS-----------NDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLG-KSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKR-------------DHAVQMVVVSREMVDGWAKYKIVVESVFKRGTE--------NMQRGETSLWISPQGVICKCPKLRVGRRYLLLGKNDSDH--ERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHR 611          
BLAST of Netrin-1 vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 197.978 bits (502), Expect = 1.525e-51
Identity = 133/434 (30.65%), Postives = 210/434 (48.39%), Query Frame = 3
Query:  807 CTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNH---VNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTC-FDLNQKQKDGNLGQAESILPFSSTIGR------KMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCI----INNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY 2066
            C P F+N A   ++ VT++CG   P   C    +        C  CD+  +   +  K LTD  N  N+  W+      Q G  +    N+++   K+F++ YV L+F S  P+S TIYK      +W PWQ+YS +C+  + L  +   PI  G E +   T  F        GN+        FS+  GR      + ++ L KW+T + +RI+L+R    M+++ D                    F  + + +   YY +SD +VGGRC+C GH+++C+    ++ +  +VC C+HNT+GADC++C   ++D  W   + +    C  C C+  S  C F++ ++ +TG   GG C  CQ NT G  C  C       W +P  +   C  C C+ +GS +   CD + G+C CK GV GR CD+C  G+
Sbjct:   51 CVPDFVNAAFNLEVQVTNTCGTKRPTKFCVQSGHTGQRSV--CETCDDRHEGFSHPAKYLTD-FNVGNNETWWQSDTM-QEGQQYPTTTNLTLVLGKSFDITYVRLKFISPRPESFTIYKKTHTDSEWEPWQFYSGSCRATYGL--SDRAPILPGNEATAQCTKEFSDISPITGGNIA-------FSTLEGRPSAHAFEESEVLQKWVTASAIRISLNR----MNTFGD------------------EVFK-DPQVLRSYYYAISDFAVGGRCKCNGHASECVGSSSVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEETGH--GGHCIDCQGNTQGVHCEQC---IANHWRRPGEN--YCVACGCNEIGSLST-QCDNE-GKCQCKPGVTGRFCDQCLDGF 439          

HSP 2 Score: 73.1738 bits (178), Expect = 8.161e-13
Identity = 50/158 (31.65%), Postives = 73/158 (46.20%), Query Frame = 3
Query: 1590 RCQCYGHSNKCIINNDGNIVCDCKH---NTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKC 2054
             C C G+++   I N   I  +CK    NT G +C+ CK G+    W  A      +C+ C C              ++  Q+ G     C  N  G QC  C +G+Y      ++  L C++C C  +GS   N+CD   GQC CK GV G++CD+C
Sbjct:  834 ECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGY----WGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQC--DCLPNVIGIQCDQCAHGFYN-----ITSGLGCQECNCDPLGSEG-NTCDVNTGQCQCKPGVTGQRCDRC 979          

HSP 3 Score: 65.855 bits (159), Expect = 1.501e-10
Identity = 50/153 (32.68%), Postives = 69/153 (45.10%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLN-PFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVK 2102
            C+C     G  C+ C+ GF      R +K   PF+ C +C C+ HS  C+ E            G C  C+HNTAG+ C  C  GYY D  +    D  C+KC C   G   +++ D  +    C  G  GR+CD+C  GY         CV+
Sbjct:  702 CECLPGFVGQFCESCESGFR-----RETKFGGPFNHCIKCDCHNHSNSCEAES-----------GSC-ICEHNTAGDTCERCARGYYGDALQGTEED--CQKCPCPNDGPCILHA-DGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVE 834          

HSP 4 Score: 62.003 bits (149), Expect = 2.148e-9
Identity = 59/217 (27.19%), Postives = 85/217 (39.17%), Query Frame = 3
Query: 1590 RCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCN------LHSQH---CKFEKNVYM---------------KTG--------------------QKSGGVCRKCQHNTAGNQCHFCDNGYYRD-WTKPLSHDLACKKCKCHAVGSTNVNS------CDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSML 2087
            +C C+ HSN C   +     C C+HNT G  C++C  G++    +   +     C++C C       LH+     C    N Y                K G                     K  G C+KC  NT G  C  C  GY+ D   +P  +   C+ C C A G+   N+      C+++ GQC C   VIG +CD+C  G+    S L
Sbjct:  735 KCDCHNHSNSCEAESGS---CICEHNTAGDTCERCARGYYGDALQGTEE----DCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGN---CQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSGL 941          
BLAST of Netrin-1 vs. Ensembl Celegans
Match: lam-3 (LAMinin related. See also lmb; Laminin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5ECE3])

HSP 1 Score: 163.31 bits (412), Expect = 1.900e-40
Identity = 128/457 (28.01%), Postives = 211/457 (46.17%), Query Frame = 3
Query:  813 PPFINIAQRAKITVTSSCGEILPDDICPHWKYY-----SSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFC-SELPDSITIYKSHDNGKKWIPWQYYS---KNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRK-MNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINN-DGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHC----KFEKNVYMKTGQ---KSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSH--DLACKKCKCHAVGSTNVNSC---------DKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPC 2096
            P   N+A  + IT T +CG+   ++ C   ++      ++     C ICD +  +  + I+   D   ++    W S  + N      VNI+I  ++ ++V Y+ L+   S  P +  + KS D G+ + PWQYY+     C + F +P T   P      +         ++  K   L   E  +  S   GR    +T ++    T  R    R     +   D     L+       I+N  + S++     + +Y +SD+S+GG+C CYGH+  C  +   G   C+C+HNT G  C++C   F+ L W+  +  +P  C++CQC  H+  C    + ++N +  T +   + GG C +C HNT G  C  C +GYYR     LSH  + AC+ C+C  VGS + ++C          +K G C CK G  GR+C++C  GY +     +PC
Sbjct:   50 PNIFNLATNSLITATDTCGQYTAEEYCKLVEHVLLRKTTNTQSPQCDICDANNVHKRHPIEYAIDGTRRW----WQSPSLANGLRFEKVNITIDLRQEYQVAYIILKMGNSPRPGTWVLEKSLD-GEYYEPWQYYAMQDAECMRQFGIPATTGVP-----RFQKEDEVHCTSEYSKITPLENGE--IHTSLVNGRPGAENTSLELQKFTRARFVRLRLISPRTLNAD-----LM-------IINKKSDSLDKSVTMRYFYSISDISIGGQCICYGHAESCPSDPVTGQFKCECRHNTCGESCNRCCPLFNQLPWKPGTNSHPNVCQQCQCFNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYYR--PSGLSHYREDACRTCECDPVGSVS-DACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGY-RNHPTCEPC 478          

HSP 2 Score: 77.7962 bits (190), Expect = 3.167e-14
Identity = 54/155 (34.84%), Postives = 73/155 (47.10%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCK 2057
            C C+GHS  C  N D ++  DC+HNT G  C+ C  G+     E  +     +C +C C L  ++   +  V +  G+  G VC  C+    G  C  C  GYY D   P      C  C CH  GS +  +C+   GQC CK GV GR C  C+
Sbjct: 1540 CSCHGHSQTC--NPDTSVCTDCEHNTFGDFCEHCLPGYIGDAREGGAN----ACTKCACPL-VENSFSDSCVAVDHGR--GYVCNSCKPGYTGQYCETCVAGYYGD---PQHIGGTCSPCDCHPDGSLH-GACNPLSGQCECKPGVTGRTCSMCQ 1681          

HSP 3 Score: 72.4034 bits (176), Expect = 1.718e-12
Identity = 53/182 (29.12%), Postives = 84/182 (46.15%), Query Frame = 3
Query: 1590 RCQCYGHSNKCIINND----------------GNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPF---SCKRCQCNLH---SQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYL 2069
            +CQC+ H++ C+ +++                G    +C HNTEG +C++CK+G++     R S L+ +   +C+ C+C+     S  C    +   + GQK G     C+    G +C  C  GY    T        C+ C C+  GS N ++CD     C CK  V G  CD+CK G +
Sbjct:  352 QCQCFNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYY-----RPSGLSHYREDACRTCECDPVGSVSDAC-VRDDQSAENGQKPGDCI--CKPGFGGRRCERCAPGYRNHPT--------CEPCPCNRAGSVNFDTCDG--ASCQCKANVEGIYCDRCKAGTI 515          

HSP 4 Score: 64.6994 bits (156), Expect = 3.883e-10
Identity = 50/175 (28.57%), Postives = 72/175 (41.14%), Query Frame = 3
Query: 1557 YYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRS 2081
            ++G + L     C C+         ++ N  C+CK N  GA CD+CKE   D++           C  C CN        +         +  G C  C+    G QC  C   Y+ ++T     D  C+ C C+  GS     CD+  G+C C+E V G  C+KC  GY    S
Sbjct:  929 HWGNAQLHTCKPCGCHTQGAVNPQCSEENGECECKENYIGAQCDRCKENHGDVE---------NGCPACDCN--------DTGSIGSDCDQVSGQC-NCKQGVFGKQCDQCRPSYF-NFT-----DAGCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGYFNITS 1079          

HSP 5 Score: 63.929 bits (154), Expect = 6.077e-10
Identity = 41/137 (29.93%), Postives = 63/137 (45.99%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQ--KSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKC 2054
            C+CK    G  CD+C+  + +             C+ C CN++           ++ G+  ++ G C +C+ N  G  C  C +GY+      ++    C+ C C   GS +V SC+   GQC CK GV G KCD C
Sbjct: 1007 CNCKQGVFGKQCDQCRPSYFNF--------TDAGCQFCHCNIYGS---------IEDGKCDQTTGKC-ECRENVEGTMCEKCADGYFN-----ITSGDGCEDCGCDPTGSEDV-SCNLVTGQCVCKPGVTGLKCDSC 1119          

HSP 6 Score: 62.003 bits (149), Expect = 2.196e-9
Identity = 51/178 (28.65%), Postives = 83/178 (46.63%), Query Frame = 3
Query: 1557 YYGVSDLSVGGRCQ---CYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQC-----NLHSQHCKFEKNVYMKTGQKSGG-VCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHA-VGSTNVNSCDKKLGQCF-CKEGVIGRKCDKCK 2057
            Y  V++   GGRC+   C+G+S +C  +       +C+HNT G+ C+ CK G H     R  +L   +C++C+C     N + +    E  V           VC  C     GN+C +C +G++ D   PL+    C +C C+  +    + +CD + G+C  C     G  C+ CK
Sbjct:  759 YRRVNNQLYGGRCEKCDCHGNSEEC--DPFTGECLNCRHNTTGSRCELCKPG-HVGNPSRGGELG--ACEQCECPSLDLNPNPECISTELAVLGSVASNEDNYVCINCPLGYEGNKCEYCSDGFFED---PLTG--KCIECTCNGNIDPMGIGNCDSETGKCLKCIGHTTGDSCESCK 926          

HSP 7 Score: 52.7582 bits (125), Expect = 1.545e-6
Identity = 47/170 (27.65%), Postives = 68/170 (40.00%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASK---LNPFSCKRCQCNLHSQHCKFEKNV------------YMKTGQ---------KSGGVCRK------CQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYL 2069
            C+C+ N EG  C+KC +G+ ++      +    +P   +   CNL +  C  +  V            Y  T +           G VC        C  NT G  C  C    + D+  PL+    CK C C  +GS +   C+   GQC CK   +G KCD C  G+ 
Sbjct: 1056 CECRENVEGTMCEKCADGYFNITSGDGCEDCGCDPTGSEDVSCNLVTGQCVCKPGVTGLKCDSCLPNFYGLTSEGCTECEPCPAPGQVCDPIDGSCVCPPNTVGEMCENCTTNAW-DY-HPLN---GCKLCDCSDIGS-DGGMCNTFTGQCKCKAAYVGLKCDLCTHGFF 1219          
BLAST of Netrin-1 vs. Ensembl Celegans
Match: lam-1 (LAMinin related. See also lmb [Source:UniProtKB/TrEMBL;Acc:V6CIX7])

HSP 1 Score: 162.54 bits (410), Expect = 2.642e-40
Identity = 111/378 (29.37%), Postives = 176/378 (46.56%), Query Frame = 3
Query: 1041 NQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKY---FLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCI----------INNDGNIV---CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKK--------LGQCFCKEGVIGRKCDKCKIGYLQ-TRSMLKPCV 2099
            +++G  +V+IS   +  F   ++ + F S  P ++ I +S D GK W  ++Y++ +C  +F  P   E P ++  +   +                Q   + P  ST G       I +  I+   +T + + D++S+          F   H  G D+L+        +   K YY + ++ V G C CYGH+++CI          +    +IV   C+C HNTEG +C+KCK  ++DL W  A       C++C CN H+  C F++ VY  +G  SGGVC  C HNT G  C  C   +YRD  + +     C  C+C   GS N   C+ +         G+C+CK  V G +CD+CK GY   T + +  CV
Sbjct:  118 SENGAQNVSISFDLEAEFHFTHLIMTFKSFRPAAMIIERSADFGKTWQVYRYFAYDCDSSF--PGIPEGPPKKHTDVICT---------------SQYSDVAP--STGGE------IVYKVISPHIVTENPYADEISTLLKITNLRFNFTKLHTLGDDLLDYRP-----EIDEKYYYAIYEIVVRGSCSCYGHASRCIPIDPHVSPNTVMERADIVHGRCECMHNTEGLNCEKCKAFYNDLPWRPAIGDEKNECRQCNCNRHALRCHFDRAVYESSGFVSGGVCDDCMHNTQGKNCEQCKPFFYRDPRRTIDDPHVCLPCECDKAGSQNKGICEGEEDAERGLVAGKCYCKTNVDGNRCDRCKNGYWNLTETNVDGCV 465          

HSP 2 Score: 82.8037 bits (203), Expect = 1.007e-15
Identity = 58/181 (32.04%), Postives = 88/181 (48.62%), Query Frame = 3
Query: 1557 YYGVSDLSVGGRCQ----------CYGHSNKCIINNDGN----IVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNV-NSCDKKLGQCFCKEGVIGRKCDKC 2054
            YYG   L VG  C+           Y H++ C + N GN    IVC+CK   +G  C +C +      W    ++   +C+RC CN +      E +    TG+     C KC H+T G QC  C +GYY D     +    C++C C+ +G+ +   +CD+  GQC C + +IG +CD+C
Sbjct:  909 YYGDPRLGVGIPCKPCPCPGGPTSGYQHADTCYLRNSGNNTQDIVCNCKSGYQGERCGECAQN----HWGSPREVGG-TCERCDCNGNIDM-AMEGSCDAATGE-----CLKCLHHTEGAQCEHCVDGYYGD-----AKLKTCQRCVCNELGTNSTKGACDRVSGQCPCHDNIIGMQCDQC 1073          

HSP 3 Score: 56.225 bits (134), Expect = 1.137e-7
Identity = 47/135 (34.81%), Postives = 62/135 (45.93%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTG-QKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLS-HDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCD 2048
            C CK N +G  CD+CK G+ +L     ++ N   C  C CNL           Y   G  K  G+C  C+    G  C  C   +Y      LS H   CK C C   GS + N+C+   GQC C+EG  GR+C+
Sbjct:  435 CYCKTNVDGNRCDRCKNGYWNL-----TETNVDGCVACTCNLLG--------TYNNEGCDKYTGMC-TCKRLVTGENCDQCLPEHY-----GLSEHVDGCKACDCDIGGSYD-NTCEITTGQCKCREGFSGRRCE 549          

HSP 4 Score: 53.9138 bits (128), Expect = 7.510e-7
Identity = 47/186 (25.27%), Postives = 78/186 (41.94%), Query Frame = 3
Query: 1557 YYGVSDLSVGGRCQC--YGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTY 2108
            YYG + L    RC C   G ++     +  +  C C  N  G  CD+C E   +L        +   C+ C C+ +      E   +++     G    +C+    G +C  C++ Y+ D T P      C +C+C+  GS ++  C +  G C C+ G  G  C++C  GY        PC + +
Sbjct: 1026 YYGDAKLKTCQRCVCNELGTNSTKGACDRVSGQCPCHDNIIGMQCDQCAENHFNL-------ASGAGCEACGCDSNGVVLNHEGVPHLQCNIFDGQC--QCKPGRGGRKCDQCEDLYWGDPTTPD----GCHRCECNPTGSKSLQ-CHRNNGTCECQAGSGGALCNECARGYTGQWPYCNPCGECF 1197          

HSP 5 Score: 51.2174 bits (121), Expect = 4.791e-6
Identity = 73/362 (20.17%), Postives = 130/362 (35.91%), Query Frame = 3
Query: 1077 AFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYY--------SKNCQKAFNLPPTQEFPI------------------QEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRI--TLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYY---GVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCF-CKEGVIGRKCDKCKIGY 2066
             F +  E   + +    E+     +   HD  +  + W+          ++      + PP+ +F I                  + G++Y L       N+K+ + +        P        + D+++     ++L I    +R +  ++ Y  Y    L         L++S F      + + Y      + L+    C C    +   I N     C+CK N  G  CD+C  G +           P  CK+C C+          +   ++GQ    VCR  +    G QC+ C  G+   W  P      C+ C+C+     + N CD+  G C  C++   G  CD+C+ GY
Sbjct:  595 GFAQAVEGTIITVNPIVEVSQKYNVIIRHDGARDPVGWENIQITVVRPEAEGDGSCSDAPPSDDFLIARIYPGSRYIEVQPAICLEAGVQYELR---IQFNEKRGNSH--------PQERAAANILIDSILLAPPTSELHIFQGSARAEQHLTEYNRYQCRHL--------ALSLSLFKDQRNEVCERYVCPIAAALLNKTSECNCDATGSVSGICNVQGGQCECKPNVVGRRCDQCAIGTY--------GFGPSGCKKCDCDAVG---SLGNDCDKQSGQ---CVCR--EKGIYGRQCNQCQPGF---WGFP-----ECRTCQCN----DHANICDQSSGACIECRDLTTGHYCDRCQDGY 909          
BLAST of Netrin-1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0308337)

HSP 1 Score: 283.108 bits (723), Expect = 1.903e-83
Identity = 161/452 (35.62%), Postives = 231/452 (51.11%), Query Frame = 3
Query:  807 CTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFC--SELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMN------DTLIKWITITDLRIT---LSRFDDQM--------SSYFDYGKYFL-LKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVK 2102
            C P F+N A  A +  +S+CG       C +      +H R C  CD       +  +SLTD  N  N TCW S PV      ++V ++++  K FE+ YV LQ C  +  PDS+ IYKS D+G  W P+Q++S  C++ F  P  Q      G        C D+ +           S + FS+  GR  +        L  W+T TD+R+    L R D Q         ++    GKY + L +    + +  +       S S ++Y +SD SVGGRC+C GH++KC  +  G + C+C HNT G DC++CK    D  W RA+      CK C CN H++ C+F   ++  +   SGGVC+ C+H+T G  CH C  G+YRD TKPL+H   CK C CH +GS+    C+   GQC CK+GV G  C++C  GY Q+RS + PC+K
Sbjct:   50 CIPDFVNAAYDAPVVASSTCGSSGAQRYCEY-----QDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSG--DNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQS----TGRHNEHEARCSDVTRP--------LVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSG-KICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIK 481          
BLAST of Netrin-1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0073942)

HSP 1 Score: 283.493 bits (724), Expect = 5.798e-83
Identity = 161/452 (35.62%), Postives = 231/452 (51.11%), Query Frame = 3
Query:  807 CTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFC--SELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMN------DTLIKWITITDLRIT---LSRFDDQM--------SSYFDYGKYFL-LKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVK 2102
            C P F+N A  A +  +S+CG       C +      +H R C  CD       +  +SLTD  N  N TCW S PV      ++V ++++  K FE+ YV LQ C  +  PDS+ IYKS D+G  W P+Q++S  C++ F  P  Q      G        C D+ +           S + FS+  GR  +        L  W+T TD+R+    L R D Q         ++    GKY + L +    + +  +       S S ++Y +SD SVGGRC+C GH++KC  +  G + C+C HNT G DC++CK    D  W RA+      CK C CN H++ C+F   ++  +   SGGVC+ C+H+T G  CH C  G+YRD TKPL+H   CK C CH +GS+    C+   GQC CK+GV G  C++C  GY Q+RS + PC+K
Sbjct:   50 CIPDFVNAAYDAPVVASSTCGSSGAQRYCEY-----QDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSG--DNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQS----TGRHNEHEARCSDVTRP--------LVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSG-KICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIK 481          
BLAST of Netrin-1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0346088)

