Symplekin

Overview
NameSymplekin
Smed IDSMED30023927
Length (bp)3753
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Symplekin (SMED30023927) t-SNE clustered cells

Violin plots show distribution of expression levels for Symplekin (SMED30023927) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Symplekin (SMED30023927) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Symplekin (SMED30023927) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023927

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023927SMESG000046152.1 dd_Smed_v4_4387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023927SMESG000046152.1 Contig23710uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023927SMESG000046152.1 Contig23710newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30023927SMESG000046152.1 Contig36426uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30023927SMESG000046152.1 Contig36426newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Symplekin vs. Ensembl Human
Match: SYMPK (symplekin [Source:HGNC Symbol;Acc:HGNC:22935])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 397/1112 (35.70%), Postives = 628/1112 (56.47%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSS-KRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSL--ESKEKRETFQDES--NSNSILEDFPMSGYANQ----KSKNQMTLLKKH-PFSTQKPFNLESVT--KTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            +RVVDL N     +  + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+K+    M  +Y ++L   +K +  S    E  + C  +V A+   +    DS N G+    IK +E +++  S R  DSEIP+ +E+D+SLD+IP D   P +Q  +L + G      L+K +     SS ++ T L SL NIA+QRP FMS VI+++E  H N+P  L + QV+S+RK LK  LLS+LKHP+ LEF +Q+TTLL+DLG  Q+EI R +P + +     RKR  +++ S+ K+ +   N   D  D             PS   K+ +         ++ E L  L T  NV +LVL+SM+ LPE MP +FQ+ YTP+ +AGT+ QI HL+RL++ Q+ +AG      ++K+ +E  ++E    + S+L    +S          S + M+ L++  P + ++P  +  VT  +       ++IF  S    ++ PL + +++  +      +       +        R  IL SL +    G  L  E++ + ++DV+ R D+  + L +EY +Y A   +              ++  Y+  L+ +L  L    D K+  F +++LEAPLIT  AL ++R YC  +     G   +R+L   RP  + + L ++LD SS +  +VRS AL   K  +   E   E +  FA   L  L+   P + +      T +   WT+E V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +H LTDK  PSP +V++++++YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P ELL+A+H ++    ++K +I+A+ +CF E+ ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+LSRLI KQVWK   +W+GFI+CC +   QSF V+LQLP  +L +VF+  PE R  +  ++ + T  Q+ H  N+I++++ +  
Sbjct:   34 ERVVDLLNQAA-LITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVIS----ELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDH--PYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDT----RKRPRDDSDSTLKKMKLEPNLGEDDEDKDLE-------PGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSD---VLKPLTDAQVEAMKLGAVKRILRAEKAVACSGAAQV-RIKILASLVTQFNSG--LKAEVLSFILEDVRARLDLAFAWLYQEYNAYLAAGAS-------------GSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAPLITESALEVVRKYCEDESRTYLGMSTLRDLIFKRPSRQFQYLHVLLDLSSHEKDKVRSQALLFIKR-MYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEGNSALSPLNPGELLIALHNIDSVKCDMKSIIKATNLCFAERNVYTSEVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFVMNILSRLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVRSFTPHQQAHIPNSIMTILEASG 1102          
BLAST of Symplekin vs. Ensembl Human
Match: SYMPK (symplekin [Source:HGNC Symbol;Acc:HGNC:22935])