HSP 1 Score: 283.493 bits (724), Expect = 5.798e-83
Identity = 161/452 (35.62%), Postives = 231/452 (51.11%), Query Frame = 3
Query:  807 CTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFC--SELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMN------DTLIKWITITDLRIT---LSRFDDQM--------SSYFDYGKYFL-LKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVK 2102
            C P F+N A  A +  +S+CG       C +      +H R C  CD       +  +SLTD  N  N TCW S PV      ++V ++++  K FE+ YV LQ C  +  PDS+ IYKS D+G  W P+Q++S  C++ F  P  Q      G        C D+ +           S + FS+  GR  +        L  W+T TD+R+    L R D Q         ++    GKY + L +    + +  +       S S ++Y +SD SVGGRC+C GH++KC  +  G + C+C HNT G DC++CK    D  W RA+      CK C CN H++ C+F   ++  +   SGGVC+ C+H+T G  CH C  G+YRD TKPL+H   CK C CH +GS+    C+   GQC CK+GV G  C++C  GY Q+RS + PC+K
Sbjct:   50 CIPDFVNAAYDAPVVASSTCGSSGAQRYCEY-----QDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSG--DNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQS----TGRHNEHEARCSDVTRP--------LVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSG-KICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIK 481          
BLAST of Netrin-1 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0345031)

HSP 1 Score: 214.542 bits (545), Expect = 8.718e-57
Identity = 138/437 (31.58%), Postives = 225/437 (51.49%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYN--QHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSR---FDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCI----INNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQ 2072
            +G+   C P FIN A + +I  T++CGE   +  C   +  + NH ++C  C  +  N  +    LTD  +  + T W S  ++   QH  N+VN+++   K++++ YV + F S  P+S TIYK       WIP+Q+YS  C+  ++LP ++     EG  ++L  + +      +DG +  + ++    S I  + +  L +W+T TD+RITL R   F D++     +G   +LK                       +Y +SD++VG RC+C GH++KC+    ++ +  +VC+C+HNT+G DCD+C   ++DL+W+R++      CK C CN  +  C F+ N++ +TG   GG C  C+ N  G  C  C   +Y      +  D  C  C C  VGS ++  C+   G+C CK GV G KCD+C   Y Q
Sbjct:   61 YGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFC--IQTMNQNH-KNCEFCKYNDHNPSF----LTDLHDPQSPTWWQSETMFEGIQH-PNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFS-TLEGRPSGINFERSGELQEWVTATDIRITLDRLNTFGDEL-----FGDSQVLK---------------------SYFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLFNRTGH--GGHCLDCRENRDGPNCERCKENFY------MRDDGYCVNCACDPVGSRSL-QCNSH-GKCQCKPGVTGDKCDRCDNNYYQ 452          

HSP 2 Score: 82.8037 bits (203), Expect = 1.304e-15
Identity = 66/217 (30.41%), Postives = 98/217 (45.16%), Query Frame = 3
Query: 1464 YGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGG------RCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLA-CKKCKCHAVGST----NVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRS 2081
            +G   +     GR I   +T   N    +K +YG +   +GG      RC C        IN D  I  +C     G+ C++C +GF         ++   +CK C CN +      + N  +    ++ G C KC HNTAG  C  C +G++ D   PL+     C +C C+  G+     ++  CD+  GQC CK  VIGR C +C+ GY   RS
Sbjct:  747 HGHADICDSETGRCICQHNTHGDNCDQCAKGFYGNA---LGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQ--TCKSCDCNGN-----VDPNA-VGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGD---PLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRS 949          

HSP 3 Score: 62.7734 bits (151), Expect = 1.494e-9
Identity = 46/158 (29.11%), Postives = 72/158 (45.57%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCK---HNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCK 2057
            C C G+ +   + N      +C    HNT G  CD+C  G     +     L    C RC C  +    + ++    +  Q +G    +C+ N  G  C  C  GY+      +     C+ C C  VGS N ++CD+  GQC C+ GV+G++CD+C+
Sbjct:  847 CDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSG----HFGDPLALPHGRCDRCSC--YEAGTEQDEQSITRCDQVTGQC--QCKPNVIGRDCGECQPGYFN-----IRSGNGCENCLCDPVGSYN-STCDRYSGQCHCRPGVMGQRCDQCE 990          

HSP 4 Score: 55.0694 bits (131), Expect = 3.351e-7
Identity = 43/159 (27.04%), Postives = 68/159 (42.77%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESS 2126
            C CK N  G DC +C+ G+ +++           C+ C C+            Y  T  +  G C  C+    G +C  C+N +Y   ++       CK C+C   GS     CD+  GQC C + V GR+CD+CK            C   Y++++ +
Sbjct:  926 CQCKPNVIGRDCGECQPGYFNIRSGNG-------CENCLCD--------PVGSYNSTCDRYSGQCH-CRPGVMGQRCDQCENYFYGFSSE------GCKPCECDESGSKGF-QCDQN-GQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDA 1060          
BLAST of Netrin-1 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0076382)

HSP 1 Score: 214.542 bits (545), Expect = 8.718e-57
Identity = 138/437 (31.58%), Postives = 225/437 (51.49%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYN--QHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSR---FDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCI----INNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQ 2072
            +G+   C P FIN A + +I  T++CGE   +  C   +  + NH ++C  C  +  N  +    LTD  +  + T W S  ++   QH  N+VN+++   K++++ YV + F S  P+S TIYK       WIP+Q+YS  C+  ++LP ++     EG  ++L  + +      +DG +  + ++    S I  + +  L +W+T TD+RITL R   F D++     +G   +LK                       +Y +SD++VG RC+C GH++KC+    ++ +  +VC+C+HNT+G DCD+C   ++DL+W+R++      CK C CN  +  C F+ N++ +TG   GG C  C+ N  G  C  C   +Y      +  D  C  C C  VGS ++  C+   G+C CK GV G KCD+C   Y Q
Sbjct:   61 YGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFC--IQTMNQNH-KNCEFCKYNDHNPSF----LTDLHDPQSPTWWQSETMFEGIQH-PNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFS-TLEGRPSGINFERSGELQEWVTATDIRITLDRLNTFGDEL-----FGDSQVLK---------------------SYFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLFNRTGH--GGHCLDCRENRDGPNCERCKENFY------MRDDGYCVNCACDPVGSRSL-QCNSH-GKCQCKPGVTGDKCDRCDNNYYQ 452          

HSP 2 Score: 82.8037 bits (203), Expect = 1.304e-15
Identity = 66/217 (30.41%), Postives = 98/217 (45.16%), Query Frame = 3
Query: 1464 YGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGG------RCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLA-CKKCKCHAVGST----NVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRS 2081
            +G   +     GR I   +T   N    +K +YG +   +GG      RC C        IN D  I  +C     G+ C++C +GF         ++   +CK C CN +      + N  +    ++ G C KC HNTAG  C  C +G++ D   PL+     C +C C+  G+     ++  CD+  GQC CK  VIGR C +C+ GY   RS
Sbjct:  747 HGHADICDSETGRCICQHNTHGDNCDQCAKGFYGNA---LGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQ--TCKSCDCNGN-----VDPNA-VGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGD---PLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRS 949          

HSP 3 Score: 62.7734 bits (151), Expect = 1.494e-9
Identity = 46/158 (29.11%), Postives = 72/158 (45.57%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCK---HNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCK 2057
            C C G+ +   + N      +C    HNT G  CD+C  G     +     L    C RC C  +    + ++    +  Q +G    +C+ N  G  C  C  GY+      +     C+ C C  VGS N ++CD+  GQC C+ GV+G++CD+C+
Sbjct:  847 CDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSG----HFGDPLALPHGRCDRCSC--YEAGTEQDEQSITRCDQVTGQC--QCKPNVIGRDCGECQPGYFN-----IRSGNGCENCLCDPVGSYN-STCDRYSGQCHCRPGVMGQRCDQCE 990          

HSP 4 Score: 55.0694 bits (131), Expect = 3.351e-7
Identity = 43/159 (27.04%), Postives = 68/159 (42.77%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESS 2126
            C CK N  G DC +C+ G+ +++           C+ C C+            Y  T  +  G C  C+    G +C  C+N +Y   ++       CK C+C   GS     CD+  GQC C + V GR+CD+CK            C   Y++++ +
Sbjct:  926 CQCKPNVIGRDCGECQPGYFNIRSGNG-------CENCLCD--------PVGSYNSTCDRYSGQCH-CRPGVMGQRCDQCENYFYGFSSE------GCKPCECDESGSKGF-QCDQN-GQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDA 1060          
BLAST of Netrin-1 vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 358.607 bits (919), Expect = 3.572e-112
Identity = 212/646 (32.82%), Postives = 322/646 (49.85%), Query Frame = 3
Query:  699 FNSILLLGFSFYFSVAISVLYENKQTTC-----EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            F ++L +   F  S      +   Q T      E  G    C P FIN A   +++V+S CG  +    C   +       R C ICD     + +    LTD  +  N TCW S  +  Q    +V ++++  K FE+ YV+LQFCS  P+S+ IYKS D G+ W P+Q+YS  C++ +N P       Q   E   +    DL           +  ++ FS+  GR        +  L  W+T+TD+R+  SR          + +   +  R   D L          S+   YY V D  VGGRC+C GH+++C+   DG ++C+CKHNTEG +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD  K ++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   I      K + + S   +  + +S CKP     K    K   +  +V + V++ + V G   +F + +  V++  G   +    +        LW+  +++ C CP I +G+ +LIL   +   +  R  L  D  ++++QWR  W RRL+KFQ K  + KC K
Sbjct:    4 FQTLLSMLTVFQASSHSPNPFSGPQVTPTDPCYEETGAARRCIPEFINAAFGQEVSVSSVCGRPV-SRSCSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENL--QSSPLNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGRTWTPYQFYSSQCRRMYNRPNKAAITKQNEQEALCTDGHTDL--------YPLSGGLIAFSTLDGRPSGKDFDSSPVLQDWVTVTDIRVVFSRPQ--------HTRALPMSGRESEDALGAP------GSLPTYYYAVGDFQVGGRCKCNGHASRCVREKDGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKEANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVI------KPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETV-GDWAKFSVSLMSVYKSRGDPLKRGDHM--------LWVHMKDLACKCPRIHMGKRFLILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 608          
BLAST of Netrin-1 vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 358.221 bits (918), Expect = 3.955e-112
Identity = 206/613 (33.61%), Postives = 312/613 (50.90%), Query Frame = 3
Query:  783 EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            E  G    C P FIN A   +++V+S CG  +    C   +       R C ICD     + +    LTD  +  N TCW S  +  Q    +V ++++  K FE+ YV+LQFCS  P+S+ IYKS D G+ W P+Q+YS  C++ +N P       Q   E   +    DL           +  ++ FS+  GR        +  L  W+T+TD+R+  SR          + +   +  R   D L          S+   YY V D  VGGRC+C GH+++C+   DG ++C+CKHNTEG +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD  K ++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   I      K + + S   +  + +S CKP     K    K   +  +V + V++ + V G   +F + +  V++  G   +    +        LW+  +++ C CP I +G+ +LIL   +   +  R  L  D  ++++QWR  W RRL+KFQ K  + KC K
Sbjct:   28 EETGAARRCIPEFINAAFGQEVSVSSVCGRPV-SRSCSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENL--QSSPLNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGRTWTPYQFYSSQCRRMYNRPNKAAITKQNEQEALCTDGHTDL--------YPLSGGLIAFSTLDGRPSGKDFDSSPVLQDWVTVTDIRVVFSRPQ--------HTRALPMSGRESEDALGAPG------SLPTYYYAVGDFQVGGRCKCNGHASRCVREKDGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKEANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVI------KPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETV-GDWAKFSVSLMSVYKSRGDPLKRGDHM--------LWVHMKDLACKCPRIHMGKRFLILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 599          
BLAST of Netrin-1 vs. Ensembl Zebrafish
Match: ntn1b (netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168])

HSP 1 Score: 354.369 bits (908), Expect = 1.231e-110
Identity = 216/652 (33.13%), Postives = 332/652 (50.92%), Query Frame = 3
Query:  669 FIRVLMNCFLFNSI--LLLGFSFYFSVAISVLYENKQTTC-EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKC 2597
             IR+L+ C    SI  ++ G    + +++     +    C + +G    C P F+N A    + V+S+CG   P   C   +       RDC+ICD       +    LTD  N  N TCW S   Y Q+  N V ++++  K FEV YV+LQFCS  P+S+ I+KS D GK W+P+Q+YS  C+K +N P       Q   E      C D +   +    G    ++ FS+  GR        +  L  W+T TD+++T +R                  H  G +  + S  + +       +Y VSDL VGGRC+C GH++KC+ + +GN+VC+CKHNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G++SGGVC  C+HNTAG  CH+C  GYYRD +K +SH  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K      +S     D  +      + +S CK    K K    K   +  +V + V++  +  G+  +F + I  V++  G   +   ++        LW+  ++V C CP I  GR YL++   +    R +  ++ D  ++++ W+  W RRL+KFQ +    KC
Sbjct:    1 MIRILVTCVSMVSITSMVSGARGGYGMSMFAAQSSPPDPCYDENGNPRRCIPDFVNSAFGKDVRVSSTCGSP-PSRYCVVTEK-GEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQS-ENYVQYPQN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKTWVPFQFYSTQCKKMYNKPSKAAITKQNEQEA----ICTDSHTDMQPLTGG----LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFNRL-----------------HTFGDENEDDSELARDS-----YFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAAPTSSYSSPDGPT------DCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKA-GEWWKFTINIISVYKQGGHRIRRGDQL--------LWVRAKDVACKCPKIKPGRKYLLMGSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGKC 602          
BLAST of Netrin-1 vs. Ensembl Zebrafish
Match: ntn1b (netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168])

HSP 1 Score: 354.369 bits (908), Expect = 1.231e-110
Identity = 216/652 (33.13%), Postives = 332/652 (50.92%), Query Frame = 3
Query:  669 FIRVLMNCFLFNSI--LLLGFSFYFSVAISVLYENKQTTC-EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKC 2597
             IR+L+ C    SI  ++ G    + +++     +    C + +G    C P F+N A    + V+S+CG   P   C   +       RDC+ICD       +    LTD  N  N TCW S   Y Q+  N V ++++  K FEV YV+LQFCS  P+S+ I+KS D GK W+P+Q+YS  C+K +N P       Q   E      C D +   +    G    ++ FS+  GR        +  L  W+T TD+++T +R                  H  G +  + S  + +       +Y VSDL VGGRC+C GH++KC+ + +GN+VC+CKHNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G++SGGVC  C+HNTAG  CH+C  GYYRD +K +SH  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K      +S     D  +      + +S CK    K K    K   +  +V + V++  +  G+  +F + I  V++  G   +   ++        LW+  ++V C CP I  GR YL++   +    R +  ++ D  ++++ W+  W RRL+KFQ +    KC
Sbjct:    1 MIRILVTCVSMVSITSMVSGARGGYGMSMFAAQSSPPDPCYDENGNPRRCIPDFVNSAFGKDVRVSSTCGSP-PSRYCVVTEK-GEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQS-ENYVQYPQN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKTWVPFQFYSTQCKKMYNKPSKAAITKQNEQEA----ICTDSHTDMQPLTGG----LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFNRL-----------------HTFGDENEDDSELARDS-----YFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAAPTSSYSSPDGPT------DCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKA-GEWWKFTINIISVYKQGGHRIRRGDQL--------LWVRAKDVACKCPKIKPGRKYLLMGSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGKC 602          
BLAST of Netrin-1 vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 351.673 bits (901), Expect = 1.342e-109
Identity = 217/653 (33.23%), Postives = 337/653 (51.61%), Query Frame = 3
Query:  666 IFIRVLMNCFLFNSILLLGFSFYFSVAISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQ-EQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +   V + C L  ++   G S +     +          + +G    C P F+N A   ++  +S+CG+  P   C   +     H R+C  CD       +    LTD  N  N TCW S   Y Q+  N V ++++  K FEV YV+LQFCS  P+S+ I+KS D GK W+P+QYYS  C+K +N P       Q   E   + +  D++          +  ++ FS+  GR        +  L  W+T TD+++T SR                  H  G +  + S  + +       +Y VSDL VGGRC+C GH+++C+ + DGN+VC+CKHNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  GYYRD +KP+SH  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K      ++    ++  S      + ES CK    K K    K   +  +V + ++++ +  G+  +F + I  V++      Q  S I + +Q+   LW+  ++V C CP I  G+ YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:    8 LVTLVTLCCVLKGTVGGYGMSMF-----AAQTSPPDPCYDENGHPRRCIPDFVNAAFGKEVRASSTCGKT-PSRYCVVTEKGDERH-RNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSD-NYLQYPQN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKSWVPFQYYSTQCRKMYNKPSKATITKQNEQEAICTDSHTDMHP--------LSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFSRL-----------------HTFGDENEDDSELARDS-----YFYAVSDLQVGGRCKCNGHASRCVKDRDGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCIKIPIAPPTTTASSTEEPS------DCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKA-GEWWKFTVNIISVYK------QGESRIRRGDQF---LWVRAKDVACKCPKIKSGKKYLLLGNDE--DSPGQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin-1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 332.798 bits (852), Expect = 2.066e-102
Identity = 198/620 (31.94%), Postives = 301/620 (48.55%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAE------SILPFSSTIGRKM------NDTLIKWITITDLRITLSR---FDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            HG    C P F+N A   ++  +S+CG +            ++ H      CD       Y    LTD     N TCW S   + +H   +V+++++  K FEV YV+LQFCS  P+S+ I+KS D GK W+P+QYYS  C+K +  P       Q              N+++     GQ E       ++ FS+  GR        +  L  W+T TD+R+  SR     ++ S   D G  F                          YY V +  VGGRC+C GH+++C  + +  ++CDCKHNTEG +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD ++ ++   ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   ++ +     ++      +  + E  CKP     K    K   +   V + V+E  E+ G   +F + I  V++      +             LWI  +++ C CP I L R YL++   +      R  L  D  ++++QWR +W RRL+K Q +  + KC K
Sbjct:   45 HGLPRRCVPEFVNAAFNKEVQASSTCGRL------------ATRH------CDTTDPRKSYPASYLTDLNTAGNMTCWRS-ETFPRHSSQNVSLTLSLGKKFEVTYVSLQFCSPRPESVAIFKSMDYGKSWVPYQYYSSQCRKVYGKPSRASVTKQ--------------NEQEALCTDGQTELYPLTGGLIAFSTLDGRPSAQDLDNSPVLQDWLTATDIRVFFSRPHLLGNKESEASDEGPGF--------------------------YYSVGEFQVGGRCKCNGHASRCGKDKEARLICDCKHNTEGPECDRCKPFHYDRPWQRATAREANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTSTE------EPADCEQYCKPPKGNYKINLKKYCKKDFVVQVNVLE-MEMVGSWAKFTVNILSVYKCRDDRIKRGDNF--------LWIHIKDLSCKCPKILLSRRYLVMGSSE--GPSERPGLTADKNSMVIQWRDAWTRRLRKLQRREKKGKCLK 587          
BLAST of Netrin-1 vs. Ensembl Xenopus
Match: ntn1 (netrin 1 [Source:NCBI gene;Acc:779839])