HSP 1 Score: 500.745 bits (1288), Expect = 2.704e-157
Identity = 337/978 (34.46%), Postives = 533/978 (54.50%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSS-KRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSL--ESKEKRETFQDES--NSNSILEDFPMSGYANQ----KSKNQMTLLKKH-PFSTQKPFNLESVT--KTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKM 2958
            +RVVDL N     +  + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+K+    M  +Y ++L   +K +  S    E  + C  +V A+   +    DS N G+    IK +E +++  S R  DSEIP+ +E+D+SLD+IP D   P +Q  +L + G      L+K +     SS ++ T L SL NIA+QRP FMS VI+++E  H N+P  L + QV+S+RK LK  LLS+LKHP+ LEF +Q+TTLL+DLG  Q+EI R +P + +     RKR  +++ S+ K+ +   N   D  D             PS   K+ +         ++ E L  L T  NV +LVL+SM+ LPE MP +FQ+ YTP+ +AGT+ QI HL+RL++ Q+ +AG      ++K+ +E  ++E    + S+L    +S          S + M+ L++  P + ++P  +  VT  +       ++IF  S    ++ PL + +++  +      +       +        R  IL SL +    G  L  E++ + ++DV+ R D+  + L +EY +Y A   +              ++  Y+  L+ +L  L    D K+  F +++LEAPLIT  AL ++R YC  +     G   +R+L   RP  + + L ++LD SS +  +VRS AL   K  +   E   E +  FA   L  L+   P + +      T +   WT+E V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +H LTDK  PSP +V++++++YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P ELL+A+H ++    ++K +I+   +
Sbjct:   34 ERVVDLLNQAA-LITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVIS----ELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDH--PYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDT----RKRPRDDSDSTLKKMKLEPNLGEDDEDKDLE-------PGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSD---VLKPLTDAQVEAMKLGAVKRILRAEKAVACSGAAQV-RIKILASLVTQFNSG--LKAEVLSFILEDVRARLDLAFAWLYQEYNAYLAAGAS-------------GSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAPLITESALEVVRKYCEDESRTYLGMSTLRDLIFKRPSRQFQYLHVLLDLSSHEKDKVRSQALLFIKR-MYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEGNSALSPLNPGELLIALHNIDSVKCDMKSIIKGEAL 968          
BLAST of Symplekin vs. Ensembl Human
Match: SYMPK (symplekin [Source:HGNC Symbol;Acc:HGNC:22935])

HSP 1 Score: 500.745 bits (1288), Expect = 2.704e-157
Identity = 337/978 (34.46%), Postives = 533/978 (54.50%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSS-KRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSL--ESKEKRETFQDES--NSNSILEDFPMSGYANQ----KSKNQMTLLKKH-PFSTQKPFNLESVT--KTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKM 2958
            +RVVDL N     +  + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+K+    M  +Y ++L   +K +  S    E  + C  +V A+   +    DS N G+    IK +E +++  S R  DSEIP+ +E+D+SLD+IP D   P +Q  +L + G      L+K +     SS ++ T L SL NIA+QRP FMS VI+++E  H N+P  L + QV+S+RK LK  LLS+LKHP+ LEF +Q+TTLL+DLG  Q+EI R +P + +     RKR  +++ S+ K+ +   N   D  D             PS   K+ +         ++ E L  L T  NV +LVL+SM+ LPE MP +FQ+ YTP+ +AGT+ QI HL+RL++ Q+ +AG      ++K+ +E  ++E    + S+L    +S          S + M+ L++  P + ++P  +  VT  +       ++IF  S    ++ PL + +++  +      +       +        R  IL SL +    G  L  E++ + ++DV+ R D+  + L +EY +Y A   +              ++  Y+  L+ +L  L    D K+  F +++LEAPLIT  AL ++R YC  +     G   +R+L   RP  + + L ++LD SS +  +VRS AL   K  +   E   E +  FA   L  L+   P + +      T +   WT+E V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +H LTDK  PSP +V++++++YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P ELL+A+H ++    ++K +I+   +