HSP 1 Score: 332.028 bits (850), Expect = 4.721e-102
Identity = 197/607 (32.45%), Postives = 316/607 (52.06%), Query Frame = 3
Query:  804 YCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCW--FSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGR------KMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCE 2600
            YC P FIN+A   ++  +++CG   P  +C ++   ++   R C +CD  R  + Y    +TD   Q   TCW   SG  + Q+    V +++   + FE+ Y +L+FCS  PDS+ IYKS D GK WIP+Q+YS +C++ ++   T    I + +++    TC D     K    G    ++ F    GR      + +  L  W+T TD+R+  +R          +GK   ++ +                     +YGVS++ VGGRC+C GH+++C    +G ++C+C+HNT G +CD CK  ++D  W+RA+  N   C  C+CNLHS  C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  GY RD +KP++   ACK C+CH +G+ N   C++  GQC CK GV G  C++C  GY Q+RS   PCV+  + + ++ +   +  +   +    +S CKP    R  +  +K+C++D V    + S E  G+  +F   +  V+R           +   +   PLW+   ++ CDC  + +G+SYLI+   +      R  L+LD  ++ L WR  W  +L++FQ +    KC 
Sbjct:   51 YCIPDFINVALGQEVITSNTCGRT-PQKLC-YFLDSTNVTSRRCQLCDQKRPENSYPPSYMTDTDAQ---TCWKSESGITFPQN----VTLTLPLGRRFELVYASLRFCSPRPDSMAIYKSMDYGKTWIPFQFYSTHCRRVYDQATTSA--ISKPMQHEA--TCTDFQTGVKPLTKG----LVAFMPLAGRPSARRFEYSPVLQDWVTATDIRVVFNRLH--------HGKKMGIRRK-------------------TAFYGVSEIQVGGRCKCNGHASRCTAGKEG-LMCECQHNTIGPECDACKPFYYDRPWQRATPSNAHECVACECNLHSHRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKQGYKRDLSKPITSRKACKPCQCHPIGAVNA-MCNQTTGQCQCKTGVTGPTCNRCAPGYQQSRSAHMPCVRIQEEMTTTASYPQEWKAG-TNGTECQSYCKP-SHSRVHMNLRKYCKKDYVLRAQLLSMEKSGEWWQFTATVLTVYRQ--------RRVPIRRGDQPLWVPDHDLACDCLRVQVGKSYLIIGNDEESPDPAR--LILDKNSLALPWRDVWGHKLRRFQQQERRGKCR 599          
BLAST of Netrin-1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 325.865 bits (834), Expect = 4.026e-100
Identity = 195/620 (31.45%), Postives = 294/620 (47.42%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAE------SILPFSSTIGRKM------NDTLIKWITITDLRITLSR---FDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            HG    C P F+N A   ++  +S+CG +            ++ H      CD       Y    LTD     N TCW S   + +H   +V+++++  K FEV YV+LQFCS  P+S+ I+KS D GK W+P+QYYS  C+K +  P       Q              N+++     GQ E       ++ FS+  GR        +  L  W+T TD+R+  SR     ++ S   D G  F                          YY V +  VGGRC+C GH+++C  + +  ++CDCKHNTEG +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD ++ ++   ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   ++ +               P   S  +P                  V + V+E  E+ G   +F + I  V++      +             LWI  +++ C CP I L R YL++   +      R  L  D  ++++QWR +W RRL+K Q +  + KC K
Sbjct:   45 HGLPRRCVPEFVNAAFNKEVQASSTCGRL------------ATRH------CDTTDPRKSYPASYLTDLNTAGNMTCWRS-ETFPRHSSQNVSLTLSLGKKFEVTYVSLQFCSPRPESVAIFKSMDYGKSWVPYQYYSSQCRKVYGKPSRASVTKQ--------------NEQEALCTDGQTELYPLTGGLIAFSTLDGRPSAQDLDNSPVLQDWLTATDIRVFFSRPHLLGNKESEASDEGPGF--------------------------YYSVGEFQVGGRCKCNGHASRCGKDKEARLICDCKHNTEGPECDRCKPFHYDRPWQRATAREANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPT---------------PALTSTEEPA----------------VVQVNVLE-MEMVGSWAKFTVNILSVYKCRDDRIKRGDNF--------LWIHIKDLSCKCPKILLSRRYLVMGSSE--GPSERPGLTADKNSMVIQWRDAWTRRLRKLQRREKKGKCLK 562          
BLAST of Netrin-1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 221.861 bits (564), Expect = 7.682e-59
Identity = 153/477 (32.08%), Postives = 230/477 (48.22%), Query Frame = 3
Query:  705 SILLLGFSFYFSVAISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNH---VNISIAFKKNFEVFYVALQFCSELPDSITIYK-SHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYR-DWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQ-TRSMLKPCV 2099
            ++LLLG       A+   YE         G    C P F+N A  A +  T++CG   P++ C       +   + C ICD+ + +  +  + LTD  NQ   T W S  +    G+ +   +N+++   K F++ YV L+F +  P+S  +YK +H++G  WIP+QYYS +C+K +           E  + +L    F        GN+        FS+  GR        +  L +W+T TD+R+TL+R +      F                        + K +   YY +SD +VGGRC+C GH+++C+ N    IVC+CKHNT G+DC+KC   ++D  W R++  +P  C  C CN  SQ C F+  +Y  TG   GG C  C  NT G  C  C   YYR D  +P      C  C+C+ VGS +   CD   G+C CK GV+G KCD+C+ G+   T +  +PC 
Sbjct:    5 AVLLLG---TVRAAMDECYE--------EGSPQRCMPEFVNAAFNATVVATNTCG-TPPEEYCVQTGV--TGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTML--AGIQYPSTINLTLHLGKAFDITYVRLKFHTSRPESFALYKRTHEDGP-WIPYQYYSGSCEKTYQKFNRGFIRTGEDEQQALCTDEFSDISPLTGGNVA-------FSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFS-----------------------DPKVLKSYYYAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTGH--GGHCTGCADNTDGPNCERCRENYYRQDNNEP------CHACQCNPVGSLSTQ-CD-NYGRCSCKPGVMGEKCDRCQPGFHSLTEAGCRPCA 424          

HSP 2 Score: 75.485 bits (184), Expect = 4.330e-13
Identity = 50/163 (30.67%), Postives = 78/163 (47.85%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLA---CKKCKC-HAVGSTNVNSCDKKLGQCF-CKEGVIGRKCDKCKIGY 2066
            C C GHS+ C   +  + VCDC+HNT G  C++C EG+    +  ++  +   C+ C C   S      +   +        VC  C   T G +C  CD+GY+ D   PL  + A   C+ C+C + +    V +CD+  G+C  C     G  CD+C+ G+
Sbjct:  702 CTCNGHSDTC---DPESGVCDCQHNTAGPHCERCSEGY----YGDSTTGSASDCQPCPCPGGSSCAVVPRTKEV--------VCTNCPLGTTGKRCELCDDGYFGD---PLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGF 846          

HSP 3 Score: 70.0922 bits (170), Expect = 1.677e-11
Identity = 56/181 (30.94%), Postives = 84/181 (46.41%), Query Frame = 3
Query: 1548 SKVYYGVSDLSVGGRCQ---CYGHSNKCIINNDGNIVC-DCKHNTEGADCDKCKEG-FHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSH--DLACKKCKCHAVGSTNVNS-CDKKLGQCFCKEGVIGRKCDKCKIGY 2066
            S+ YYG S       CQ   C G S+  ++     +VC +C   T G  C+ C +G F D   E  +   P  C+ C+C+ +      + N      + +G  C KC +NT G  C  C +G+Y +   PL+   DL C+ C C+  G+    S C++  GQC C   V  R C  C+ G+
Sbjct:  733 SEGYYGDSTTGSASDCQPCPCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGA---PRPCRICECSNN-----IDPNAVGNCDRLTG-ECLKCIYNTGGFYCDRCRDGFYGN---PLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCSACEPGF 901          

HSP 4 Score: 66.6254 bits (161), Expect = 1.895e-10
Identity = 52/155 (33.55%), Postives = 67/155 (43.23%), Query Frame = 3
Query: 1647 VCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY----LQTRSMLKPC 2096
            +C C     G  C++C  G+   + E  S+  P+S C  C CN HS  C  E            GVC  CQHNTAG  C  C  GYY D T   + D  C+ C C    S  V    K++    C  G  G++C+ C  GY    L      +PC
Sbjct:  667 ICSCPTGYIGQFCERCAPGY---RRENPSQ-GPYSPCVLCTCNGHSDTCDPES-----------GVC-DCQHNTAGPHCERCSEGYYGDSTTGSASD--CQPCPCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPC 803          

HSP 5 Score: 55.4546 bits (132), Expect = 5.411e-7
Identity = 43/145 (29.66%), Postives = 69/145 (47.59%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQC-NLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRS 2081
            C+C  +    DC  C+ GF++L       L+   C+RC C +L S   + +    ++TGQ     C +C    +G QC  C+  ++    +       CK C C   GS ++    K+ G+C CK G +G +CD+C+  Y   RS
Sbjct:  883 CECLPHVTERDCSACEPGFYNL-------LSGRGCERCDCHSLGSTSGQCD----VRTGQ-----C-ECHPGISGQQCQQCEPNHFGFGPE------GCKPCDCDPEGSGSLQC--KEDGRCECKSGFVGTRCDQCEENYFYNRS 1002          
BLAST of Netrin-1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 221.476 bits (563), Expect = 8.338e-59
Identity = 153/477 (32.08%), Postives = 230/477 (48.22%), Query Frame = 3
Query:  705 SILLLGFSFYFSVAISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNH---VNISIAFKKNFEVFYVALQFCSELPDSITIYK-SHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYR-DWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQ-TRSMLKPCV 2099
            ++LLLG       A+   YE         G    C P F+N A  A +  T++CG   P++ C       +   + C ICD+ + +  +  + LTD  NQ   T W S  +    G+ +   +N+++   K F++ YV L+F +  P+S  +YK +H++G  WIP+QYYS +C+K +           E  + +L    F        GN+        FS+  GR        +  L +W+T TD+R+TL+R +      F                        + K +   YY +SD +VGGRC+C GH+++C+ N    IVC+CKHNT G+DC+KC   ++D  W R++  +P  C  C CN  SQ C F+  +Y  TG   GG C  C  NT G  C  C   YYR D  +P      C  C+C+ VGS +   CD   G+C CK GV+G KCD+C+ G+   T +  +PC 
Sbjct:    8 AVLLLG---TVRAAMDECYE--------EGSPQRCMPEFVNAAFNATVVATNTCG-TPPEEYCVQTGV--TGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTML--AGIQYPSTINLTLHLGKAFDITYVRLKFHTSRPESFALYKRTHEDGP-WIPYQYYSGSCEKTYQKFNRGFIRTGEDEQQALCTDEFSDISPLTGGNVA-------FSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFS-----------------------DPKVLKSYYYAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTGH--GGHCTGCADNTDGPNCERCRENYYRQDNNEP------CHACQCNPVGSLSTQ-CD-NYGRCSCKPGVMGEKCDRCQPGFHSLTEAGCRPCA 427          

HSP 2 Score: 75.0998 bits (183), Expect = 5.133e-13
Identity = 50/163 (30.67%), Postives = 78/163 (47.85%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLA---CKKCKC-HAVGSTNVNSCDKKLGQCF-CKEGVIGRKCDKCKIGY 2066
            C C GHS+ C   +  + VCDC+HNT G  C++C EG+    +  ++  +   C+ C C   S      +   +        VC  C   T G +C  CD+GY+ D   PL  + A   C+ C+C + +    V +CD+  G+C  C     G  CD+C+ G+
Sbjct:  705 CTCNGHSDTC---DPESGVCDCQHNTAGPHCERCSEGY----YGDSTTGSASDCQPCPCPGGSSCAVVPRTKEV--------VCTNCPLGTTGKRCELCDDGYFGD---PLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGF 849          

HSP 3 Score: 69.707 bits (169), Expect = 2.315e-11
Identity = 56/181 (30.94%), Postives = 84/181 (46.41%), Query Frame = 3
Query: 1548 SKVYYGVSDLSVGGRCQ---CYGHSNKCIINNDGNIVC-DCKHNTEGADCDKCKEG-FHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSH--DLACKKCKCHAVGSTNVNS-CDKKLGQCFCKEGVIGRKCDKCKIGY 2066
            S+ YYG S       CQ   C G S+  ++     +VC +C   T G  C+ C +G F D   E  +   P  C+ C+C+ +      + N      + +G  C KC +NT G  C  C +G+Y +   PL+   DL C+ C C+  G+    S C++  GQC C   V  R C  C+ G+
Sbjct:  736 SEGYYGDSTTGSASDCQPCPCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGA---PRPCRICECSNN-----IDPNAVGNCDRLTG-ECLKCIYNTGGFYCDRCRDGFYGN---PLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCSACEPGF 904          

HSP 4 Score: 66.6254 bits (161), Expect = 2.208e-10
Identity = 52/155 (33.55%), Postives = 67/155 (43.23%), Query Frame = 3
Query: 1647 VCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY----LQTRSMLKPC 2096
            +C C     G  C++C  G+   + E  S+  P+S C  C CN HS  C  E            GVC  CQHNTAG  C  C  GYY D T   + D  C+ C C    S  V    K++    C  G  G++C+ C  GY    L      +PC
Sbjct:  670 ICSCPTGYIGQFCERCAPGY---RRENPSQ-GPYSPCVLCTCNGHSDTCDPES-----------GVC-DCQHNTAGPHCERCSEGYYGDSTTGSASD--CQPCPCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPC 806          

HSP 5 Score: 55.0694 bits (131), Expect = 6.919e-7
Identity = 43/145 (29.66%), Postives = 69/145 (47.59%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQC-NLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRS 2081
            C+C  +    DC  C+ GF++L       L+   C+RC C +L S   + +    ++TGQ     C +C    +G QC  C+  ++    +       CK C C   GS ++    K+ G+C CK G +G +CD+C+  Y   RS
Sbjct:  886 CECLPHVTERDCSACEPGFYNL-------LSGRGCERCDCHSLGSTSGQCD----VRTGQ-----C-ECHPGISGQQCQQCEPNHFGFGPE------GCKPCDCDPEGSGSLQC--KEDGRCECKSGFVGTRCDQCEENYFYNRS 1005          
BLAST of Netrin-1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 339.347 bits (869), Expect = 6.527e-105
Identity = 208/616 (33.77%), Postives = 316/616 (51.30%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKY-----YSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +G    C P F+N A    + V+S+CG        P  +Y           R C +C++      +    LTD  N  N TCW S   Y Q   N V ++++  K FEV YV+LQFCS  P+S+ IYKS D G+ W+P+Q+YS  C+K +N P     PI +  E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+  SR                  H  G +  + S  + +       YY VSDL VGGRC+C GH+ +C+ + D ++VCDC+HNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD  KP++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K    +    T  S +     +  + +S CK    K K    K   +  +V + ++++ +  G   +F + I  V++      Q  S I +   +  LWI   ++ C CP I   + YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:   45 NGHPRRCIPDFVNAAFGKDVRVSSTCGR-------PPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQS-ENYLQFPHN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRP--HRAPITKQNEQEA--VCTDSHTDMRPLSGG----LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRL-----------------HTFGDENEDDSELARDS-----YYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKI--PVAPPTTAASSVE----EPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKA-GDWWKFTVNIISVYK------QGTSRIRRGDQS--LWIRSRDIACKCPKIKPLKKYLLLGNAE--DSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 339.347 bits (869), Expect = 6.527e-105
Identity = 208/616 (33.77%), Postives = 316/616 (51.30%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKY-----YSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +G    C P F+N A    + V+S+CG        P  +Y           R C +C++      +    LTD  N  N TCW S   Y Q   N V ++++  K FEV YV+LQFCS  P+S+ IYKS D G+ W+P+Q+YS  C+K +N P     PI +  E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+  SR                  H  G +  + S  + +       YY VSDL VGGRC+C GH+ +C+ + D ++VCDC+HNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD  KP++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K    +    T  S +     +  + +S CK    K K    K   +  +V + ++++ +  G   +F + I  V++      Q  S I +   +  LWI   ++ C CP I   + YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:   45 NGHPRRCIPDFVNAAFGKDVRVSSTCGR-------PPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQS-ENYLQFPHN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRP--HRAPITKQNEQEA--VCTDSHTDMRPLSGG----LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRL-----------------HTFGDENEDDSELARDS-----YYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKI--PVAPPTTAASSVE----EPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKA-GDWWKFTVNIISVYK------QGTSRIRRGDQS--LWIRSRDIACKCPKIKPLKKYLLLGNAE--DSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1 vs. Ensembl Mouse
Match: Ntn3 (netrin 3 [Source:MGI Symbol;Acc:MGI:1341188])

HSP 1 Score: 302.753 bits (774), Expect = 2.077e-91
Identity = 187/635 (29.45%), Postives = 292/635 (45.98%), Query Frame = 3
Query:  684 MNCFLFNSILLLGFSFYFSVAISVLYENKQTTCEFHGKD-YYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFN-LPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVY-YGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLIL----MKYKIYHHRHREELLLDSRTVMLQWRPSW 2549
            M  +L+  +L  G     S A+S         C    ++   C P  +N A   ++  +S+CG              S+N      +CD+      +S   LT      +  CW S  +  Q   N V +++   K FE+ +V+L+FCS  P S+ + KS D+G+ W+P  ++S +C   +  LP   + P   G E      CF   Q Q DG       +L FS   G         +  L  W+T TD+RI L+R   Q  +                           D  ++  Y Y  ++L VGGRC+C GH+++C+++  G++VCDC+H TEG DC +CK  + D  W+RA+     +C  C CN H++ C+F   +Y  +G++SGGVC  C+HNTAG  CH+C  G+YRD  + LS   AC+ C CH VG+    +C++  GQC CK+GV G  C++C  G+ Q+RS + PCVKT   +     + S +  +     + ES C+P     +    K   +  +V + V    E  G   RF + +  V+R          E    + +  LW+   +  C CP +  GR YL+L               + L     +++L WR +W
Sbjct:    1 MPTWLWGLLLTAG---TLSAALSPGLPASADPCYDEAREPRSCIPGLVNAALGREVLASSTCGR-------------SANR-----VCDSSDPQRAHSADLLTSAPGTASPLCWRSD-LLQQAPFN-VTLTVPLGKAFELVFVSLRFCSAPPTSVALLKSQDHGRSWVPLGFFSSSCTLDYGRLPAPADGPSGPGPEA----LCFPAPQAQPDGG-----GLLAFSVQDGSPQGLDLDNSPVLQDWVTATDIRIVLTRPAIQGDT--------------------------RDGGVTVPYSYSATELQVGGRCKCNGHASRCLLDTHGHLVCDCQHGTEGPDCSRCKPFYCDRPWQRATGQEAHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRVLSDRRACRACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKT--PVPGPTEESSPVEPQ-----DCESHCRPARGSYRISLKKFCRKDYAVQVAVGARGEARGSWTRFPVAVLAVFRS--------GEERARRGSSALWVPTLDAACGCPRLLPGRRYLLLGGGPGAAAGSTAGRGQGLSAARGSLVLPWRDAW 561          
BLAST of Netrin-1 vs. Ensembl Mouse
Match: Lamc1 (laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914])

HSP 1 Score: 216.468 bits (550), Expect = 2.734e-57
Identity = 139/443 (31.38%), Postives = 213/443 (48.08%), Query Frame = 3
Query:  792 GKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVY-NQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQ-TRSMLKPC 2096
            G+   C P F+N A    +  T++CG   P++ C       +   + C +CD  +++  +    LTD  NQ + T W S  +       N +N+++   K F++ YV L+F +  P+S  IYK       WIP+QYYS +C+  ++             + +L    F        GN+        FS+  GR        +  L +W+T TD+R+TL+R                  +  G ++ N      + K +   YY +SD +VGGRC+C GH+++C+ N    ++C+CKHNT G DC+KC   F+D  W RA+  +   C  C CN  SQ C F+  +Y  TG   GG C  C+ NT G +C  C   ++R     L +  AC  C C  VGS +   CD   G+C CK GV+G KCD+C+ G+   T +  +PC
Sbjct:   43 GRPQRCMPEFVNAAFNVTVVATNTCG-TPPEEYCVQTGV--TGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVA-------FSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRL-----------------NTFGDEVFN------DPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDKLMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGH--GGHCTNCRDNTDGAKCERCRENFFR-----LGNTEACSPCHCSPVGSLSTQ-CD-SYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPC 443          

HSP 2 Score: 71.633 bits (174), Expect = 4.162e-12
Identity = 59/184 (32.07%), Postives = 80/184 (43.48%), Query Frame = 3
Query: 1548 SKVYYGVSDLSVGGRCQ---CYGHSNKCIINNDGNIVCD-CKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGST-NVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRS 2081
            S  YYG S L     CQ   C G S+  I+     +VC  C   T G  C+ C +G+     +      P   C+ CQCN +      + N      + +G  C KC +NTAG  C  C  G++ +   P   D  CK C C+  G+    +SC+   GQC C   V GR C  C  GY   +S
Sbjct:  753 SDGYYGDSTLGTSSDCQPCPCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYF---GDPLGSNGPVRLCRPCQCNDN-----IDPNAVGNCNRLTG-ECLKCIYNTAGFYCDRCKEGFFGNPLAPNPAD-KCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQS 926          