Sbjct:   34 ERVVDLLNQAA-LITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVIS----ELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDH--PYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDT----RKRPRDDSDSTLKKMKLEPNLGEDDEDKDLE-------PGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSD---VLKPLTDAQVEAMKLGAVKRILRAEKAVACSGAAQV-RIKILASLVTQFNSG--LKAEVLSFILEDVRARLDLAFAWLYQEYNAYLAAGAS-------------GSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAPLITESALEVVRKYCEDESRTYLGMSTLRDLIFKRPSRQFQYLHVLLDLSSHEKDKVRSQALLFIKR-MYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEGNSALSPLNPGELLIALHNIDSVKCDMKSIIKGEAL 968          
BLAST of Symplekin vs. Ensembl Human
Match: SYMPK (symplekin [Source:HGNC Symbol;Acc:HGNC:22935])

HSP 1 Score: 278.485 bits (711), Expect = 8.362e-80
Identity = 211/641 (32.92%), Postives = 332/641 (51.79%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSS-KRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSL--ESKEKRETFQDES--NSNSILEDFPMSGYANQ----KSKNQMTLLKKH-PFSTQKP--------------------FNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKA 1896
            +RVVDL N     +  + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+K+    M  +Y ++L   +K +  S    E  + C  +V A+   +    DS N G+    IK +E +++  S R  DSEIP+ +E+D+SLD+IP D   P +Q  +L + G      L+K +     SS ++ T L SL NIA+QRP FMS VI+++E  H N+P  L + QV+S+RK LK  LLS+LKHP+ LEF +Q+TTLL+DLG  Q+EI R +P + +     RKR  +++ S+ K+ +   N   D  D             PS   K+ +         ++ E L  L T  NV +LVL+SM+ LPE MP +FQ+ YTP+ +AGT+ QI HL+RL++ Q+ +AG      ++K+ +E  ++E    + S+L    +S          S + M+ L++  P + ++P                    F L  V K L    ++ +   + KRIL            RA    + +               R  IL SL +    G  L  E++ + ++DV+ R D+  + L +EY +Y A
Sbjct:   34 ERVVDLLNQA-ALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVIS----ELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDH--PYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDT----RKRPRDDSDSTLKKMKLEPNLGEDDEDKDLE-------PGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSDVLKPLTDAQVEAMKLGAVKRIL------------RAEKAVACSGAAQV----------RIKILASLVTQFNSG--LKAEVLSFILEDVRARLDLAFAWLYQEYNAYLA 632          
BLAST of Symplekin vs. Ensembl Human
Match: SYMPK (symplekin [Source:HGNC Symbol;Acc:HGNC:22935])

HSP 1 Score: 83.1889 bits (204), Expect = 1.605e-18
Identity = 37/77 (48.05%), Postives = 53/77 (68.83%), Query Frame = 1
Query: 3082 PRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQ 3312
            PR+ G+V+N+LSRLI KQVWK   +W+GFI+CC +   QSF V+LQLP  +L +VF+  PE R  +  ++ + T  Q
Sbjct:    2 PRLGGFVMNILSRLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVRSFTPHQ 78          
BLAST of Symplekin vs. Ensembl Celegans
Match: symk-1 (SYMpleKin cleavage and polyadenylation factor [Source:UniProtKB/TrEMBL;Acc:O16929])

HSP 1 Score: 236.498 bits (602), Expect = 2.497e-63
Identity = 265/1081 (24.51%), Postives = 506/1081 (46.81%), Query Frame = 1
Query:  181 SLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRF-LIEDESF----NVMKRLATAMMTIYPLSLSQAIKLKSSSADDI-EAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQR----FPDSEIPKGKE-----NDLSLDKIPAD---LTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQF---MSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLID-LGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLN--TVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQL----VSAGYLSLESKEKRETFQDESNSNSILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAEL-YRELV-------------------KYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLAT----ISDYDAVLVGVLKELITSDV-KETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVD-WTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLND--KLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFAN-VELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLW-DGFIRCCVKLGQQSF-AVLLQLPVDKLESV 3246