HSP 3 Score: 71.633 bits (174), Expect = 4.569e-12
Identity = 53/173 (30.64%), Postives = 74/173 (42.77%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHA-VGSTNVNSCDKKLGQCF-CKEGVIGRKCDKCKIGYLQTRSMLKPCVK 2102
            C C GHS  C   +    VCDC+ NT G  C+KC +G++       S L   S C+ C C   S      K   +        VC  C   TAG +C  CD+GY+ D          C+ C+C+  +    V +C++  G+C  C     G  CD+CK G+        P  K
Sbjct:  722 CTCNGHSETC---DPETGVCDCRDNTAGPHCEKCSDGYYG-----DSTLGTSSDCQPCPCPGGSSCAIVPKTKEV--------VCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADK 878          

HSP 4 Score: 62.3882 bits (150), Expect = 2.944e-9
Identity = 46/141 (32.62%), Postives = 59/141 (41.84%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYL 2069
            C C     G  C+ C  G+          L P+S C  C CN HS+ C  E            GVC  C+ NTAG  C  C +GYY D T   S D  C+ C C    S  +    K++    C  G  G++C+ C  GY 
Sbjct:  688 CTCPVGYGGQFCETCLPGYR----RETPSLGPYSPCVLCTCNGHSETCDPET-----------GVC-DCRDNTAGPHCEKCSDGYYGDSTLGTSSD--CQPCPCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYF 810          

HSP 5 Score: 62.003 bits (149), Expect = 4.311e-9
Identity = 59/214 (27.57%), Postives = 83/214 (38.79%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCK---HNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFC-----------------------------------------------KEGVIGRKCDKCKIGYLQTRS 2081
            CQC  + +   + N   +  +C    +NT G  CD+CKEGF    +      NP   CK C CN +    + + +    TGQ     C +C  + +G  C  CD GYY      L     C++C CHA+GSTN   CD + GQC C                                               +EG +G +CD+C+  Y   RS
Sbjct:  826 CQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGF----FGNPLAPNPADKCKACACNPYGT-VQQQSSCNPVTGQ-----C-QCLPHVSGRDCGTCDPGYYN-----LQSGQGCERCDCHALGSTN-GQCDIRTGQCECQPGITGQHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKEDGRCECREGFVGNRCDQCEENYFYNRS 1022          
BLAST of Netrin-1 vs. Ensembl Mouse
Match: Lamc3 (laminin gamma 3 [Source:MGI Symbol;Acc:MGI:1344394])

HSP 1 Score: 214.542 bits (545), Expect = 1.096e-56
Identity = 135/433 (31.18%), Postives = 203/433 (46.88%), Query Frame = 3
Query:  792 GKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGP--VYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGR------KMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY 2066
            G+   C P F N A   +   + +CG   P+D CPH     +     C  CD+      +    LTD  +  + + W+  P   +       VN++++  K +E+ YV L+F +  P+S  IYK       W P+QYYS +CQK +  P        E    +   + F        GN+        FS+  GR      + +  L +W+T TD+ I+L    D+++++ D             DI        + + +   YY VSD SVGGRC+C GH+++C  N  G + C C+HNT G DC++C   F D  W R +  +   C  C C+ HS+ C F++ +Y  TG   GG C++C+ +T G  C  C+  YYR W    S    C+ C CH  GS ++  CD   G C CK  V G KCD+C  G+
Sbjct:   39 GRAQRCLPEFENAAFGRRAEASHTCGRP-PEDFCPHVGAPGAG--LQCQRCDDADPGRRHDASYLTD-FHSPDDSTWWQSPSMAFGVQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTYGRPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVA-------FSTLEGRPSAYNFEESPVLQEWVTSTDILISL----DRLNTFGD-------------DIFK------DPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACRCQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGH--GGHCQRCRDHTTGPHCERCEKNYYR-W----SPKTPCQPCDCHPAGSLSLQ-CDNS-GVCPCKPTVTGWKCDRCLPGF 428          

HSP 2 Score: 81.6481 bits (200), Expect = 4.110e-15
Identity = 59/169 (34.91%), Postives = 78/169 (46.15%), Query Frame = 3
Query: 1590 RCQCYGHSNKCIINNDGNIVCD--------CKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYL 2069
            RCQC G+ +   +N  GN  CD        C +NT GA C+ C+EGF+      A    P   C  C C+L         +V  KT     G C  C    +G  C  C  G+Y      L     C+ CKCH +GS   N C  K GQC C+ GV G+ CD+C++G+ 
Sbjct:  821 RCQCSGNVD---LNAVGN--CDPHSGHCLRCLYNTTGAHCEHCREGFYG----SAVATRPVDKCAPCSCDLRG-------SVSEKTCNPVTGQC-VCLPYVSGRDCSRCSPGFYD-----LQSGRGCQSCKCHPLGSLE-NKCHPKTGQCPCRPGVTGQACDRCQLGFF 966          

HSP 3 Score: 75.8702 bits (185), Expect = 2.147e-13
Identity = 51/166 (30.72%), Postives = 72/166 (43.37%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCD-CKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDW--TKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRS 2081
            C C G S    I   G++VC  C     G  C+ C++GF       +    P  C+RCQC+ +      + N        SG  C +C +NT G  C  C  G+Y     T+P+     C  C C   GS +  +C+   GQC C   V GR C +C  G+   +S
Sbjct:  767 CPCPGQSACATIPESGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQP--CRRCQCSGN-----VDLNAVGNCDPHSG-HCLRCLYNTTGAHCEHCREGFYGSAVATRPVDK---CAPCSCDLRGSVSEKTCNPVTGQCVCLPYVSGRDCSRCSPGFYDLQS 921          

HSP 4 Score: 60.8474 bits (146), Expect = 8.254e-9
Identity = 46/172 (26.74%), Postives = 68/172 (39.53%), Query Frame = 3
Query: 1602 YGHSNKCIINNDGNI-----VCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGG-VCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHA-VGSTNVNSCDKKLGQCF-CKEGVIGRKCDKCKIGYLQTRSMLKP 2093
            Y +   C  N  G       +C C H+TEG  C++C  GF+          N FS +   C    Q C         T  +SG  VC  C     G +C  C++G++ D          C++C+C   V    V +CD   G C  C     G  C+ C+ G+  +    +P
Sbjct:  713 YANCIPCTCNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYG---------NAFSGRADDC----QPCPCPGQSACATIPESGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHSGHCLRCLYNTTGAHCEHCREGFYGSAVATRP 871          

HSP 5 Score: 56.9954 bits (136), Expect = 1.318e-7
Identity = 45/175 (25.71%), Postives = 73/175 (41.71%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYL--QTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDM 2168
            C C     G DC +C  GF+DLQ  R        C+ C+C+        E   + KTGQ        C+    G  C  C  G++    K       C+ C+C  +G+ + + C +    C C+ G +G KCD+C+  +      +  + C   Y +++    K   L ++ M M
Sbjct:  898 CVCLPYVSGRDCSRCSPGFYDLQSGRG-------CQSCKCHPLG---SLENKCHPKTGQC------PCRPGVTGQACDRCQLGFFGFSIK------GCRDCRCSPLGAAS-SQCHEN-STCVCRPGFVGYKCDRCQDNFFLADGDTGCQECPTCYALVKEEAAK---LKARLMLM 1045          
BLAST of Netrin-1 vs. UniProt/SwissProt
Match: sp|Q90922|NET1_CHICK (Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 3.489e-104
Identity = 206/611 (33.72%), Postives = 318/611 (52.05%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            HG    C P F+N A   ++ V+S+CG+  P   C   +       R C +C+       +    LTD  N  N TCW S   Y Q+  N V ++++  K FEV YV+LQFCS  P+S+ IYKS D GK W+P+Q+YS  C+K +N P       Q   E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+++T SR                  H  G +  + S  + +       +Y VSDL VGGRC+C GH+++C+ + D N+VCDCKHNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD +KP+SH  ACK+C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K       +    ++      +  + +S CK    K K    K   +  +V + ++++ E +    +F + I  V++   + S  +    Q      LW+  +++ C CP +   + YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  + KC K
Sbjct:   47 HGLPRRCIPDFVNSAFGKEVKVSSTCGKP-PSRYCVVTEK-GEEQVRSCHLCNASDPKRAHPPSFLTDLNNPHNLTCWQSD-SYVQYPHN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCRKMYNKPSRAAITKQNEQEA----ICTDSHTDVRPLSGG----LIAFSTLDGRPTAHDFDNSPVLQDWVTATDIKVTFSRL-----------------HTFGDENEDDSELARDS-----YFYAVSDLQVGGRCKCNGHASRCVRDRDDNLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKECDCHPVGAAG-QTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPAAPPPTAASSTE------EPADCDSYCKASKGKLKINMKKYCKKDYAVQIHILKA-EKNADWWKFTVNIISVYK---QGSNRLRRGDQT-----LWVHAKDIACKCPKVKPMKKYLLLGSTE--DSPDQSGIIADKSSLVIQWRDTWARRLRKFQQREKKGKCRK 605          
BLAST of Netrin-1 vs. UniProt/SwissProt
Match: sp|O09118|NET1_MOUSE (Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=3)

HSP 1 Score: 339.347 bits (869), Expect = 4.565e-104
Identity = 208/616 (33.77%), Postives = 316/616 (51.30%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKY-----YSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +G    C P F+N A    + V+S+CG        P  +Y           R C +C++      +    LTD  N  N TCW S   Y Q   N V ++++  K FEV YV+LQFCS  P+S+ IYKS D G+ W+P+Q+YS  C+K +N P     PI +  E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+  SR                  H  G +  + S  + +       YY VSDL VGGRC+C GH+ +C+ + D ++VCDC+HNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD  KP++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K    +    T  S +     +  + +S CK    K K    K   +  +V + ++++ +  G   +F + I  V++      Q  S I +   +  LWI   ++ C CP I   + YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:   45 NGHPRRCIPDFVNAAFGKDVRVSSTCGR-------PPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQS-ENYLQFPHN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRP--HRAPITKQNEQEA--VCTDSHTDMRPLSGG----LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRL-----------------HTFGDENEDDSELARDS-----YYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKI--PVAPPTTAASSVE----EPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKA-GDWWKFTVNIISVYK------QGTSRIRRGDQS--LWIRSRDIACKCPKIKPLKKYLLLGNAE--DSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1 vs. UniProt/SwissProt
Match: sp|O95631|NET1_HUMAN (Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2)

HSP 1 Score: 338.191 bits (866), Expect = 1.219e-103
Identity = 208/616 (33.77%), Postives = 315/616 (51.14%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKY-----YSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +G    C P F+N A    + V+S+CG        P  +Y           R C +C+       +    LTD  N  N TCW S   Y Q   N V ++++  K FEV YV+LQFCS  P+S+ IYKS D G+ W+P+Q+YS  C+K +N P     PI +  E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+  SR                  H  G +  + S  + +       +Y VSDL VGGRC+C GH+ +C+ + D ++VCDC+HNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  GYYRD  KP++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K    +    T  S +     +  + +S CK    K K    K   +  +V + ++++ +  G   +F + I  V++      Q  S I +   +  LWI   ++ C CP I   + YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:   45 NGHPRRCIPDFVNAAFGKDVRVSSTCGR-------PPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQS-ENYLQFPHN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRP--HRAPITKQNEQEA--VCTDSHTDMRPLSGG----LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRL-----------------HTFGDENEDDSELARDS-----YFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKI--PVAPPTTAASSVE----EPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKA-GDWWKFTVNIISVYK------QGTSRIRRGDQS--LWIRSRDIACKCPKIKPLKKYLLLGNAE--DSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1 vs. UniProt/SwissProt
Match: sp|Q924Z9|NET1_RAT (Netrin-1 OS=Rattus norvegicus OX=10116 GN=Ntn1 PE=1 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 1.166e-101
Identity = 206/616 (33.44%), Postives = 313/616 (50.81%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKY-----YSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +G    C P F+N A    + V+S+CG        P  +Y           R C +C++      +    LTD  N  N TCW S   Y Q   N V ++++  K FEV YV+LQFCS  P+S+ IYKS D G+ W+P+Q+YS  C+K +N P     PI +  E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+  SR                  H  G +  + S  + +       YY VSDL VGGRC+C GH+ +C+ + D ++VCDC+HNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD  KP++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K    +    T  S +     +  + +S CK    K K    K   +  +V + ++++ +  G   +F + I  V++      Q  S I +   +  LWI   ++   CP I   + YL+L   +      +  ++ D   +++QWR +W RR +KFQ +  + KC+K
Sbjct:   45 NGHPRRCIPDFVNAAFGKDVRVSSTCGR-------PPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQS-ENYLQFPHN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRP--HRAPITKQNEQEA--VCTDSHTDMRPLSGG----LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRL-----------------HTFGDENEDDSELARDS-----YYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKI--PVAPPTTAASSME----EPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKA-GDWWKFTVNIISVYK------QGTSRIRRGDQS--LWIRSRDIAXKCPKIKPLKKYLLLGNAE--DSPDQSGIVADKSXLVIQWRDTWARRXRKFQQREKKGKCKK 603          
BLAST of Netrin-1 vs. UniProt/SwissProt
Match: sp|Q2HXW4|NET1_PIG (Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 1.288e-101
Identity = 205/612 (33.50%), Postives = 311/612 (50.82%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKY-----YSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEE 2591
            +G    C P F+N A    + V+S+CG        P  +Y           R C +C+       +    LTD  N  N TCW S   Y Q   N V ++++  K FEV YV+LQFCS  P+S+ IYKS D G+ W+P+Q+YS  C+K +N P     PI +  E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+  SR                  H  G +  + S  + +       +Y VSDL VGGRC+C GH+ +C+ + D ++VCDC+HNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  GY+RD  KP++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K    +    T  S +     +  + +S CK    K K    K   +  +V + ++++ +  G   +F + I  V++      Q  S I +      LWI   ++ C CP I   + YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  +E
Sbjct:   45 NGHPRRCIPDFVNAAFGKDVRVSSTCGR-------PPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQS-ENYLQFPHN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRP--HRAPITKQNEQEA--VCTDSHTDMRPLSGG----LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRL-----------------HTFGDENEDDSELARD-----SYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYFRDLGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGVTCNRCAKGYQQSRSPIAPCIKI--PVAPPTTAASSVE----EPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKA-GDWWKFTVNIISVYK------QGASRIRRGDQN--LWIRSRDIACKCPKIKPLKKYLLLGNAE--DSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKE 599          
BLAST of Netrin-1 vs. TrEMBL
Match: A0A4D6G2V3 (Netrin-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=netrin-4 PE=2 SV=1)

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 276/276 (100.00%), Postives = 276/276 (100.00%), Query Frame = 3
Query: 1707 HDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQ 2534
            HDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEKRKRIRFKKFCRRDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQ
Sbjct:    1 HDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEKRKRIRFKKFCRRDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQ 276          
BLAST of Netrin-1 vs. TrEMBL
Match: A0A3Q0KPX7 (Putative netrin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 2.484e-143
Identity = 264/686 (38.48%), Postives = 372/686 (54.23%), Query Frame = 3
Query:  747 ISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEI-LPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM----NDTLIKWITITDLRITLSRFDD-------------------------QMSSYFDYGKYFLLKHRRGRDILNMST--------FSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCI--------INNDGN---------IVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDII-----ESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQ---YAVPLWISHEEV-----RCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCE 2600
            I V+YE  ++ C   G+   C+PPF NIA+   I  TS+CG+    ++IC     Y   H + C  C    K   +    LTD     N TCW SG V      + VN++++  K FEV+Y++LQ C +LPDSI +YKS D G  W PWQY+S +C +AF+LP + E   Q  L       C  L      GN GQ+ +++ FS+TIGR      +  LI W+T+TDLRI+L RF +                         ++S     G +           L+MS         +S   KS + V++  SDLS+GGRC+C GH+N+CI        I  D N         + CDC+HNTEGADC++C  G+ D  W R +  +   CKRC CNLHS  C F   +Y+ + + SGGVC+ CQHNT G +CH C  GYYRDWTKP+SHD  C +C+CH +GS     CD+K GQC CK GV+G+ C++C+ GY QTR    PC+K  +       E+ QT  S      +  P T  +C PC+  +KRIRFKKFCR ++VF G+++S+ +HG ++R E+ I+  WR++G     + + +      Y V L I +        RC CPN+ +G+SYL + +     +  R ELLLD+ +V+L+WR SW RRL KF  +A  E C+
Sbjct:   43 IKVIYEATRSVCYTKGQAIECSPPFTNIAESVDIKATSTCGQFDQSEEIC----RYVMGHEK-CETCGKGEK---FGTHLLTDRHQMNNETCWVSGSVLPG---DTVNLTLSLGKRFEVYYISLQPCGQLPDSIALYKSSDFGVTWKPWQYFSTDCYRAFHLPTSNEHNAQISLANIQEVLCVALKSPDVHGNSGQSSNVIAFSTTIGRPSMQPWSSALIDWMTMTDLRISLMRFPEYRDEVQYDSNGLFLNPSFLKPTNVFRVSGSPSIGGFGTNPVLSEAGTLDMSQHLYQSDMHYSKTPKSKTPVHFSFSDLSIGGRCKCNGHANRCIRDRIVGTGITTDNNGQTKSQWGPLRCDCQHNTEGADCERCSPGYLDRPWARGTSESANDCKRCDCNLHSNSCVFSNQLYLMSMKVSGGVCQDCQHNTVGRKCHNCVTGYYRDWTKPVSHDQVCLECRCHPIGSIANQHCDRKTGQCPCKPGVVGQACNRCQEGYKQTRLPDAPCIKAMEHYAHRRKENDQTSHS--TKSQLSKPETNIDCPPCERSKKRIRFKKFCRNEAVFRGIVKSRTIHGDLMRLEVGIQNTWRITGAAEHLLPKTASPNLPAYRVWLRIKNNSADKRHSRCLCPNLQVGQSYLFITRSHQVPYGDRMELLLDTHSVVLKWRESWRRRLSKFVRRAARESCD 715          
BLAST of Netrin-1 vs. TrEMBL
Match: A0A4Z2D9H4 (Netrin-A OS=Schistosoma japonicum OX=6182 GN=EWB00_003107 PE=4 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 8.210e-141
Identity = 261/684 (38.16%), Postives = 367/684 (53.65%), Query Frame = 3
Query:  747 ISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEI-LPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM----NDTLIKWITITDLRITLSRFD--------DQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDK-------------------------SMSKVYYGVSDLSVGGRCQCYGHSNKCIIN----------NDG-------NIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKT---YDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQ---YAVPLWISHEEVR-----CDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCE 2600
            + V+YE  ++ C   G+   C+PPF NIA+   I  TS+CG+    ++IC   +Y      R C ICD+  K   +    LTD     N TCW SG V      + VN++++  K FEV+Y++LQ C +LPDSI +YKS D G  W PWQY+S +C +AF LP + E   Q  L       C  L        +G++ +I+ FS+TIGR      +  LI W+T+TDLRI+L RF         D    + + G     K  R     N+  F +N                           S S V++  SDLS+GGRC+C GH+N+C+ +          NDG        + CDC+HNTEG DC++C  G+ D  W R +  +   CKRC CNLHS  C F   +Y+ + + SGGVC+ CQHNT G +CH C  GYYRDWTKP+SHD  C +C+CH +GS     CD+K GQC CK GVIG+ C++C+ GY QTR    PC+K    Y        + S      M     ++ C PC+  +KRIRFKKFCR ++VF G+I+S+ +HG ++R E+ I+  WR++G     + + +      Y V L I +         C CPN+ +G+SYL + +     +  R ELLLDS++V+L+WR SW RRL KF  +A  E C+
Sbjct:   43 VKVIYEATRSVCYTKGQAIECSPPFTNIAESIDIKATSTCGQFGQSEEIC---RYVLGQ--RKCDICDSSEK---FGTHLLTDRHQMNNETCWISGSVLPG---DTVNLTLSLGKRFEVYYISLQPCGQLPDSIALYKSSDFGITWKPWQYFSTDCYRAFRLPTSNEHNAQISLANIQEVLCVALKSPDIHDAIGKSSNIIAFSTTIGRPSTQPWSSALIDWMTMTDLRISLMRFPEHREEVQHDSNGLFLNPGLLKPSKVFRVSGSPNIGGFGINPALSETGALDMSQHLYQSDMHYAKTPNSKSPVHFSFSDLSIGGRCKCNGHANRCVRDRIVSTSSTKENDGLAKSQWGPLRCDCQHNTEGTDCERCSSGYLDRPWARGTSESANECKRCDCNLHSNSCIFSNQLYLMSMKVSGGVCQDCQHNTVGRRCHNCATGYYRDWTKPVSHDQVCLECRCHPIGSIANQHCDRKTGQCPCKPGVIGQACNRCQDGYKQTRLPDAPCIKAMEHYAHRRKENDQTSHPTKSQMSRLEPDTNCPPCERSKKRIRFKKFCRCEAVFRGIIKSRTIHGDLMRLEVGIQNTWRITGAAEHLLPKTASPNLPAYRVWLRIKNNSADKRHSFCLCPNLLVGQSYLFITRSHQVPYGDRMELLLDSQSVILRWRESWRRRLSKFVRRAARESCD 715          
BLAST of Netrin-1 vs. TrEMBL
Match: A0A4S2M819 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002075 PE=4 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 5.123e-136
Identity = 250/669 (37.37%), Postives = 355/669 (53.06%), Query Frame = 3
Query:  747 ISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEI-LPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMND----TLIKWITITDLRITLSRFDDQMSSYFDYGKYFLL-----------------KHRRGRDILNMSTFSVNDKSMS-----KVYYGVSDLSVGGRCQCYGHSNKCI-----------INNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYD-IIESSQTKKSDLNSKYMDMP-NTES--ECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFIS-EISQEQYAVPLWISHE---------EVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKC 2597
            I V+YE+ ++ C   G+   C PPF NIA+ A +  TS+CG     +  C      +      C  C ++ K   +    LTD     N T W SG V        +NI+++  K FEV+YV+LQ    LPD+I +YKS D GK W PWQY+S +C +AF LP + E   Q          C  L   + +   G++  ++ FS+TIGR  +      L+ W+T+TDLR++L+RF D            LL                 K++     L MS       + S      +++  SDL++GGRC+C GHSN+C+               G + CDC+HNT G DC+KC  G+ D  W RA++     CKRC CNLHS  C+F + +Y+ + + SGGVC+ CQHNT G +CH C +GYYRDWTKP+SH+  C +C+CH +GS     CD+K GQC CK GVIG+ C++C+ GY QTR    PCV+  +      +T    + +     P NTE   +C PC   R+RIRFKKFCRR++VFMG +ES    G   RFE++I+E WRV G   + +  + S      P+WI  +          +RC CP +  G SYL   +     H +R EL+LD  ++++ WR SW RRL KF  +A + +C
Sbjct:   44 IRVVYEDVRSPCHSEGRASQCMPPFTNIAEGAPVVATSTCGASDKTEKFCKQQVDATGRIQWRCEQCTSEDK---FPTHHLTDRHQMVNETYWVSGAVLRGQT---INITLSMGKTFEVYYVSLQPYGRLPDAIALYKSSDFGKTWHPWQYFSTDCFRAFRLPTSNEHNAQISAANIQEVLCVALKSSEDNEPYGRSLKVIAFSTTIGRPSSQPWSAALVDWMTMTDLRVSLTRFSDLADMTQHDASGLLLTPNLLSPAEVFRVGEVEKNKMSAGTLGMSRHHFQSDAASFMPDKGIHFAFSDLAIGGRCKCNGHSNRCVRDRLVDAAGKETGEWGPLRCDCQHNTAGIDCEKCAPGYLDRPWARATRELANECKRCDCNLHSLTCEFSQQIYLMSSKTSGGVCQNCQHNTVGRRCHHCASGYYRDWTKPVSHEQVCLECRCHPIGSVANEPCDRKSGQCPCKPGVIGQACNRCEEGYKQTRLSDHPCVRVMEHFAYRRKTVPPPVAASSHHQPINTEPHLKCPPCKPHRRRIRFKKFCRREAVFMGKVESYRAEGDKTRFEIRIRETWRVDGAAGRLLPKKASHSLPPFPVWIQSQLIGGDNGNPAIRCLCPELKTGESYLFFTQPYQIPHGNRMELMLDPSSIIIPWRESWRRRLNKFVRRAAKNRC 706          
BLAST of Netrin-1 vs. TrEMBL
Match: A0A5K3F9D3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 435.261 bits (1118), Expect = 2.345e-135
Identity = 251/728 (34.48%), Postives = 376/728 (51.65%), Query Frame = 3
Query:  753 VLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEI-LPDDICPHWKYYSSNHFRD-CSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDT----LIKWITITDLRITLSRFDDQMSSYF---DYGKYFLLKHRRGRD-----------------------------------ILN------------MSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCI-------------INNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYD-IIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQ--FISEISQEQYA-VPLWIS---------HEEVRCDCPNISLGRSYLILMK-YKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKKSKIKHNRINRVGKNKRSFLLTKN 2687
            V+YE+  + C    K Y CTPPF NIA+   +  TS+CG+    + +C  W   +    +  C  CD+ +  +    + LTD     N TCW SG V      + VN++++  K FE+FY++LQ C  LPDSI +YKS D G+ W PWQY+S +C +AF LP + E   Q          C  +    K    GQ  +++ FS+TIGR  + +    LI W+T+TDL+I+LSRF  +  S       G   ++ HRR R                                     LN            ++T  ++      VY+  SD++VGGRC+C GH+N+C+             I   G + CDC+HNT GADC++C  G+ D  W RA+  +   CK C+CNLHS  C F +  Y+ + + SGGVC  C+H+T G +CH C  G+YRDWTKP+SH + C KC+CH +GS     CD+K GQC CK GV G+ C++C  GY QTRS + PCVK  D ++ +    +S   +  +  P  +  C PC++  KR RFKKFCRR +VF   + S+E  G++VR  ++I +VWR  G ++Q    + + + Q   +PLW+               C CP   + +SYL + + Y+I  H  R ELLLD ++ +L W  +W RRL +F  +    +C+      S   ++++     ++R+ +  +N
Sbjct:   36 VIYESPNSVCYADNKAYLCTPPFTNIAEGIPVVATSTCGQGGRAERVCKSWTSQNGQKRQTYCETCDSRKAATSRGAERLTDRHITSNQTCWVSGKVAPG---STVNLTLSLGKRFEIFYISLQPCGPLPDSIALYKSSDFGRTWKPWQYFSTDCYRAFGLPTSSEHNAQISSANIQEVLCVAIKPPVKYNAQGQVSNVIAFSTTIGRPTSQSWSPALIDWMTMTDLQISLSRFPARRKSRTVERSGGDNTVVLHRRDRSSGQRRVPQKAPVFRLGGGRLFHQGAELEEMQADGTTLNATASTATNARNEVNTHEIHHDEDDAVYFAFSDIAVGGRCKCNGHANRCVRDRIVEKNAAGEEIVTWGPLRCDCQHNTVGADCERCAPGYLDRPWARATNEDANECKACECNLHSNSCTFSQYFYLLSKKVSGGVCEDCRHHTTGEKCHQCMEGFYRDWTKPISHPMVCLKCQCHPIGSIGSRPCDRKTGQCHCKTGVTGQTCNRCLDGYKQTRSKITPCVKAVDALVFAGSATRSSPQTSIVGQPTADDACPPCEKNNKRFRFKKFCRRQAVFRATVISQEARGELVRLVIRIHDVWRNKGSLAQRYLPAHVRRNQAPIIPLWVPLTKKPSTSRESHAVCVCPRFKIDQSYLFISQVYEIPFH-ERNELLLDQKSTILPWVENWRRRLMRFAIRQERGRCDAV----SDDPYSQVRITPDHRRNLIRPRN 755          
BLAST of Netrin-1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 352.443 bits (903), Expect = 4.558e-110
Identity = 213/612 (34.80%), Postives = 314/612 (51.31%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINND-GNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            HG    C P F+N A   ++  +S+CG   P   C   K       R C  CD       +    LTD  N  N TCW S     Q    +V ++++  K FEV YV++QFCS+ PDS+ I+KS D GK W+P+Q+YS  C+K FN P       Q   E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+T SR                           ++     D+    ++Y VSDL VGGRC+C GH+++C+   D G +VCDCKHNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  GYYRD +KP+SH  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   I  +  T  +    +  D    +S CK    K K    K   +  +V + +++S +  G+  +F + I  V++      Q  S I +      LW+  ++V C CP I  G+ YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:   41 HGAARRCIPDFVNAAFGKEVRASSTCGLKGPSRYCAQDK--GEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQS-ETGVQALQGNVTLTLSLGKKFEVTYVSVQFCSKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQNEQEA----VCTDAHADGRPLSGG----LVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSR---------------------------LTAPGEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIK---IPVAPPTTTASSPEEPADC---DSYCKASKGKLKINMKKYCKKDYAVQVHILKSDKA-GEWWKFTVNIISVYK------QGESRIRRGDQL--LWVRAKDVACKCPKIKTGKKYLLLGNDE--DSPGQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 596          
BLAST of Netrin-1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 353.984 bits (907), Expect = 1.605e-108
Identity = 212/612 (34.64%), Postives = 314/612 (51.31%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINND-GNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            HG    C P F+N A   ++  +S+CG   P   C   K       R C  CD       +    LTD  N  N TCW S     Q    +V ++++  K FEV YV++QFCS+ PDS+ I+KS D GK W+P+Q+YS  C+K FN P       Q   E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+T SR                           ++     D+    ++Y VSDL VGGRC+C GH+++C+   D G +VCDCKHNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  GYYRD +KP+SH  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   +   + T  S       +  + +S CK    K K    K   +  +V + +++S +  G+  +F + I  V++      Q  S I +      LW+  ++V C CP I  G+ YL+L   +      +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:  218 HGAARRCIPDFVNAAFGKEVRASSTCGLKGPSRYCAQDK--GEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQS-ETGVQALQGNVTLTLSLGKKFEVTYVSVQFCSKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQNEQEA----VCTDAHADGRPLSGG----LVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSR---------------------------LTAPGEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIK-IPVAPPTTTASSP-----EEPADCDSYCKASKGKLKINMKKYCKKDYAVQVHILKSDKA-GEWWKFTVNIISVYK------QGESRIRRGDQL--LWVRAKDVACKCPKIKTGKKYLLLGNDE--DSPGQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 773          
BLAST of Netrin-1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 343.969 bits (881), Expect = 1.612e-106
Identity = 211/610 (34.59%), Postives = 311/610 (50.98%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINND-GNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKC 2597
            +G+   C P F+N A   ++  +S+CG       C   +       R+C  CD       +    LTD  N  N TCW S   Y QH  N V ++++  K FEV YV+LQFCS  P+S+ IYKS D GK W+P+Q+YS  C+K FN P       Q   E   + +  D+           A  ++ FS+  GR        +  L  W+T TD+R+T SR                  H  G +  + S  + +       +Y VSDL VGGRC+C GH++KC+ + D G +VC+CKHNT GA+CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G++SGGVC  C+HNTAG  CH+C  GYYRD TK +SH  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   I  +S T       +  D    +S CK    K K    K   +  +V + V++  +  G+  +F + I  V++      +   ++        LW+  ++V C CP I  G+ YL+L        R +  ++ D  ++++ W+  W RRL+KFQ +    KC
Sbjct:   61 NGQPRRCIPDFVNAAFGKEVRASSTCGAQTAARYCVVTER-GEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQS-ESYVQHPQN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCKKMFNRPSRAAITKQNEQEAVCTDSHTDMRP--------LAGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSRL-----------------HTFGDENEDDSELARDS-----YFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIK---IPVASPTATYTSAEEPTDC---DSHCKASKGKMKVTMKKYCKKDFAVQVHVLKGDKA-GEWWKFTINIISVYKQGEHRIRRGDQL--------LWVRAKDVACKCPKIKPGKKYLLLGS-DDDDSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 620          
BLAST of Netrin-1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 264.233 bits (674), Expect = 3.199e-77
Identity = 146/393 (37.15%), Postives = 202/393 (51.40%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINND-GNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACK 1946
            HG    C P F+N A   ++  +S+CG   P   C   K       R C  CD       +    LTD  N  N TCW S     Q    +V ++++  K FEV YV++QFCS+ PDS+ I+KS D GK W+P+Q+YS  C+K FN P       Q   E      C D +   +  + G    ++ FS+  GR        +  L  W+T TD+R+T SR                           ++     D+    ++Y VSDL VGGRC+C GH+++C+   D G +VCDCKHNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  GYYRD +KP+SH  ACK
Sbjct:  218 HGAARRCIPDFVNAAFGKEVRASSTCGLKGPSRYCAQDK--GEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQS-ETGVQALQGNVTLTLSLGKKFEVTYVSVQFCSKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQNEQEA----VCTDAHADGRPLSGG----LVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSR---------------------------LTAPGEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACK 572          
BLAST of Netrin-1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 262.307 bits (669), Expect = 1.208e-76
Identity = 148/394 (37.56%), Postives = 207/394 (52.54%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINND-GNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKK 1949
            +G+   C P F+N A   ++  +S+CG       C   +       R+C  CD       +    LTD  N  N TCW S   Y QH  N V ++++  K FEV YV+LQFCS  P+S+ IYKS D GK W+P+Q+YS  C+K FN P       Q   E   + +  D+           A  ++ FS+  GR        +  L  W+T TD+R+T SR                  H  G +  + S  + +       +Y VSDL VGGRC+C GH++KC+ + D G +VC+CKHNT GA+CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G++SGGVC  C+HNTAG  CH+C  GYYRD TK +SH  ACK+
Sbjct:   61 NGQPRRCIPDFVNAAFGKEVRASSTCGAQTAARYCVVTER-GEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQS-ESYVQHPQN-VTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCKKMFNRPSRAAITKQNEQEAVCTDSHTDMRP--------LAGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSRL-----------------HTFGDENEDDSELARD-----SYFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACKE 421          

HSP 2 Score: 76.6406 bits (187), Expect = 5.532e-14
Identity = 73/290 (25.17%), Postives = 124/290 (42.76%), Query Frame = 3
Query: 1758 RCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYY-RDWTKPLSHDL-ACKKCKCHAVGST---NVN----SCDKKLGQCF-CKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKC 2597
            RC+CN H+  C  +++         GG+  +C+HNTAG +C  C   +Y R W +  + +   C  C C+        N+     S  +  G C  C+    GR C  CK GY   R M K         E      +   +   +  + +S CK    K K    K   +  +V + V++  +  G+  +F + I  V++      +   ++        LW+  ++V C CP I  G+ YL+L        R +  ++ D  ++++ W+  W RRL+KFQ +    KC
Sbjct:  301 RCKCNGHASKCVKDRD--------GGGLVCECKHNTAGAECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYY--RDMTKAISHRRACKEIPVASPTATYTSAEEPTDCDSHCKASKGKMKVTMKKYCKKDFAVQVHVLKGDKA-GEWWKFTINIISVYKQGEHRIRRGDQL--------LWVRAKDVACKCPKIKPGKKYLLLGSDDD-DSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 570          
BLAST of Netrin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009682.1 (pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 gene:ENSPMAG00000008750.1 transcript:ENSPMAT00000009682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 7.203e-47
Identity = 109/345 (31.59%), Postives = 163/345 (47.25%), Query Frame = 3
Query: 1086 KNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY-LQTRSMLKPCV 2099
            K F++ YV L+F +  P+S  IYK       W P+QYYS +C+  +     +        +   +P C D          G     + FS+  GR        +  L  W+T T++R+TL+R +        +G      H                K +   YY +SD +VGGRC+C GH+++C+ N  G + C C+HNT GADC+KC   ++D  W RA+  +   C  C CN  +  C F+  +Y  TG   GG C  C+ NT G  C  C   +YR      S    C  C C+ VGS +   CD++ G+C CK+GV+G +CD+C  G+     +  +PC 
Sbjct:    2 KAFDITYVRLKFHTSRPESFAIYKRASMDGPWTPYQYYSGSCEPTYG---KRNRGFLRSGDDEQTPLCTDEFSDISPLTGGN----VAFSTLEGRPSAYNFDNSPVLQDWVTSTEIRVTLNRLNT-------FGDEVFNDH----------------KVLRSYYYAISDFAVGGRCKCNGHASECVKNELGALACKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATGH--GGHCTNCRDNTDGKTCERCLENFYR-----RSASEHCLPCNCNPVGSYS-RQCDEQ-GRCSCKQGVMGERCDQCLPGFHSMDEAGCRPCT 307          
BLAST of Netrin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004606.1 (pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004606.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 1.304e-29
Identity = 70/223 (31.39%), Postives = 104/223 (46.64%), Query Frame = 3
Query: 1086 KNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGR------KMNDTLIK-WITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERAS 1733
            K F++ YV L+F +  P+S  IYK       W P+Q+YS  C++ F LP        +    +L    F        GN+        FS+  GR        ND L + W+T TD+R++L R +      F                        + K +   YY VSDL+VGGRC+C+GH+++C   +DG +VC C+HNT G DC++C    +   W +AS
Sbjct:    4 KAFQITYVRLRFHTSRPESFAIYKRTSPASPWQPYQFYSGTCERTFGLPSRGFLRAGDEERTALCSDEFSDISPLTGGNVA-------FSTLEGRPGALAFDGNDKLQQEWVTATDVRVSLRRLNTFGDEVFG-----------------------DPKVLRSYYYAVSDLAVGGRCKCHGHASECGRGSDGRLVCRCQHNTTGDDCERCLPSHNSRPWAQAS 196          
BLAST of Netrin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004614.1 (pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 1.546e-28
Identity = 64/213 (30.05%), Postives = 100/213 (46.95%), Query Frame = 3
Query: 1092 FEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERA 1730
            F++ YV L+F +  P+S  IYK       W P+Q+YS  C++ F LP        +    +L    F        GN+  +     F ST    ++    +W+T TD+R++L R +      F                        + K +   YY VSDL+VGGRC+C+GH+++C   +DG +VC C+HNT G DC++C    +   W +A
Sbjct:    1 FQITYVRLRFHTSRPESFAIYKRTSPASPWQPYQFYSGTCERTFGLPSRGFLRAGDEERTALCSDEFSDISPLTGGNVAFSTLEGLFHST--GPLSSATQEWVTATDVRVSLRRLNTFGDEVFG-----------------------DPKVLRSYYYAVSDLAVGGRCKCHGHASECGRGSDGRLVCRCQHNTTGDDCERCLPSHNSRPWAQA 188          
BLAST of Netrin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008925.1 (pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 gene:ENSPMAG00000008054.1 transcript:ENSPMAT00000008925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 5.810e-27
Identity = 98/363 (27.00%), Postives = 155/363 (42.70%), Query Frame = 3
Query: 1092 FEVFYVALQFC-SELPDSITIYKSHDNGKKWIPWQYYS---KNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDT----LIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGN-IVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKS-------GGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSC-----------DKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCV 2099
            F+V YV ++   S  P +  + +S D G  + PWQYYS     C   + + PT   P+    +  +  + + +        L  A   +  S   GR   D     L+ + +   +R+ L R     +          L HR  R++  + T         + YY + D+SVGG C C GH++ C  N D   + C C+HNT G +C  C  G++  +W   +  N  +C++C C+  ++ C ++  V       S       GGVC  C  NTAG  C  C +G+YR      +    C+ C+C   GS +   C           D   GQC C+ G  G +C++C   Y +     KPC+
Sbjct:    3 FQVAYVIVKAANSPRPGNWILERSLD-GATYHPWQYYSVSDSECLTRYGITPTVGNPVYRRDDEVICTSYYVVL-------LMLARGKIHTSLINGRPSADDPSPKLLDFTSARYIRLRLQRIRTLNA------DLMTLSHRDPREVDPIVT--------RRYYYSIKDISVGGMCICSGHASTCPWNEDTQKMECQCEHNTCGENCQHCCPGYNQRRWRPGTINNGNTCEKCNCHGKTEDCYYDAEVDRTNRSLSVHGRFSGGGVCVNCSANTAGTNCETCRDGFYRPTGVLPNDPYPCRLCQCDPQGSLS-QVCIKDEKHADPEKDLSPGQCLCRPGFAGERCERCAFAY-RGYPDCKPCL 341          