            S+LDNF  ++L      ++ +   ++DF+  A   D  L NK+VER  F LI ++S     +V+KR+  A   +YP+ L  AI  K+ +A+   +AF    ++   +   V   + G+  + +K +E +++ QS +       S I   +E     N +SL  +P     L+    Q+E  E      F+ L+K      ++S ++ T++ SL  I + RPQ+   + RV +  +  H N+P  L + QV  +RK+ K +LL  LK P+ +    ++TT+L + LG +  E+ +++P  + + ++   R  ++       R  +      + +  +D      A PS    +    +   ++  +K ++  LN  TV+N   LV +S+  LP  MP AF S+YTPIA AGT+     LS L++ Q+    +  GY  L+ + K+E                    A  K++++   +       Q P +  +++  +P +    I  +S + I  +P++    K  +A         F D      +  +  ++L +    + GGA L Y++LV                   ++ + D K R D+ L  L + Y  Y+ Y       +E  A     T    +  YD  +  +L  ++  ++ KE  F ++LLE PL+T  A+  L+  C AK N ++G  ++REL   R   R +LL  +      +  E+RS+ L   K +          + D A+  ++  LQ  P     P+   +    D WTDE+ +  L ++  LMP +  L+  LA V+ ++  + KR +++ ++   +++  + E ++ L+E+C      L+ R++ +LT++  PS  +++KLK ++  +  D+R ++PI+ GL + E++ ++P  +   +  K V+ +FR+L  V   DP  G+ V       P E++   H++E  N  E ++++   +  F +  +   +  S  I  +     +P LF+ +L   F  +     +V N+  ++ +K++++ S  W   F +C  +L  +++ AV+  L  ++ E +
Sbjct:   53 SILDNFLTEMLEFAELNDSRILCLLVDFLLKASAKDFTLCNKTVERYSFYLIPNKSIKRYESVIKRVVVASTNLYPIVLEFAIMDKNDNAESCWDAFN---LLKNRICMLVSDDHEGVRTVTVKFLEALILCQSPKPRELATGSNISWAREANTRFNRISLSDVPRSHRFLSYHKTQLEAEEN-----FSALLKQTTVAEATSQNLITVIESLCMITRCRPQWENALPRVFDVIKALHSNVPPMLSKGQVKFLRKSFKYNLLRFLKLPASVPLQQKITTMLTNYLGASPREVQQSIP-PELIQKIAPPRPPQHPAEPVAKRPKIQ-----NQIFEDDDDDDDEAGPSTSTVNAKDARTEAIDMTAKFIMECLNHETVMN---LVKISLYTLPSEMPAAFASSYTPIANAGTEPNRQELSELMAVQMTNKEIGPGYEWLQQQRKKEY------------------EARNKARSEGMAI------AQTPIHEPNMSNRVPAQ----IVKQSLQEINTLPVIQ---KAKKAFNLVEEAVVFDDKEAAEMFELAYESVLQAERRVVAGGARLMYQKLVVRLTTRFWEDCTPFEEKLIEFVLADHKKRNDLALLWLCELYAQYQGYSNCALFMKEMIAGQEGLTQAQRLDRYDQAMCKMLDAMLERNMEKEALFYKVLLETPLLTPNAIERLKQVCLAKEN-EHGMAMLRELIMTRNRQRPQLLQFLFGLFFMERPELRSSCLEVVKELCYLP-FIRSSLSDQARMQIHDCLQESP-----PMYMRSSEDSDQWTDEMYKNSLAVYSTLMPSDPLLLIPLASVYAQSTNVFKRVVLRSLEPVFRQL--SQEMVISLIEDCPYGAETLVARLVVLLTERITPSTDLIQKLKILHDERKMDIRALLPIIGGLEREEVVRLIPTFIFRAEYQKSVNVLFRKLYTVR--DPQTGNLVFD-----PIEVIKEYHKIEPKNDNEAELLVNNLEFLF-DPALLKPDTASQAIEAVFKWENVPFLFLHSLYTLFHKFKTFESFVANLFYKVTEKKMYQQSDRWKQAFFKCIKELKTKAYPAVITFLSFEEYEEL 1068          
BLAST of Symplekin vs. Ensembl Fly
Match: Sym (gene:FBgn0037371 transcript:FBtr0078723)

HSP 1 Score: 424.861 bits (1091), Expect = 2.164e-128
Identity = 320/1136 (28.17%), Postives = 562/1136 (49.47%), Query Frame = 1
Query:   79 RVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLS---SKRARTSVNAHSDYS---DLTYNDSIIKKFAAPSLEQK--SPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLV------SAGYLSLESKEKRETFQ-----------DESNSNSILED-FPMSGYANQK-------SKNQMTLLKKHPFSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITSDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSI--HPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSL-IHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPL--MVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSN---AILSLINSDSV 3363