HSP 2 Score: 78.9518 bits (193), Expect = 3.402e-15
Identity = 50/147 (34.01%), Postives = 76/147 (51.70%), Query Frame = 3
Query: 1683 CDKCKEGFHDLQWERAS------KLNPF-SCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY--LQTRSMLKPC 2096
            CD+C  G+  L+ ER +        +P  SC+RC+CN + +     +    +TGQ     C +C+  TAG  C  C +G+Y D T        C+ C+CH  G+T    CD+  GQC C+  V+GR C++C IG+  L + +   PC
Sbjct:  704 CDQCLPGYIGLRCERCADDFFGEPSSPGGSCRRCECNGNEEAWGGGRVCDARTGQ-----CLRCRERTAGFHCERCADGFYGDATG----TGGCQPCQCHPEGAT-APQCDRINGQCPCRPSVVGRTCEQCAIGFYGLSSGAGCSPC 840          

HSP 3 Score: 62.7734 bits (151), Expect = 3.959e-10
Identity = 51/184 (27.72%), Postives = 77/184 (41.85%), Query Frame = 3
Query: 1590 RCQCYGHSNKCIINND----------------GNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLH---SQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGY--YRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTR 2078
            +C C+G +  C  + +                G +  +C  NT G +C+ C++GF+       +  +P+ C+ CQC+     SQ C  ++         S G C  C+   AG +C  C   Y  Y D          CK C C   G TN + C +    C CKE V G  CD+C+ G+   R
Sbjct:  212 KCNCHGKTEDCYYDAEVDRTNRSLSVHGRFSGGGVCVNCSANTAGTNCETCRDGFYRPTGVLPN--DPYPCRLCQCDPQGSLSQVCIKDEKHADPEKDLSPGQC-LCRPGFAGERCERCAFAYRGYPD----------CKPCLCSMAGGTNDDPCSEP---CVCKERVEGEHCDRCRAGFYDLR 379          

HSP 4 Score: 58.5362 bits (140), Expect = 6.297e-9
Identity = 48/167 (28.74%), Postives = 67/167 (40.12%), Query Frame = 3
Query: 1590 RCQCYGHSNKCIINNDGNIVCD--------CKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY 2066
            RC+C G+         G  VCD        C+  T G  C++C +GF+              C+ CQC+         +        +  G C  C+ +  G  C  C  G+Y      LS    C  C CH VG+  V +C    G+C C  GV GR CD+C  G+
Sbjct:  736 RCECNGNEEA----WGGGRVCDARTGQCLRCRERTAGFHCERCADGFY------GDATGTGGCQPCQCH--------PEGATAPQCDRINGQC-PCRPSVVGRTCEQCAIGFYG-----LSSGAGCSPCPCHPVGTAGV-ACSAD-GRCHCWPGVEGRSCDRCTSGH 876          

HSP 5 Score: 55.0694 bits (131), Expect = 8.808e-8
Identity = 45/170 (26.47%), Postives = 67/170 (39.41%), Query Frame = 3
Query: 1557 YYGVSDLSVGGRCQCYGHSNKCII-NNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIG 2063
            +YG+S  +    C C+      +  + DG   C C    EG  CD+C  G +  +           C  C C+  + HC  E    +            C  NT G +CH C + ++      ++    C+ C C A  S     CD+  GQC C +G  GR C +C  G
Sbjct:  828 FYGLSSGAGCSPCPCHPVGTAGVACSADGR--CHCWPGVEGRSCDRCTSGHYGFKEG--------GCTPCNCSHTNHHCDQETGRCL------------CPPNTEGTRCHRCIDDHWG-----VNPHAGCRACNCSAAHSRGAR-CDEASGQCSCLDGYGGRTCGECAQG 969          

HSP 6 Score: 53.1434 bits (126), Expect = 3.170e-7
Identity = 47/150 (31.33%), Postives = 65/150 (43.33%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNL-HSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGS----------TNVNSCDKKLGQCFCKEGVIGRKCDKCKIG 2063
            C C  NTEG  C +C     D  W     +NP + C+ C C+  HS+  + ++     +GQ S      C     G  C  C  G    W  P     AC+ C+CH  G+           ++  CD++ GQC CKE V G +CD C  G
Sbjct:  903 CLCPPNTEGTRCHRCI----DDHW----GVNPHAGCRACNCSAAHSRGARCDE----ASGQCS------CLDGYGGRTCGECAQGR---WGYP-----ACRPCECHPEGTRANTCPAPPTGSLCGCDERTGQCACKENVGGTRCDACLPG 1026          
BLAST of Netrin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007784.1 (pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1 gene:ENSPMAG00000007035.1 transcript:ENSPMAT00000007784.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 8.974e-22
Identity = 69/278 (24.82%), Postives = 124/278 (44.60%), Query Frame = 3
Query: 1062 VNISIAFKK-NFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRF--DDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDG-NIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTG---QKSGGVCRKCQHNTAGN 1874
            V +SI  +  +++VFYV +QF S  P+ + I +    G  W+ WQ ++K+C   +N+  ++  P    LE   S  C    ++            +P S     + N T        +LR   + F     + ++    +  +L   R   +  ++   +      + Y+ VS++ V GRC+C+GH+ +C  +      +C  + NTEG +C+ C+  F D  W      N  +C+ C C   +  C++E  +    G   +  GGVC+ C  NT G+
Sbjct:  107 VAVSIELRGGSYQVFYVIVQFLSPQPEGVRIQRRPAAGSPWVDWQVFAKDCVSMYNM--SKNGP----LEKPDSVNCLQFPRE------------VPLS-----RGNVTFSVLTPEPNLRPGYNAFYATPALQAFVLAAEVRVLLEGRLLGVAGVAGGPL------RPYHAVSEVIVSGRCECHGHAERCDSSTTPYRCLCSAQSNTEGPNCELCRPLFRDKPWRAGDTRNQNACRPCLCYGRALSCRYEAILDPHPGLHWRGGGGVCQDCTQNTTGS 355          

HSP 2 Score: 63.5438 bits (153), Expect = 1.855e-10
Identity = 41/145 (28.28%), Postives = 60/145 (41.38%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLA-CKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRS 2081
            C C     G  C  C+ GF+ L+ + +       C+ C C+        E+         + G C    H   G +CH C + YY       + +L  C++C C   GS +  SC    GQC CK   +GR+CD C  G    R+
Sbjct:  658 CACLPGWAGRRCSTCQAGFYRLEGDASG------CRPCDCH--------ERGSAHAACDGNSGQCACTSHTVGGRRCHRCAHSYYG-----FAQELGRCRECACSTAGSLD-TSCHPDTGQCSCKALAMGRRCDACTHGASHLRA 782          
BLAST of Netrin-1 vs. Ensembl Nematostella
Match: EDO36836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI5])

HSP 1 Score: 293.893 bits (751), Expect = 5.999e-89
Identity = 186/597 (31.16%), Postives = 290/597 (48.58%), Query Frame = 3
Query:  807 CTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQA--ESILPFSSTIGR----KMNDTLI--KWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESE-CKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKF 2570
            C P F ++A    + V+ +CGE      CP            C  CD     + +  K LTD  N+ N TCW + PV ++    +V + ++F K +++ YV+LQFC   PDS+ IYKS D GK W  +Q+YS  C+K +      E    E  + +L            DG+L +      + FS+  GR    KM+ + +  +W+  TD+++  +                + +  R RD L               YY VS+ +VGGRC C GH+++C+ + +G  VCDCKHNT G DC  C+  F+D  W  A+  +   CK C CNLH++ C F   ++  +G +SGGVC KC+HNTAG  CH+C  G+Y+D  K ++H   C++C CH  GS     C++  GQC CKEGV+GR CDKC  GY  T+S + PC++T +++ S ++            P +  + C  C     +++             V   K++    VR  + I  ++    K S+       + Y   +WI   + RC CP +  GRSY I    +      +  ++L+ R+V+L W     +R+ +F
Sbjct:   15 CQPAFHDLAYNKDVYVSHTCGE-KSRRFCPPMSVRGRT---ACGFCDERNAKTSHPAKYLTDVHNENNVTCWQADPVQSRE---NVTLILSFGKTYDITYVSLQFCGIRPDSMGIYKSMDYGKSWQAYQFYSSRCEKMYGRVTNGEIS-PENEQVALC----------TDGHLLRPLYGGRIAFSTLEGRPSASKMDYSAVMQEWVMATDIKVEFN---------------MISRSARPRDSL---------------YYAVSEFNVGGRCHCNGHASECVSDRNGRQVCDCKHNTVGVDCGACRPFFNDRPWRPATHHSANECKMCNCNLHARTCVFSMELFKLSGGRSGGVCVKCRHNTAGRYCHYCREGFYKDPNKHITHIKVCRQCNCHPHGSRG-RVCNQSTGQCPCKEGVVGRSCDKCAPGYKSTKSNIVPCIETPNVVMSQES----------STPRSRDQGCSQCRRVPLKVKRFCRKDFALKVTVVRVEKKLPNSWVRATVNINTLF----KRSRTRRVRRGDGY---VWIKKRDFRCRCPKLKPGRSYFIAGNLR--GQSRKRSIVLNGRSVVLPWNEKLLKRIYRF 543          
BLAST of Netrin-1 vs. Ensembl Nematostella
Match: EDO36523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF3])

HSP 1 Score: 190.66 bits (483), Expect = 1.724e-49
Identity = 130/450 (28.89%), Postives = 213/450 (47.33%), Query Frame = 3
Query:  789 HGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRK------MNDTLIKWITITDLRITLSRFDDQMSSYFD--YGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKC----IINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWT-KPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQ-TRSMLKPC 2096
             G+   C P F N A   ++   ++CG+  P   C           ++C +C++      +    +TD  +  N T W+      ++    V +++   K+++V Y+ ++F S  P+S+ IYK      KWIP+QY+S  C+K + +  T         + +L    F        GN+        FS+   R        +  L +W+T   +RI L R    M+++ D  +G   +L+                       YY + DLS+GGRC+C GH+++C    + +    + C C+H+TEG DC++CK  ++D  W RAS  N   C RC CN  ++ C F++ +Y +TG   GG C+ C+ NT G  C  C   +YR  + +P      C  C C+ VGS ++  C+ + GQC CK GV G KCDKC+  Y   +++  +PC
Sbjct:   25 QGRAQRCMPQFGNAAFGKRVISNNTCGDP-PKKFCVQTGVLEVR--KECEMCNSSDPALEHPALKITDIKDDTNRT-WWQSETLLENPDKPVTLTLDLGKSYDVSYIRIRFRSPRPESMAIYKKTTPSSKWIPYQYFSATCEKTYGV-TTNGIVDPRNQQVALCTDAFSTITPLTGGNVA-------FSTLEDRPDAYNFDNSPALQEWVTAVAVRIHLRR----MNTFGDEVFGDPNVLR---------------------SYYYAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALYRQTGH--GGRCQNCKQNTDGPNCERCKENFYRKTSLEP------CVACGCNPVGSVSLQ-CNSE-GQCRCKPGVTGIKCDKCQANYFGFSQTGCRPC 427          

HSP 2 Score: 85.5001 bits (210), Expect = 6.458e-17
Identity = 54/164 (32.93%), Postives = 74/164 (45.12%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHA-VGSTNVNSCDKKLGQCF-----CKEGVIGRKCDKCKIGY 2066
            CQCYGHS+ C   +     C+CKHNT G  CDKC +G+    +   ++  P  CK+C C   ++  +   NV          VC  C     GN C  C +GYY D          C+KC C   +    + SCD+  G C       + G I  +C+ C IGY
Sbjct:  704 CQCYGHSDTC---DPVTGKCNCKHNTTGIRCDKCIDGY----YGNPTQGTPDDCKKCPCKFGTRCIQIGANV----------VCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCSGNIDPNAIGSCDRLTGDCLKCIHNTRNGPIS-QCELCAIGY 849          

HSP 3 Score: 60.4622 bits (145), Expect = 3.438e-9
Identity = 55/203 (27.09%), Postives = 78/203 (38.42%), Query Frame = 3
Query: 1638 GNIVC-DCKHNTEGADCDKCKEGFH-DLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAG---NQCHFCDNGYYRDWT------------------KPLSHDL-------------------------------------ACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY 2066
             N+VC DC     G  CD C++G++ D   +R +   P +C++C C+ +      + N  + +  +  G C KC HNT     +QC  C  GYY + T                   P  HD                                       C+ C C   GS N N+C    GQC CK GV GR+CD+C I +
Sbjct:  766 ANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGA---PTTCQKCNCSGN-----IDPNA-IGSCDRLTGDCLKCIHNTRNGPISQCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEYWNVASGKGCEPCNCDTTGSWN-NTCSVTTGQCHCKPGVTGRRCDQCSIDH 958          

HSP 4 Score: 55.8398 bits (133), Expect = 8.818e-8
Identity = 52/184 (28.26%), Postives = 74/184 (40.22%), Query Frame = 3
Query: 1593 CQCY--------GHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIE 2120
            C+CY        GH        D    C C  N  G  CD C+  +    W  AS      C+ C C+       +     + TGQ     C  C+    G +C  C   +Y         +L C  C C+  GS NV +CD++ G C C+ GV+G KCD C+  +    +    C   YD+I+
Sbjct:  864 CECYVQGTVSPPGHDPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEY----WNVASGK---GCEPCNCDTTG---SWNNTCSVTTGQ-----CH-CKPGVTGRRCDQCSIDHY------AFSELGCLACNCNLQGSLNV-TCDEQ-GVCQCRPGVLGIKCDSCQENFHNLTAGCIACPPCYDVIQ 1023          

HSP 5 Score: 55.4546 bits (132), Expect = 1.081e-7
Identity = 47/146 (32.19%), Postives = 67/146 (45.89%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKC------KCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGY 2066
            C C    +G +C++CK+G+      +A   + ++ C  CQC  HS  C               G C  C+HNT G +C  C +GYY + T+    D  CKKC      +C  +G+ NV   D       C EG +G  CD C+ GY
Sbjct:  670 CSCPKEYKGNNCEQCKDGYT----RQAGSTDRYAQCVPCQCYGHSDTC-----------DPVTGKC-NCKHNTTGIRCDKCIDGYYGNPTQGTPDD--CKKCPCKFGTRCIQIGA-NVVCTD-------CPEGHVGNLCDMCQDGY 789          
BLAST of Netrin-1 vs. Ensembl Nematostella
Match: EDO39502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X8])

HSP 1 Score: 179.874 bits (455), Expect = 4.960e-46
Identity = 122/441 (27.66%), Postives = 200/441 (45.35%), Query Frame = 3
Query:  828 IAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYN----------QHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNL--GQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIV-------CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKK--------LGQCFCKEGVIGRKCDKCKIGYL 2069
            + +  KI  +S+CG   P++ C      +   + DC ICD        S    T+P  QF+H   +    ++          ++G  +V + +  +  F   ++ ++F +  P  + I +S D GKKW  ++Y+S +C K F   P  E    + ++  +    +   +   +G +     +S +P  +    K+ + L     IT++RI  ++                  H  G D+L+        +   K YY V DL + G C CYGH+ +C+               C+C HNT G +C++C++G+ D+ W  A   NP  C++C CN H+  C+F+  VY  +G  SGGVC+ C+HNT G  C  C   +Y+D +K  S   AC  C C   G  N   C+ K         G+C CK  V G +CD+CK G+ 
Sbjct:   32 VGRENKIYASSTCGLRGPEEYC---VVSNLQDYGDCHICD--------SRPYQTNP--QFSHVPKYMLSSFDGRKKDEWWQSENGRENVYLQLDLESEFHFTHLIMRFRTFRPAGMVIERSWDYGKKWQIYRYFSADCDKIFPGIPKGE---PKDIDDVICTNKYSTVEPSTNGEVIFRALKSQIPIKNAYSSKVQNLL----KITNIRINFTKL-----------------HTLGDDLLDPRP-----EIKRKYYYAVYDLVIRGSCSCYGHAEQCLPEPGQPTTPGMVYGRCNCTHNTTGKNCERCQDGYFDVPWRPADADNPNECRKCNCNGHAVKCRFDPAVYQASGNVSGGVCQDCEHNTVGRNCERCKPLHYQDPSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGFF 430          

HSP 2 Score: 81.2629 bits (199), Expect = 1.549e-15
Identity = 63/210 (30.00%), Postives = 86/210 (40.95%), Query Frame = 3
Query: 1593 CQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGV-CRKCQHNTAGNQCHFCDNGYYRDWTKPL---------------------------------SHDLACKKCKCHAVG---------------STNVN---SCDKKLGQCFCKEGVIGRKCDKCKIGY 2066
            C+CYGH++ C  N    +  DC+HNT G +C+ C  GF+ +    A+K  P  CKRCQC   S   KF ++ Y+ T      V C KCQ    G QC  C +GYY +   P                                  +    C++CK    G                TN     SC+ K GQC C   V G++CD+C  G+
Sbjct:  850 CRCYGHASSC--NPKTGVCVDCQHNTVGKNCEACAVGFYGI----ATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGYYGNPLVPGGSCKPCSCNNNIDPTVSGNCDRLTGSCLQCLYNTAGFNCERCKPGYFGDAIARNCTSCVCDKKGTNPGFHYSCNHKTGQCNCLPDVEGKQCDRCAEGF 1053          

HSP 3 Score: 69.3218 bits (168), Expect = 6.683e-12
Identity = 46/138 (33.33%), Postives = 63/138 (45.65%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIG 2063
            C CK N  G  CD+CK GF +L  +     NP  CK C CN      +   +          G C  C+    G  C  C + Y+   + P      C  C C   GS + N CDK+ GQC C++G+ GR+C++ K G
Sbjct:  411 CICKRNVGGVRCDRCKAGFFNLTTD-----NPDGCKACGCNPLGTIGECNPDT---------GRC-TCKRYVEGEDCDRCASEYWGLSSTPA----GCSNCACDVGGSYD-NQCDKQTGQCRCRKGITGRQCERVKTG 528          

HSP 4 Score: 59.3066 bits (142), Expect = 6.888e-9
Identity = 41/135 (30.37%), Postives = 63/135 (46.67%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKC 2054
            C+C  + EG  CD+C EGF +L   +        C++C C +       E ++     Q +G    +C+    G +C  C++ +   W  P      C  C C+  GS ++  CD+  G+C CK G IG KCD C
Sbjct: 1035 CNCLPDVEGKQCDRCAEGFWNLSSGKG-------CQQCDCCI-------EGSLRSMCNQITGQC--QCKAGFGGPRCCECEDNF---WGSPPD---GCSACNCNPAGSVHL-QCDRDTGKCLCKVGHIGDKCDMC 1146          

HSP 5 Score: 55.0694 bits (131), Expect = 1.606e-7
Identity = 66/249 (26.51%), Postives = 86/249 (34.54%), Query Frame = 3
Query: 1542 SMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCD-------CKHNTEGADCDKCKEGFHDLQ--------WERASKLNPFS------------------------------CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNS---------------CDKKLGQCFCKEGVIGRKCDKCKIGY----LQTRSMLKPC 2096
            SMS V Y   D +V   C   G       + +G +VCD       CK N  G  CD+C  G              +R   ++ F                               C+ C+C  H+  C  +            GVC  CQHNT G  C  C  G+Y   TK   +D  CK+C+C    S N  S               CDK      C+ G  GR+C++C  GY    L      KPC
Sbjct:  739 SMSSVIY---DGAVACNCDPKGTQR----DANGTLVCDPIGGQCKCKSNVIGQRCDRCAPGSFGFSNKGCSACDCDRIGAIDNFCNILTGQCQCRNWASGRQCSLCPPNMWGFPLCRPCRCYGHASSCNPKT-----------GVCVDCQHNTVGKNCEACAVGFYGIATKGTPND--CKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDK------CQVGYTGRQCEECADGYYGNPLVPGGSCKPC 961          

HSP 6 Score: 53.9138 bits (128), Expect = 3.651e-7
Identity = 52/175 (29.71%), Postives = 76/175 (43.43%), Query Frame = 3
Query: 1557 YYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCD--------CKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCK 2057
            YYG + L  GG C+    +N       GN  CD        C +NT G +C++CK G+      R       +C  C C+    +  F  +   KTGQ +      C  +  G QC  C  G++      LS    C++C C   GS   + C++  GQC CK G  G +C +C+
Sbjct:  947 YYG-NPLVPGGSCKPCSCNNNIDPTVSGN--CDRLTGSCLQCLYNTAGFNCERCKPGYFGDAIAR-------NCTSCVCDKKGTNPGFHYSCNHKTGQCN------CLPDVEGKQCDRCAEGFWN-----LSSGKGCQQCDCCIEGSLR-SMCNQITGQCQCKAGFGGPRCCECE 1099          
BLAST of Netrin-1 vs. Ensembl Nematostella
Match: EDO36501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF6])

HSP 1 Score: 169.474 bits (428), Expect = 8.985e-43
Identity = 120/421 (28.50%), Postives = 187/421 (44.42%), Query Frame = 3
Query:  813 PPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLN-----HVNISIAFKKNFEVF-YVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERA-SKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKC 2054
            P F    +   ++ TS+CG        P  +Y        C  C+       + I+ + D     + T W S   ++ +  N      VN+SI+F K +++  ++   F S  P    + KS D G+ W P QYYS NC+K F +  T     + G   +     +  +  Q++G +         +    R+ N                S FD Q+  Y       L     G D L ++   V   ++ + YY VSDL V  RC+C+GH+  C   ++    CDC HNT G DC++C   F++  W  A S+  P  C+RC+C+ H+  C + +       Q+  G C  C HNT G+ C  C + +YR+ +  L+H   C  C C   G TN  +C++  GQC C+  V GR+CD C
Sbjct:   36 PRFAAKMKHRAVSSTSTCGS-------PPSEYCRVKPLNGCFKCNASSPTERHPIEYIADKSPGSDATFWQSETWWDWYQKNPRDDLKVNVSISFNKTYDITGHIMFTFESPRPSKAILEKSFDKGQTWDPLQYYSFNCRKDFGMENTDPTENRFGDFSAKCTEKYSSSSPQQNGKV---------TFDFLRRYNKA--------------SFFDTQVQQYLSATDLRLRMEYPGTDGLEVAKDEV---TLKQYYYAVSDLEVIARCKCHGHARWCDFPHETGKNCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECHSHADSCTYSQ-------QEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNNGTCNQTTGQCECRANVTGRQCDSC 416          

HSP 2 Score: 55.0694 bits (131), Expect = 1.746e-7
Identity = 48/173 (27.75%), Postives = 67/173 (38.73%), Query Frame = 3
Query: 1650 CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQ-----CNLHSQHCKFEKNVYMKT---------GQKSGGVCRKCQHN---------------------TAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIG 2063
            C CK    G  CDKCK GF++     +S   P  C         CN  S  C  +  V  +T         G  +G  C +C+ N                     T G +C  C  G+Y ++T        C+ C CH  GS +   C+ + G C CK   +G KC+ C+ G
Sbjct:  754 CQCKPGVTGRTCDKCKPGFYNFT---SSGCAPCDCVSTGSHHLVCNAVSGQCPCKPGVITRTCSRCNDSFYGYTTGSGCVECRCNMSGSADAQCDDVTGNCTCKNSTDGAKCAECRFGFY-NFTSA-----GCQACNCHEGGSQS-QQCNLQTGICTCKSNALGEKCESCRPG 916          
BLAST of Netrin-1 vs. Ensembl Nematostella
Match: EDO36500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF5])

HSP 1 Score: 156.762 bits (395), Expect = 7.358e-39
Identity = 131/488 (26.84%), Postives = 215/488 (44.06%), Query Frame = 3
Query:  705 SILLLGFSFYFSVAISVLYENKQTTCEFH-------GKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNS--IYSIKSLTD-----PLNQFNHTCWFSGPVY--NQHGLNH------VNISIAFKKNFEVF-YVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPP-TQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLS-RFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIV---CDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSC------DKKLGQCFCKEGVIGRKCDKCKIGY 2066
            ++L         V   V+  N Q TC F        G+   C P    ++    +T +++CG           KY        C  CD +  NS   + + +L D     P     +T W S   +  NQ GL+       VNI+++F K +++  ++   F S+ P ++   KS+D G  W     Y+  C + +N+ P +   P      Y     C +     +   LG  E I      I    N  +  ++++TD+R+ L     D M   +                        ++++++K+YY +S++ V GRC C GH+  C     G I+   C+C+HNT G DC+ C+  F++  W RA++ +   C+ C CN H+  C + + +         G+C+ CQHNT G+ C  C   +YRD +KP++H  AC       +G TN  SC       +++GQC CK  V GR+CD+C  G+
Sbjct:    2 AVLKATLEILCVVGSLVVCLNSQNTCRFETCYERDTGRATPCMPFTSFMSLTRNVTTSNTCGTT-------RAKYCELPGPEPCYYCDANSSNSNEQHPVTNLVDNELVLPFYAQKYTWWQSQTWWETNQLGLSSIENPPKVNITLSFGKRYQLSGHIKATFYSKRPKAMCFDKSNDFGHTWETLLCYAWRCDRFYNMEPQSNPDPANPFKLY-----CTEEYSGHEPRKLGIVEFIASKRYEICDYFNPEVQDYLSVTDVRLRLEYPASDGMELLYQ-----------------------DEQTLNKLYYAISNVEVTGRCSCNGHAMGC----SGPIMSRRCECEHNTMGTDCEMCEPLFNNRPWMRANQTHGNECQECNCNNHATSCVYNETLGY-------GLCKGCQHNTQGDHCQNCTAKHYRDLSKPINHVNAC-------LGITNNGSCLTQATDTEQIGQCSCKPNVYGRRCDQCIPGH 436          

HSP 2 Score: 55.4546 bits (132), Expect = 1.327e-7
Identity = 47/147 (31.97%), Postives = 63/147 (42.86%), Query Frame = 3
Query: 1653 DCKHNTEGADCDKCKEGFHDLQWERASKLNPFS-CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDN---GYYRDWTKP----LSHDLACKKCKCHAVGS--TNVNSCDKKLGQCFCKEG--VIGRKCDKCK 2057
            +C  N  G  C+ C EG+      +     PF  C  C CN  S+ C  E            GVC  C+  T G +C  C N   G      KP    LS D  CK C C+  G+  +N + CD+  GQC C     + G+ CD+C+
Sbjct: 1075 ECHRNYTGLSCEVCAEGY----TRQPMGGTPFDRCVLCSCNDRSRFCHPET-----------GVCTDCKIGTHGYRCELCTNNVQGPECVRCKPQYWGLSKD-GCKACDCNLPGTLYSNTSVCDQTTGQCSCNATLHIGGQLCDRCE 1205          

HSP 3 Score: 51.2174 bits (121), Expect = 2.112e-6
Identity = 34/77 (44.16%), Postives = 39/77 (50.65%), Query Frame = 3
Query: 1833 GGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIG 2063
            GG C  C+   AG +C+ C  GYY      LS    CKKC+C   GS     CD   G+C CK  V G KCD CK G
Sbjct:  780 GGQC-PCKPGVAGLKCNHCLPGYY-----ALSSS-GCKKCECSMSGSI-TPVCDNADGKCQCKANVEGAKCDACKYG 848          
BLAST of Netrin-1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 352.058 bits (902), Expect = 7.993e-110
Identity = 216/653 (33.08%), Postives = 334/653 (51.15%), Query Frame = 3
Query:  669 FIRVLMNCFLFNSILLLGFSFYFSVAISVLYENKQTTC-EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQ-EQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
             +R +    L  S+        + + +     +    C + HG    C P F+N A   ++ V+S+CG+                  R+C  CD       +    LTD  N  N TCW S   + Q+  N V ++++  K FEV YV+LQFCS  P+S+ IYKS DNGK W+P+Q+YS  C+K +N P       Q   E   + +  D+              ++ FS+  GR        +  L  W+T TD+++  SR                  H  G +  + S  + +       +Y VSDL VGGRC+C GH+++C+ + DG++VCDCKHNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD +KP+SH  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   I  S  T  +    +  D    ES CK    K K    K   +  +V + ++++ ++ G+  +F + I  V++      Q  S I + +Q+   LW+  ++V C CP I  G+ YL+L   ++     +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:    1 MMRAVHAVLLAASLWCRSAFGGYGIGLFAAQTSPPDPCYDEHGNPRRCIPDFVNAAFGKEVKVSSTCGKTPSRYCVVTSAEKGEERTRNCHSCDASDPKKYHPPAYLTDLNNPHNLTCWQS-ENFIQYPQN-VTLTLSLGKKFEVTYVSLQFCSPRPESMVIYKSMDNGKTWVPFQFYSTQCRKMYNKPNRAVITKQNEQEAVCTDSHTDM--------YPLTGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVVFSRL-----------------HTFGDENEDDSELARDS-----YFYAVSDLQVGGRCKCNGHASRCVKDRDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIK---IPVSPPTTPASSTEEASDC---ESYCKASKGKLKINMKKYCKKDYAVQVHILKADKM-GEWWKFTVNIISVYK------QGESRIRRGDQF---LWVRAKDVACKCPKIKPGKKYLLLGNDEV--SPSQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin-1 vs. Ensembl Medaka
Match: ntn2 (netrin-3 [Source:NCBI gene;Acc:101160359])

HSP 1 Score: 352.443 bits (903), Expect = 1.264e-109
Identity = 211/664 (31.78%), Postives = 330/664 (49.70%), Query Frame = 3
Query:  672 IRVLMNCFLFNSILLLGFSFYFSVAISVLYENKQTTC-EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMN------DTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHR-------------HREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +RV   C L   +L+   S +   +     +     C +  G    C P FIN A   ++ V+S CG           +       R C ICD       +    LTD  +  N TCW S  +      ++V ++++  K FE+ YV+LQFCS  P+S+ IYKS D GK W+P+Q+YS  C++ +N P       Q   E   +    DL           +  ++ FS+  GR  +        L  W+T+TD+R+   R   Q+S  F  G      +  GRD   ++  S    ++S  +Y V D  VGGRC+C GH+++C+ + +G +VCDCKHNTEG +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD  +P++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   +  ++    ++      +  + ES CKP     K    K   +  +V + V++ + V G   +F + +  V++  G+  +    I        LW+  +++ C CP I + + +L++   +                   R  L+ D  ++++QWR  W RRL+KFQ K  + KC K
Sbjct:    1 MRVPWRCLLGLFLLVKSVSPHSPTSPFAGQQTPLDPCYDETGTARRCIPEFINAAFGKEVMVSSVCGRPPSRSCSVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQSENLNTSP--HNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGKTWMPYQFYSSQCRRMYNKPNKATITKQNEQEALCTDGHTDL--------YPLSGGLIAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVVFGR--PQLSREFVLGAG---SNNGGRDDDPVAVTS----TLSTYFYAVGDFQVGGRCKCNGHASRCLKDKEGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSSTE------EPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETV-GDWAKFSVSLVSVYKSRGEPLKRGDNI--------LWVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLVADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSK 629          
BLAST of Netrin-1 vs. Ensembl Medaka
Match: ntn2 (netrin-3 [Source:NCBI gene;Acc:101160359])

HSP 1 Score: 352.443 bits (903), Expect = 1.264e-109
Identity = 211/664 (31.78%), Postives = 330/664 (49.70%), Query Frame = 3
Query:  672 IRVLMNCFLFNSILLLGFSFYFSVAISVLYENKQTTC-EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMN------DTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHR-------------HREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +RV   C L   +L+   S +   +     +     C +  G    C P FIN A   ++ V+S CG           +       R C ICD       +    LTD  +  N TCW S  +      ++V ++++  K FE+ YV+LQFCS  P+S+ IYKS D GK W+P+Q+YS  C++ +N P       Q   E   +    DL           +  ++ FS+  GR  +        L  W+T+TD+R+   R   Q+S  F  G      +  GRD   ++  S    ++S  +Y V D  VGGRC+C GH+++C+ + +G +VCDCKHNTEG +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD  +P++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   +  ++    ++      +  + ES CKP     K    K   +  +V + V++ + V G   +F + +  V++  G+  +    I        LW+  +++ C CP I + + +L++   +                   R  L+ D  ++++QWR  W RRL+KFQ K  + KC K
Sbjct:    1 MRVPWRCLLGLFLLVKSVSPHSPTSPFAGQQTPLDPCYDETGTARRCIPEFINAAFGKEVMVSSVCGRPPSRSCSVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQSENLNTSP--HNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGKTWMPYQFYSSQCRRMYNKPNKATITKQNEQEALCTDGHTDL--------YPLSGGLIAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVVFGR--PQLSREFVLGAG---SNNGGRDDDPVAVTS----TLSTYFYAVGDFQVGGRCKCNGHASRCLKDKEGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSSTE------EPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETV-GDWAKFSVSLVSVYKSRGEPLKRGDNI--------LWVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLVADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSK 629          
BLAST of Netrin-1 vs. Ensembl Medaka
Match: ntn2 (netrin-3 [Source:NCBI gene;Acc:101160359])

HSP 1 Score: 352.443 bits (903), Expect = 1.264e-109
Identity = 211/664 (31.78%), Postives = 330/664 (49.70%), Query Frame = 3
Query:  672 IRVLMNCFLFNSILLLGFSFYFSVAISVLYENKQTTC-EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMN------DTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHR-------------HREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
            +RV   C L   +L+   S +   +     +     C +  G    C P FIN A   ++ V+S CG           +       R C ICD       +    LTD  +  N TCW S  +      ++V ++++  K FE+ YV+LQFCS  P+S+ IYKS D GK W+P+Q+YS  C++ +N P       Q   E   +    DL           +  ++ FS+  GR  +        L  W+T+TD+R+   R   Q+S  F  G      +  GRD   ++  S    ++S  +Y V D  VGGRC+C GH+++C+ + +G +VCDCKHNTEG +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD  +P++H  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   +  ++    ++      +  + ES CKP     K    K   +  +V + V++ + V G   +F + +  V++  G+  +    I        LW+  +++ C CP I + + +L++   +                   R  L+ D  ++++QWR  W RRL+KFQ K  + KC K
Sbjct:    1 MRVPWRCLLGLFLLVKSVSPHSPTSPFAGQQTPLDPCYDETGTARRCIPEFINAAFGKEVMVSSVCGRPPSRSCSVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQSENLNTSP--HNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGKTWMPYQFYSSQCRRMYNKPNKATITKQNEQEALCTDGHTDL--------YPLSGGLIAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVVFGR--PQLSREFVLGAG---SNNGGRDDDPVAVTS----TLSTYFYAVGDFQVGGRCKCNGHASRCLKDKEGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSSTE------EPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETV-GDWAKFSVSLVSVYKSRGEPLKRGDNI--------LWVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLVADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSK 629          
BLAST of Netrin-1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 344.739 bits (883), Expect = 2.364e-107
Identity = 214/653 (32.77%), Postives = 331/653 (50.69%), Query Frame = 3
Query:  669 FIRVLMNCFLFNSILLLGFSFYFSVAISVLYENKQTTC-EFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM------NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQ-EQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEK 2603
             +R +    L  S+        + + +     +    C + HG    C P F+N A   ++ V+S+CG+                       CD       +    LTD  N  N TCW S   + Q+  N V ++++  K FEV YV+LQFCS  P+S+ IYKS DNGK W+P+Q+YS  C+K +N P       Q   E   + +  D+              ++ FS+  GR        +  L  W+T TD+++  SR                  H  G +  + S  + +       +Y VSDL VGGRC+C GH+++C+ + DG++VCDCKHNT G +CD+CK   +D  W+RA+      C  C CNLH++ C+F   +Y  +G+KSGGVC  C+HNTAG  CH+C  G+YRD +KP+SH  ACK C CH VG+    +C++  GQC CK+GV G  C++C  GY Q+RS + PC+K   I  S  T  +    +  D    ES CK    K K    K   +  +V + ++++ ++ G+  +F + I  V++      Q  S I + +Q+   LW+  ++V C CP I  G+ YL+L   ++     +  ++ D  ++++QWR +W RRL+KFQ +  + KC+K
Sbjct:    1 MMRAVHAVLLAASLWCRSAFGGYGIGLFAAQTSPPDPCYDEHGNPRRCIPDFVNAAFGKEVKVSSTCGKT----------------------CDASDPKKYHPPAYLTDLNNPHNLTCWQS-ENFIQYPQN-VTLTLSLGKKFEVTYVSLQFCSPRPESMVIYKSMDNGKTWVPFQFYSTQCRKMYNKPNRAVITKQNEQEAVCTDSHTDM--------YPLTGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVVFSRL-----------------HTFGDENEDDSELARDS-----YFYAVSDLQVGGRCKCNGHASRCVKDRDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIK---IPVSPPTTPASSTEEASD---CESYCKASKGKLKINMKKYCKKDYAVQVHILKADKM-GEWWKFTVNIISVYK------QGESRIRRGDQF---LWVRAKDVACKCPKIKPGKKYLLLGNDEV--SPSQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 580          
BLAST of Netrin-1 vs. Planmine SMEST
Match: SMESG000076695.1 (SMESG000076695.1)

HSP 1 Score: 1375.15 bits (3558), Expect = 0.000e+0
Identity = 676/676 (100.00%), Postives = 676/676 (100.00%), Query Frame = 3
Query:  684 MNCFLFNSILLLGFSFYFSVAISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKKSKIKHNRINRVGKNKRSFLLTKNPFSPEFIS 2711
            MNCFLFNSILLLGFSFYFSVAISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEKRKRIRFKKFCRRDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKKSKIKHNRINRVGKNKRSFLLTKNPFSPEFIS
Sbjct:    1 MNCFLFNSILLLGFSFYFSVAISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEKRKRIRFKKFCRRDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKKSKIKHNRINRVGKNKRSFLLTKNPFSPEFIS 676          
BLAST of Netrin-1 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 284/660 (43.03%), Postives = 402/660 (60.91%), Query Frame = 3
Query:  663 FIFIRVLMNCFLFNSILLLGFSFYFSVAISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRD-CSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRK----MNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKKSKI 2627
             IFIR         +I +L  S +   ++ V++E++ + C  +G+   C P F NI +  K   TS+CG   P+ IC +W   ++   R  CSICD   K+  Y    +TD     N TCWFSGP+    G N VNI+++ KK+FEV+Y+ALQ C  LPDSI IYKS D G  W PWQ++S++C +AF +P T E   Q          C +L   ++  + GQAE++LPFS+  GR      +  L++W+T+TDLRI+L RF  + S+ +   + +       +   N+    VN K+   V++G+SDL+VGGRC+C GH+N+C+I+++  I CDC HNTEG +C++CK  + D  W+RA++ N   CK C CNLHS  C F   +Y++    +GGVC  C+H+T GN C  C+NG++R+WTKP  H  AC  CKCH +GS   N CDKK GQC+C++GV G+ CD+CK GY Q+ S ++PC+ +               S   DM NT   CK C+EKRKRI FKKFCRR SVF     SKE+HG M+R+EL+I E+WRV   + +F+   +   +    WI+ E+VRC+CP + LG+SYLIL + K Y +   +EL +DSR+VML W  SWERRLQKFQ +    KCE++ +KK KI
Sbjct:    1 MIFIR---------TIAILNLSVWIH-SVKVIFESQSSPCYLNGRPQQCLPSFTNIIENVKAETTSTCGTNGPEQICRNWYDKTTAEARQYCSICD--AKHRSYPPSHITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGTLPDSIAIYKSLDFGVSWKPWQFFSQDCYRAFKMPTTNEQNSQITPANIHEVLCVELKAPERYNDYGQAETVLPFSTIYGRPSGPPWSQDLVEWMTMTDLRISLMRFTPEKSTPYRLKELYYHTESLPQAPPNL----VNHKTEPIVHFGLSDLAVGGRCKCNGHANRCLIDDNDEIKCDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKYCDCNLHSYRCYFNSQIYVRNNYTNGGVCINCRHHTTGNNCENCENGFFRNWTKPQEHRAACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGYKQSNSTVRPCIPS---------------SGMADMANTSPVCKKCNEKRKRIVFKKFCRRKSVFRATALSKEIHGNMIRYELKIDEIWRVDKNVWEFLPRETPAMHTYRAWINSEDVRCNCPKVELGQSYLILTRAKYYLYLRNKELYIDSRSVMLPWHNSWERRLQKFQKREKRGKCEQYFKKKMKI 629          
BLAST of Netrin-1 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 532.717 bits (1371), Expect = 3.393e-178
Identity = 283/660 (42.88%), Postives = 400/660 (60.61%), Query Frame = 3
Query:  663 FIFIRVLMNCFLFNSILLLGFSFYFSVAISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRD-CSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRK----MNDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKKSKI 2627
             IFIR         +I +L  S +   ++ V++E++ + C  +G+   C P F NI +  K   TS+CG   P+ IC +W   ++   R  CSICD   K+  Y    +TD     N TCWFSGP+    G N VNI+++ KK+FEV+Y+ALQ C  LPDSI IYKS D G  W PWQ++S++C +AF +P T E   Q          C +L   ++  + GQAE++LPFS+  GR      +  L++W+T+TDLRI+L RF  + S+ +   + +       +   N+    VN K+   V++G+SDL+VGGRC+C GH+N+C+I+++  I CDC HNTEG +C++CK  + D  W+RA++ N   CK CQC  HS  C F   +Y +T  + GGVC +C+HNT G+ C  C   +YRD TKP++H  AC  CKCH +GS   N CDKK GQC+C++GV G+ CD+CK GY Q+ S ++PC+ +               S   DM NT   CK C+EKRKRI FKKFCRR SVF     SKE+HG M+R+EL+I E+WRV   + +F+   +   +    WI+ E+VRC+CP + LG+SYLIL + K Y +   +EL +DSR+VML W  SWERRLQKFQ +    KCE++ +KK KI
Sbjct:    1 MIFIR---------TIAILNLSVWIH-SVKVIFESQSSPCYLNGRPQQCLPSFTNIIENVKAETTSTCGTNGPEQICRNWYDKTTAEARQYCSICD--AKHRSYPPSHITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGTLPDSIAIYKSLDFGVSWKPWQFFSQDCYRAFKMPTTNEQNSQITPANIHEVLCVELKAPERYNDYGQAETVLPFSTIYGRPSGPPWSQDLVEWMTMTDLRISLMRFTPEKSTPYRLKELYYHTESLPQAPPNL----VNHKTEPIVHFGLSDLAVGGRCKCNGHANRCLIDDNDEIKCDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKLCQCYNHSDKCMFSMGMYKQTRGQHGGVCLECKHNTEGHACDECAAFHYRDITKPVTHPQACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGYKQSNSTVRPCIPS---------------SGMADMANTSPVCKKCNEKRKRIVFKKFCRRKSVFRATALSKEIHGNMIRYELKIDEIWRVDKNVWEFLPRETPAMHTYRAWINSEDVRCNCPKVELGQSYLILTRAKYYLYLRNKELYIDSRSVMLPWHNSWERRLQKFQKREKRGKCEQYFKKKMKI 629          
BLAST of Netrin-1 vs. Planmine SMEST
Match: SMESG000069610.1 (SMESG000069610.1)