            +VVD CN  +       K   + +++E ++     L + F E +L L  + N  VR  V+ F+E  CKV  +L+   +  +  L+ D S  V+KR+  A  +IY   L     L        +A+    +I   ++  +D+ N G+    IK +E +V+LQS  F D +  K ++ D SL  +P   T+   + E L++ G  + ++L++     H SS ++    +SL  IAK RP FM  V+E+F+  + N+P  L + QV+S+RK+LK  L +LLK+    EF S +  +L+DLG + +EI + +PK D+    +R+++   N +   +KRAR +           +L   +   +K  +  + +K  +   R P  V  L  E LP L                 P  +P  F   YTPI     Q Q+ ++SR    QL        A   S E   + +  Q           DE     + E+ F     A +K       +K + T+++K      K   L+ +TK LP    ++   ++ +RIL      N  ++C                 +     S+   L ++ +A F     Y  ++++ ++D+K R D+  S L +EY+  + +        EN   P  A     + ++ G+ +     D K     R+ LEAP++   ++  L         + +G ++I++L   RP  +   + ++L+FS  + +++R  A +    +    +     I +FA   L ++ Q  P  ++        T  P DW ++  + C  L   L+P    + +  + +VFV     +KRTI++ +DIPIK+MG+ S  +L+L+E+C      L+IR+I+ILT++ +PSP   +V +++++Y NK  DVR++IP+L GLT++E+I +LPKL+ LN  +V EVF RLL + A      +F  +T  + P ++LVA+H ++ +  ++K +++A+ +C  E+ ++TQE L  V+ QL+++  LPTL MRT +QS ++YPR+  +V+N+L RLI KQVW+   +W+GF++   +L  QS  +LL LP  +L       P+ R  +  Y ++  Q + ++ S     +L +I+  SV
Sbjct:   29 KVVDWCNELV-IASPSTKCELLAKVQETVLGSCAELAEEFLESVLSLAHDSNMEVRKQVVAFVEQVCKVKVELLPHVINVVSMLLRDNSAQVIKRVIQACGSIYKNGLQYLCSLMEPGDSAEQAWNILSLIKAQILDMIDNENDGIRTNAIKFLEGVVVLQS--FADEDSLK-RDGDFSLADVPDHCTL--FRREKLQEEGNNILDILLQFHGTTHISSVNLIACTSSLCTIAKMRPIFMGAVVEAFKQLNANLPPTLTDSQVSSVRKSLKMQLQTLLKNRGAFEFASTIRGMLVDLGSSTNEIQKLIPKMDKQEMARRQKRILENAAQSLAKRARLACEQQDQQQREMELDTEELERQKQKSTRVNEKFLAEHFRNPETVVTLVLEFLPSL-----------------PTEVPQKFLQEYTPIREMSIQQQVTNISRFFGEQLSEKRLGPGAATFSREPPMRVKKVQAIESTLTAMEVDEDAVQKLSEEEFQRKEEATKKLRETMERAKGEQTVIEKMK-ERAKTLKLQEITKPLPRNLKEKFLTDAVRRIL------NSERQC-----------------IKGGVSSKRRKLVTVIAATFPDNVRYG-IMEFILEDIKQRIDLAFSWLFEEYSLLQGFTRHTYVKTENR--PDHAYNELLNKLIFGIGERCDHKD-KIILIRRVYLEAPILPEVSIGHLVQLSLDDEFSQHGLELIKDLAVLRPPRKNRFVRVLLNFSVHERLDLRDLAQAHLVSLYHVHKILPARIDEFALEWLKFIEQESPPAAVFSQDFGRPTEEP-DWREDTTKVCFGLAFTLLPYKPEVYLQQICQVFVSTSAELKRTILRSLDIPIKKMGVESPTLLQLIEDCPKGMETLVIRIIYILTER-VPSPHEELVRRVRDLYQNKVKDVRVMIPVLSGLTRSELISVLPKLIKLNPAVVKEVFNRLLGIGA------EFAHQTMAMTPTDILVALHTIDTSVCDIKAIVKATSLCLAERDLYTQEVLMAVLQQLVEVTPLPTLMMRTTIQSLTLYPRLANFVMNLLQRLIIKQVWRQKVIWEGFLKTVQRLKPQSMPILLHLPPAQLVDALQQCPDLRPALSEYAES-MQDEPMNGSGITQQVLDIISGKSV 1104          
BLAST of Symplekin vs. Ensembl Zebrafish
Match: sympk (symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 380/1108 (34.30%), Postives = 621/1108 (56.05%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGY-------LSLESKEKRETFQDESNSNS--ILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLPTETMQEIFHESFKRI-----LVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELIT-SDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINS 3354
            +RVVDL N     +  EEK + + Q++EL++ K+PSLLDNF ++I+    +++  VR  VI FIE ACK D++L+ + +  L  L+ DES NV+K+    +  +Y ++L   ++ KS +      +     +   +++ +DS N G+    IK  E ++I  S R PDS+ PK +E D+SLDKIP D T   ++ + L + G    + L+K +     SS ++ T L SL  +A+QRP FMS V++++E+ H N+P  L + QV+S+RK LK  L+++LKHPS ++FH Q++TLL DLGM+ SEI R  P A    Q +++   E  +  KR +  + A  D  D        K+  AP +  K  S         L+ E L  L T  NV +LVL+SM+ LPE MP +FQ+ YTP+ +AGT  QI HL+RL++ Q+ +AG         + + + K E    ES+S    I+            S    +   K P   + P   +     LP+  ++       K++     +V