HSP 1 Score: 391.734 bits (1005), Expect = 4.350e-125
Identity = 233/638 (36.52%), Postives = 347/638 (54.39%), Query Frame = 3
Query:  774 TTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFC-SELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPT-------QEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM----NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGN-IVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQ-----FISEISQ--------EQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDS-RTVMLQWRPSWERRLQKFQTKANEEKCEKF 2606
            + C  HG  Y C PPF NI +     + + C +    ++CP                 + R N I      TD     N TCW S P+      NHVNI+ +F K FEV+Y++L  C S +P++I  YKS++ G  W PW Y + NC   FN+  T        +F IQ   +   +  CF L     D      E ++ F++ +        + +LI W++ +D+RITL +FD+              K ++     N+  F+ N     K    +SD+S+GGRC+C GH+N C  N   N I C C+HNTEG DC+KCK+ + DL W RA+  +P  CK+C+CNLHS +C F +++Y+   Q +GGVC  CQHNTAG +CH+C++GYYRDWTKPL H   CKKC CH +G+   + CDK+ GQC CK GV G  C++C  G+ Q+ S   PCV                  KY+ M + E++CK CD KR RIRF+KFCR+D+VF   ++S+E+ G  +RF++ +  +W     I       FI  I +         +   P+W+   +++C+C  + LG++YL ++K   YH+++R ELL+ S R+++L W P+W+RRL +F+ K  + +C KF
Sbjct:    7 SPCYAHGSAYQCMPPFTNIVENMIPKIETLCKK---KEVCP---------------IKSPRDNLI------TDYHLTHNQTCWKSVPL----QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQ---AARCFPLKLSLTDN-----EPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNP-------------KPKKS----NIFRFARNS---PKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCV------------------KYIQMESAENKCKACDSKRTRIRFRKFCRKDAVFSVTLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFIESIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLFIIKSTTYHYQNRAELLIKSPRSIILIWNPTWKRRLNRFKQKKEKGECSKF 570          
BLAST of Netrin-1 vs. Planmine SMEST
Match: SMESG000006806.1 (SMESG000006806.1)

HSP 1 Score: 382.104 bits (980), Expect = 1.663e-120
Identity = 240/658 (36.47%), Postives = 370/658 (56.23%), Query Frame = 3
Query:  756 LYENKQTTCEFHGKDYYCTPPFINIAQRA-KITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSEL-PDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPT--QEFPIQEGLEYSL--SPTCFDLNQKQKDGNLGQAESILPFSST---IGRKMNDTLIKWITITDLRITLSRFDDQ-MSSYFD-------YGKYFLLKHRRGR--DIL----NMSTFSVNDKSMSKV--YYGVSDLSVGGRCQCYGHSNKCIINN-DGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEXXXXXXXXXXXXXDSVFMGVIESKEVHGKMVRFELQIKEVWRV-SGKISQF-------ISEISQEQY---AVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKK 2618
            L+    + C   GK + C PPF NI +      +TS+CG+     IC        +H  +C  C  D     +SI  LTD     N T W S  V   HG N VNI+ +F K FE++Y++L     L PDSI I KS DNG  W  W Y+SK+C ++F + P     +   +  E ++  S TC  +    K GNL  + S+L F++         +D    W++ T++RITL + +   ++S+ D         +YF   +R+     IL     +     N  S+ K+  ++ ++D+S+GGRCQCYGH+ +C+ N  D    CDC+HNT G DC+ C+EGF D +W  A+  +   CKRC CNLHS+ C+F + +Y+ + ++SGGVC  C+HNT G  CH C+ GY+RDW+KPLSH   C KC+CH +GS   + CD++  QC CK GV G  C++C+ G+ QT+S + PCV   D+ +    +              E+ C+ C+ KRKRIRFKK+CR+D+V +  ++S+E HG+M RFE+++  V+R+ + K ++        ++ I   Q+     P+WI   +++C CP++ LG +YL+++K     +  R ELLLD ++V L W+ +WERR++KF  K ++  CEK+  K+
Sbjct:   27 LHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRIC-------VDHI-NCHSCMKD----THSINYLTDQHLNNNITFWASDFV--NHGDN-VNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSI-PDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVGCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAP------------ENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKR 656          
The following BLAST results are available for this feature:
BLAST of Netrin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN12.538e-10433.77netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN31.554e-8729.76netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030][more]
LAMC11.898e-5731.69laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
LAMC34.200e-5230.25laminin subunit gamma 3 [Source:HGNC Symbol;Acc:HG... [more]
NTN51.214e-4929.29netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208][more]
back to top
BLAST of Netrin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-61.822e-10230.02Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
unc-61.822e-10230.02Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
lam-21.525e-5130.65Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
lam-31.900e-4028.01LAMinin related. See also lmb; Laminin alpha chain... [more]
lam-12.642e-4029.37LAMinin related. See also lmb [Source:UniProtKB/T... [more]
back to top
BLAST of Netrin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NetA1.903e-8335.62gene:FBgn0015773 transcript:FBtr0308337[more]
NetA5.798e-8335.62gene:FBgn0015773 transcript:FBtr0073942[more]
NetA5.798e-8335.62gene:FBgn0015773 transcript:FBtr0346088[more]
LanB28.718e-5731.58gene:FBgn0267348 transcript:FBtr0345031[more]
LanB28.718e-5731.58gene:FBgn0267348 transcript:FBtr0076382[more]
back to top
BLAST of Netrin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ntn23.572e-11232.82netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
ntn23.955e-11233.61netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
ntn1b1.231e-11033.13netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168][more]
ntn1b1.231e-11033.13netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168][more]
ntn1a1.342e-10933.23netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
back to top
BLAST of Netrin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps162.066e-10231.94ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
ntn14.721e-10232.45netrin 1 [Source:NCBI gene;Acc:779839][more]
rps164.026e-10031.45ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
utp47.682e-5932.08UTP4 small subunit processome component [Source:Xe... [more]
utp48.338e-5932.08UTP4 small subunit processome component [Source:Xe... [more]
back to top
BLAST of Netrin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ntn16.527e-10533.77netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn16.527e-10533.77netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn32.077e-9129.45netrin 3 [Source:MGI Symbol;Acc:MGI:1341188][more]
Lamc12.734e-5731.38laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914][more]
Lamc31.096e-5631.18laminin gamma 3 [Source:MGI Symbol;Acc:MGI:1344394... [more]
back to top
BLAST of Netrin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90922|NET1_CHICK3.489e-10433.72Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=... [more]
sp|O09118|NET1_MOUSE4.565e-10433.77Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=... [more]
sp|O95631|NET1_HUMAN1.219e-10333.77Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2[more]
sp|Q924Z9|NET1_RAT1.166e-10133.44Netrin-1 OS=Rattus norvegicus OX=10116 GN=Ntn1 PE=... [more]
sp|Q2HXW4|NET1_PIG1.288e-10133.50Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1[more]
back to top
BLAST of Netrin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6G2V30.000e+0100.00Netrin-4 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A3Q0KPX72.484e-14338.48Putative netrin OS=Schistosoma mansoni OX=6183 PE=... [more]
A0A4Z2D9H48.210e-14138.16Netrin-A OS=Schistosoma japonicum OX=6182 GN=EWB00... [more]
A0A4S2M8195.123e-13637.37Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K3F9D32.345e-13534.48Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Netrin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN14.558e-11034.80netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN11.605e-10834.64netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b1.612e-10634.59netrin-1-like [Source:NCBI gene;Acc:111191060][more]
NTN13.199e-7737.15netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b1.208e-7637.56netrin-1-like [Source:NCBI gene;Acc:111191060][more]
back to top
BLAST of Netrin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009682.17.203e-4731.59pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 ge... [more]
ENSPMAT00000004606.11.304e-2931.39pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 g... [more]
ENSPMAT00000004614.11.546e-2830.05pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 g... [more]
ENSPMAT00000008925.15.810e-2727.00pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 ... [more]
ENSPMAT00000007784.18.974e-2224.82pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1... [more]
back to top
BLAST of Netrin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Netrin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368365.999e-8931.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365231.724e-4928.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395024.960e-4627.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365018.985e-4328.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365007.358e-3926.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Netrin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN17.993e-11033.08netrin-1 [Source:NCBI gene;Acc:101155405][more]
ntn21.264e-10931.78netrin-3 [Source:NCBI gene;Acc:101160359][more]
ntn21.264e-10931.78netrin-3 [Source:NCBI gene;Acc:101160359][more]
ntn21.264e-10931.78netrin-3 [Source:NCBI gene;Acc:101160359][more]
NTN12.364e-10732.77netrin-1 [Source:NCBI gene;Acc:101155405][more]
back to top
BLAST of Netrin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076695.10.000e+0100.00SMESG000076695.1[more]
SMESG000050895.10.000e+043.03SMESG000050895.1[more]
SMESG000050895.13.393e-17842.88SMESG000050895.1[more]
SMESG000069610.14.350e-12536.52SMESG000069610.1[more]
SMESG000006806.11.663e-12036.47SMESG000006806.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023928 ID=SMED30023928|Name=Netrin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2794bp
TGAATTTTAATTTTGGATATTTTCTCGAAATTTTTATGTTTGAAATTCAG
GAACAATTATTGTCGAAATGTCAGTAAAAGTGTGAAAGTGAAAATGCCAG
ATCGTTTATTCTAAATATTCTAATTGGATTAGCCAATTCACAGTTGCTAT
TTCTGCAAACTTAATTAGGGTATCAGCTATAGAATTCTCTGTTCAAAAGG
TGTGAAAAATGATTTCAAATGGCCTGTTAAATTGAAATCGCTCTCTTTAA
TCATCAGCATCCCCAAATTATTTTATTTGATGACATCAGTCTATGGCGGT
TCATCTCGCTCTATCTCGCTCTATCTCGCTCGATCTCTCTCGATGCAGTT
TTTTTCTATATTCACTTTTAGTGTGGTCTTTTAAACTGAGGAATTCACGC
GGAATTGAATATCGTTTTTAAGCAATAGGGAAAAAAATCCGAAACGTAAT
TTGTCAACTTAAACGCAGCAATTGCAGCCGATAGTGCCTGTTGTCATTTG
GGGATATCTGGATAGTGTCGGATGTAAGCACCAATTGTATTTGAGACAAA
TCGTTCGTAATTGGCACCATTTTGTCTCTGGTTTCTCGATTTTTGGCACA
TTGAATTGTAATTATTCATCACCGTAATATCGAGCACTTATTTAACATAT
TTTACTATCAAATTCATTTTTATTCGGGTTTTGATGAATTGTTTTTTATT
CAACTCTATTCTCTTACTGGGATTTTCATTTTATTTCTCCGTGGCGATTT
CTGTTTTGTACGAGAATAAACAGACGACTTGTGAGTTTCACGGAAAGGAT
TATTATTGCACTCCGCCGTTTATTAATATTGCTCAAAGAGCCAAAATCAC
AGTCACGAGTAGTTGTGGAGAGATTCTACCGGACGATATTTGCCCCCATT
GGAAATATTATTCTTCAAACCATTTTAGAGATTGCTCTATTTGTGACAAT
GACAGAAAGAATTCTATTTATTCAATTAAGTCATTGACGGATCCATTGAA
TCAGTTTAATCACACCTGTTGGTTTTCAGGTCCTGTGTATAATCAGCATG
GCCTAAATCATGTCAACATTTCGATTGCCTTTAAAAAGAATTTCGAAGTC
TTTTATGTTGCACTCCAGTTTTGCAGTGAGCTTCCCGACTCTATTACTAT
TTATAAAAGTCACGACAATGGTAAAAAGTGGATACCTTGGCAATACTATT
CAAAGAATTGTCAGAAAGCATTTAATTTACCTCCAACTCAAGAATTTCCT
ATTCAAGAAGGTTTGGAATATTCATTATCCCCAACATGTTTCGATCTGAA
TCAAAAGCAAAAAGATGGTAATCTAGGTCAGGCGGAATCTATTCTTCCAT
TTAGTTCAACAATTGGAAGAAAAATGAATGATACTTTAATTAAATGGATT
ACTATTACTGATTTACGGATTACTCTATCTAGATTTGACGACCAAATGTC
TTCATATTTTGATTATGGTAAATATTTTTTACTGAAGCATAGAAGAGGCC
GAGATATTCTCAACATGTCAACATTTTCTGTAAATGACAAGTCGATGTCA
AAGGTTTATTATGGAGTGTCGGATCTGTCTGTTGGAGGTCGTTGTCAGTG
TTATGGACACTCAAATAAATGCATTATTAACAATGACGGTAACATCGTAT
GCGATTGTAAGCACAACACAGAGGGAGCCGATTGCGATAAATGTAAAGAA
GGATTCCATGATCTGCAGTGGGAAAGAGCTTCTAAACTTAACCCATTTAG
TTGCAAAAGATGTCAATGTAATTTGCATTCACAGCACTGCAAATTTGAGA
AGAATGTCTACATGAAGACTGGACAGAAAAGTGGAGGGGTTTGTCGGAAA
TGTCAACATAACACAGCGGGGAATCAATGTCATTTTTGTGATAATGGATA
CTACAGAGATTGGACTAAGCCCTTAAGCCATGATTTGGCTTGTAAAAAAT
GCAAATGTCATGCTGTTGGATCGACAAATGTAAATTCATGTGATAAAAAA
TTAGGACAGTGCTTTTGTAAGGAGGGAGTTATTGGAAGGAAGTGCGACAA
ATGCAAAATTGGATATTTGCAAACAAGGTCTATGTTGAAACCATGTGTGA
AAACGTATGATATAATAGAATCAAGTCAAACAAAAAAGTCAGATCTTAAT
TCCAAATATATGGACATGCCTAATACTGAGAGCGAATGTAAACCGTGTGA
TGAAAAAAGAAAAAGAATTCGATTTAAAAAGTTTTGCCGTAGAGATTCAG
TATTTATGGGTGTTATCGAATCCAAAGAAGTGCATGGTAAAATGGTGCGA
TTCGAATTACAAATCAAAGAGGTCTGGCGAGTAAGTGGGAAAATATCTCA
ATTCATTTCGGAAATCAGTCAGGAGCAATATGCAGTTCCTTTGTGGATAT
CTCACGAAGAAGTCCGATGTGACTGTCCAAACATTTCTCTCGGTCGAAGT
TATCTAATTTTAATGAAATATAAAATCTATCACCACAGACATCGTGAAGA
ATTATTACTTGACTCTCGAACAGTTATGTTGCAATGGCGGCCGTCTTGGG
AACGAAGATTACAGAAATTTCAAACAAAAGCCAATGAAGAAAAATGTGAA
AAATTTTTGCAAAAAAAATCAAAAATCAAACATAACCGAATAAATCGAGT
TGGGAAAAATAAGCGATCATTTTTGTTGACAAAAAATCCATTTTCACCTG
AATTTATATCGTAGAAAATAGATTTATTTGACATTTTTTCAGTGTTTTCA
TGGGTTTTTTCTCATTATCAATTGTGTTTTATGTTCCCATGTCA
back to top

protein sequence of SMED30023928-orf-1

>SMED30023928-orf-1 ID=SMED30023928-orf-1|Name=SMED30023928-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=677bp
MNCFLFNSILLLGFSFYFSVAISVLYENKQTTCEFHGKDYYCTPPFINIA
QRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKS
LTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSEL
PDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSP
TCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIKWITITDLRITLSR
FDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSV
GGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERAS
KLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCH
FCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVI
GRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTES
ECKPCDEKRKRIRFKKFCRRDSVFMGVIESKEVHGKMVRFELQIKEVWRV
SGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYH
HRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKKSKIKH
NRINRVGKNKRSFLLTKNPFSPEFIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038684Laminin_N_sf
IPR002049Laminin_EGF
IPR018933Netrin_module_non-TIMP
IPR008211Laminin_N
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018933Netrin module, non-TIMP typeSMARTSM00643c345ccoord: 514..632
e-value: 6.2E-7
score: 39.0
IPR018933Netrin module, non-TIMP typePFAMPF01759NTRcoord: 515..630
e-value: 1.9E-15
score: 56.6
IPR002049Laminin EGF domainSMARTSM00180lamegf_3coord: 423..471
e-value: 2.4E-11
score: 53.7
coord: 360..420
e-value: 1.2E-4
score: 31.5
coord: 304..357
e-value: 2.1E-8
score: 43.9
IPR002049Laminin EGF domainPFAMPF00053Laminin_EGFcoord: 360..410
e-value: 2.4E-6
score: 27.6
coord: 304..347
e-value: 1.2E-6
score: 28.5
coord: 423..467
e-value: 1.4E-9
score: 37.9
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 443..471
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 423..473
score: 16.424
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 304..359
score: 12.273
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 360..422
score: 10.693
IPR008211Laminin, N-terminalSMARTSM00136LamNT_2coord: 36..302
e-value: 1.6E-27
score: 107.5
IPR008211Laminin, N-terminalPFAMPF00055Laminin_Ncoord: 42..302
e-value: 1.8E-44
score: 152.1
IPR008211Laminin, N-terminalPROSITEPS51117LAMININ_NTERcoord: 38..303
score: 31.042
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldGENE3DG3DSA:2.40.50.120coord: 496..639
e-value: 2.1E-14
score: 55.5
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 501..635
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 326..425
e-value: 1.5E-26
score: 94.6
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 426..472
e-value: 1.3E-10
score: 43.0
NoneNo IPR availablePANTHERPTHR10574NETRIN/LAMININ-RELATEDcoord: 34..640
NoneNo IPR availablePANTHERPTHR10574:SF292NETRIN-3coord: 34..640
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 423..472
e-value: 2.78977E-10
score: 53.8974
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 303..346
e-value: 5.36699E-9
score: 50.4306
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 359..415
e-value: 2.25368E-4
score: 37.3338
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.796
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 423..465
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 304..362
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 360..413
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR038684Laminin, N-terminal domain superfamilyGENE3DG3DSA:2.60.120.1490coord: 19..325
e-value: 4.2E-57
score: 195.5
IPR001134Netrin domainPROSITEPS50189NTRcoord: 502..638
score: 16.768