P    ++++  AN       +   +         R  +L  L +   G  +   +L+++ ++D+++R ++  SLL  EY  Y      +S+            +  Y+  L  +L  L    + ++  F +++LEAP+IT  AL +++ YC  +     G   ++EL   RP  + + L ++L+ +S +  +VRS ALS  K  +   E+  + I  FA T + +L+   P + +      T +   WT+E VR CLYL+L+L+P+NH L+H LA V+ +A   +KR+++++I+ PI+ MGMNS ++L LVENC      L+ R +HILTDK  PSP +VE+++++YH +  DVR +IP++ GL K E+I+ LPKL+ LN  +V EVF RLL          +     SP+ P ELL+A+H ++ +  ++K +I+A+ +CF EK ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+L+RLI KQVWK   +W+GF++CC +   QS+ VLLQLP  +L SVF   PE R  + +++ + T  Q+ H   +I++++ +
Sbjct:   29 ERVVDLLNQAA-LISTEEKLIVLKQVQELVINKDPSLLDNFLDEIIAFQTDKSIEVRKFVIGFIEEACKRDNELLLRLIANLNMLMRDESVNVVKKAILTLTQLYKVALQWLVRTKSVTDMQEACWDMVTQMKGDVLALLDSDNDGVRTHAIKFTESLIITLSPRTPDSDTPKKQEGDISLDKIPKDHTY--IRYDTLCEEGKTALDQLLKFMVHPAISSINLTTALGSLATLARQRPMFMSEVVQAYEMLHANLPPTLAKSQVSSVRKNLKLHLVAVLKHPSSVDFHVQISTLLQDLGMSPSEITRCTPVA---VQPRKRLHHEPYVEGKRIK--MEAVEDDED--------KEEPAPVVTPKPSSSIGTQSAIDLTAEFLLPLLTSDNVANLVLISMVYLPEVMPASFQATYTPVESAGTDAQIKHLARLMATQMTAAGLGPGLEQCKARDEEVKEEGAAGESSSKDPLIIRKLSAVSLGQAISVVGASAAYKSPIIEEAPQIKKLPEPILPSTQLKAPGASGRKKVFKLADVVQPFSEVQIEKL-ANMAIKRILYSEKAIAQTGMSHVRVKLLARLVTQFEGTKK--NDLLQFVLEDMRSRSELAFSLLYHEYNEY------LSQEPS-------GCLDSYEHCLFTLLSGLQERPEQRDGLFTKIVLEAPIITDSALEVIQRYCEDESRVYLGMSTLKELIFKRPSRQYQYLNVLLNLTSHEKEKVRSTALSFIKR-MYEKEHLKDCIEKFALTYMQFLVHPNPPSLLFGAGEDTEVAAPWTEETVRQCLYLYLSLLPLNHRLVHELAAVYTEAIADIKRSVLRVIEQPIRGMGMNSPDLLLLVENCPKGAETLVTRCLHILTDKVPPSPELVERVRDLYHKRVPDVRFLIPVINGLEKNEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HSEGSSSMSPLTPGELLIALHNIDSSKCDMKSIIKATNLCFGEKNVYTSEVLAVVMQQLMEQTPLPILLMRTVIQSLTMYPRLAGFVMNILARLILKQVWKYPKVWEGFVKCCQRTKPQSYNVLLQLPPPQLASVFERCPEMREPLLQHVHSFTPHQQAHIPTSIMTVLEA 1098          
BLAST of Symplekin vs. Ensembl Zebrafish
Match: sympk (symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 380/1108 (34.30%), Postives = 621/1108 (56.05%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGY-------LSLESKEKRETFQDESNSNS--ILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLPTETMQEIFHESFKRI-----LVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELIT-SDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINS 3354
            +RVVDL N     +  EEK + + Q++EL++ K+PSLLDNF ++I+    +++  VR  VI FIE ACK D++L+ + +  L  L+ DES NV+K+    +  +Y ++L   ++ KS +      +     +   +++ +DS N G+    IK  E ++I  S R PDS+ PK +E D+SLDKIP D T   ++ + L + G    + L+K +     SS ++ T L SL  +A+QRP FMS V++++E+ H N+P  L + QV+S+RK LK  L+++LKHPS ++FH Q++TLL DLGM+ SEI R  P A    Q +++   E  +  KR +  + A  D  D        K+  AP +  K  S         L+ E L  L T  NV +LVL+SM+ LPE MP +FQ+ YTP+ +AGT  QI HL+RL++ Q+ +AG         + + + K E    ES+S    I+            S    +   K P   + P   +     LP+  ++       K++     +V P    ++++  AN       +   +         R  +L  L +   G  +   +L+++ ++D+++R ++  SLL  EY  Y      +S+            +  Y+  L  +L  L    + ++  F +++LEAP+IT  AL +++ YC  +     G   ++EL   RP  + + L ++L+ +S +  +VRS ALS  K  +   E+  + I  FA T + +L+   P + +      T +   WT+E VR CLYL+L+L+P+NH L+H LA V+ +A   +KR+++++I+ PI+ MGMNS ++L LVENC      L+ R +HILTDK  PSP +VE+++++YH +  DVR +IP++ GL K E+I+ LPKL+ LN  +V EVF RLL          +     SP+ P ELL+A+H ++ +  ++K +I+A+ +CF EK ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+L+RLI KQVWK   +W+GF++CC +   QS+ VLLQLP  +L SVF   PE R  + +++ + T  Q+ H   +I++++ +
Sbjct:   29 ERVVDLLNQAA-LISTEEKLIVLKQVQELVINKDPSLLDNFLDEIIAFQTDKSIEVRKFVIGFIEEACKRDNELLLRLIANLNMLMRDESVNVVKKAILTLTQLYKVALQWLVRTKSVTDMQEACWDMVTQMKGDVLALLDSDNDGVRTHAIKFTESLIITLSPRTPDSDTPKKQEGDISLDKIPKDHTY--IRYDTLCEEGKTALDQLLKFMVHPAISSINLTTALGSLATLARQRPMFMSEVVQAYEMLHANLPPTLAKSQVSSVRKNLKLHLVAVLKHPSSVDFHVQISTLLQDLGMSPSEITRCTPVA---VQPRKRLHHEPYVEGKRIK--MEAVEDDED--------KEEPAPVVTPKPSSSIGTQSAIDLTAEFLLPLLTSDNVANLVLISMVYLPEVMPASFQATYTPVESAGTDAQIKHLARLMATQMTAAGLGPGLEQCKARDEEVKEEGAAGESSSKDPLIIRKLSAVSLGQAISVVGASAAYKSPIIEEAPQIKKLPEPILPSTQLKAPGASGRKKVFKLADVVQPFSEVQIEKL-ANMAIKRILYSEKAIAQTGMSHVRVKLLARLVTQFEGTKK--NDLLQFVLEDMRSRSELAFSLLYHEYNEY------LSQEPS-------GCLDSYEHCLFTLLSGLQERPEQRDGLFTKIVLEAPIITDSALEVIQRYCEDESRVYLGMSTLKELIFKRPSRQYQYLNVLLNLTSHEKEKVRSTALSFIKR-MYEKEHLKDCIEKFALTYMQFLVHPNPPSLLFGAGEDTEVAAPWTEETVRQCLYLYLSLLPLNHRLVHELAAVYTEAIADIKRSVLRVIEQPIRGMGMNSPDLLLLVENCPKGAETLVTRCLHILTDKVPPSPELVERVRDLYHKRVPDVRFLIPVINGLEKNEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HSEGSSSMSPLTPGELLIALHNIDSSKCDMKSIIKATNLCFGEKNVYTSEVLAVVMQQLMEQTPLPILLMRTVIQSLTMYPRLAGFVMNILARLILKQVWKYPKVWEGFVKCCQRTKPQSYNVLLQLPPPQLASVFERCPEMREPLLQHVHSFTPHQQAHIPTSIMTVLEA 1098          
BLAST of Symplekin vs. Ensembl Xenopus
Match: vps8 (VPS8, CORVET complex subunit [Source:Xenbase;Acc:XB-GENE-988494])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 377/1130 (33.36%), Postives = 619/1130 (54.78%), Query Frame = 1
Query:   67 SIFDRVVDLCN-STIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGY-------------LSLESKEKRETFQDESNSNSILEDFPMS--GYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLP---------------TETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELIT-SDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            S  +RVV+L N + + T D+  K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  V++FIE ACK+D++L+ K +  L  L++DE+ NV+K+    M  +Y ++L    + +  S      +     +   ++  ++S N G+    +K +E +++  S R PDSE+PK +E D+SL++IP+D     L+   L   G +    L+K +     SS ++   L SL +IA+QRP FM+ VI+++E  H N+P  L + QV+S+RK LK  LLS+L+HPS  E+   ++TLL+DLG +Q EI R LP   + S  KR R E+     K++RT +        L  +D        P++   +PS +       ++ E L  L +  NV +LVL+SM+ LP++MP +FQ+ YTP+ +AGT  QI HL+RL++ Q+ S G              +  E   K E    +   +++ +   +S  G  ++K+K +    +  P + ++P  +   T+  P               TE + E+  +S K   V  +L  E     +  +                   R  +L  L + L     +  E++ + + D + R D+ L+ L +EY  Y++                 A    Y   L+G+L  L    D ++  F +++LEAPL+T  AL++LR YC  +  +  G   +R+L   RP  + + L ++LD SS +  ++R  +L   K  +   E+    I  FA   L  L+   P + +      T +   WT++ V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +HILTDK  PSP +V++++ +YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P +LLVA+H ++ +  ++K VI+A+ +CF  + ++T E L++V+ QL+D   LP L MRT++Q+  MYPR+ G+++N+L+RLI KQVWK   +W+GFI+CC +   QSF+VLLQLP  +L SV  + P+ R  +  ++   T  Q  H  ++I++++ ++S
Sbjct:   30 STSERVVELLNMAALATNDS--KITMLKQVQELIINKDPTLLDNFLDEIIAFQADKSVEVRKFVVNFIEEACKLDNELLIKLIANLHMLLKDENVNVVKKSILTMTQLYKVALQWVARSRPPSEQQESCWDLVTEMAADILLLLESDNDGIRTHAVKFVESLIVTLSPRTPDSEVPKRQEGDISLEQIPSDHAF--LKYNTLRDVGKQAVKELLKFMAHPAISSINLTAALGSLASIARQRPMFMAEVIQAYETLHANLPPTLAKSQVSSVRKNLKLQLLSVLRHPSSYEYQGPISTLLLDLGTSQGEITRHLPPPRD-SNRKRAR-EDGEGGQKKSRTDI-------PLPDDDDDKDTIQLPTIPAPAPSTQS---ATDITAEFLRPLLSPENVANLVLISMVYLPDSMPASFQATYTPVESAGTDAQIRHLARLMATQMTSVGIGPGVEQTKDVPVDVVEEENTKPEGLVIKRRISALTKGQAISVLGCQSEKAKEEEEEEEDAPLAKKRPEPILPATQIRPSGVGGRKKVFRLKEVTEPLTEVQMKSLKLGAVQRILQAERTVGSSGASQM-----------------RVKVLARLVTQL--DISVKAEVLSHFLSDPRMRLDLALAWLYQEYCEYQSG----------------AGEEAYQECLIGILTGLQERPDQRDGVFTKVVLEAPLLTDSALDVLRKYCEDEGRSYLGMSTLRDLILTRPARQFQYLHLLLDLSSHEKDKIRQQSLHFIKR-MYEKESLRPYIEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEDTVKQCLYLYLALLPQNHKLIHELASVYTEATADIKRTVLRVIETPIRGMGMNSPELLLLVENCPKGAETLVTRCLHILTDKVPPSPELVKRVRELYHKRLPDVRFLIPVLNGLDKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEVSSSMSPLTPGDLLVALHNIDSSKCDMKSVIKATNLCFSARSVYTSEVLAVVLQQLMDTTPLPMLLMRTVIQALGMYPRLGGFIMNILTRLIYKQVWKYPKVWEGFIKCCQRTKPQSFSVLLQLPPPQLLSVLQTSPDLRDPLLVHVRAFTPHQLAHVPHSIMAILEAES 1102          
BLAST of Symplekin vs. Ensembl Xenopus
Match: vps8 (VPS8, CORVET complex subunit [Source:Xenbase;Acc:XB-GENE-988494])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 377/1130 (33.36%), Postives = 619/1130 (54.78%), Query Frame = 1
Query:   67 SIFDRVVDLCN-STIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGY-------------LSLESKEKRETFQDESNSNSILEDFPMS--GYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLP---------------TETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            S  +RVV+L N + + T D+  K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  V++FIE ACK+D++L+ K +  L  L++DE+ NV+K+    M  +Y ++L    + +  S      +     +   ++  ++S N G+    +K +E +++  S R PDSE+PK +E D+SL++IP+D     L+   L   G +    L+K +     SS ++   L SL +IA+QRP FM+ VI+++E  H N+P  L + QV+S+RK LK  LLS+L+HPS  E+   ++TLL+DLG +Q EI R LP   + S  KR R E+     K++RT +        L  +D        P++   +PS +       ++ E L  L +  NV +LVL+SM+ LP++MP +FQ+ YTP+ +AGT  QI HL+RL++ Q+ S G              +  E   K E    +   +++ +   +S  G  ++K+K +    +  P + ++P  +   T+  P               TE + E+  +S K   V  +L  E     +  +                   R  +L  L + L     +  E++ + + D + R D+ L+ L +EY  Y++                 A    Y   L+G+L  L    D ++  F +++LEAPL+T  AL++LR YC  +  +  G   +R+L   RP  + + L ++LD SS +  ++R  +L   K  +   E+    I  FA   L  L+   P + +      T +   WT++ V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +HILTDK  PSP +V++++ +YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P +LLVA+H ++ +  ++K VI+A+ +CF  + ++T E L++V+ QL+D   LP L MRT++Q+  MYPR+ G+++N+L+RLI KQVWK   +W+GFI+CC +   QSF+VLLQLP  +L SV  + P+ R  +  ++   T  Q  H  ++I++++ ++S
Sbjct:   21 STSERVVELLNMAALATNDS--KITMLKQVQELIINKDPTLLDNFLDEIIAFQADKSVEVRKFVVNFIEEACKLDNELLIKLIANLHMLLKDENVNVVKKSILTMTQLYKVALQWVARSRPPSEQQESCWDLVTEMAADILLLLESDNDGIRTHAVKFVESLIVTLSPRTPDSEVPKRQEGDISLEQIPSDHAF--LKYNTLRDVGKQAVKELLKFMAHPAISSINLTAALGSLASIARQRPMFMAEVIQAYETLHANLPPTLAKSQVSSVRKNLKLQLLSVLRHPSSYEYQGPISTLLLDLGTSQGEITRHLPPPRD-SNRKRAR-EDGEGGQKKSRTDI-------PLPDDDDDKDTIQLPTIPAPAPSTQS---ATDITAEFLRPLLSPENVANLVLISMVYLPDSMPASFQATYTPVESAGTDAQIRHLARLMATQMTSVGIGPGVEQTKDVPVDVVEEENTKPEGLVIKRRISALTKGQAISVLGCQSEKAKEEEEEEEDAPLAKKRPEPILPATQIRPSGVGGRKKVFRLKEVTEPLTEVQMKSLKLGAVQRILQAERTVGSSGASQM-----------------RVKVLARLVTQL--DISVKAEVLSHFLSDPRMRLDLALAWLYQEYCEYQSG----------------AGEEAYQECLIGILTGLQERPDQRDGVFTKVVLEAPLLTDSALDVLRKYCEDEGRSYLGMSTLRDLILTRPARQFQYLHLLLDLSSHEKDKIRQQSLHFIKR-MYEKESLRPYIEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEDTVKQCLYLYLALLPQNHKLIHELASVYTEATADIKRTVLRVIETPIRGMGMNSPELLLLVENCPKGAETLVTRCLHILTDKVPPSPELVKRVRELYHKRLPDVRFLIPVLNGLDKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEVSSSMSPLTPGDLLVALHNIDSSKCDMKSVIKATNLCFSARSVYTSEVLAVVLQQLMDTTPLPMLLMRTVIQALGMYPRLGGFIMNILTRLIYKQVWKYPKVWEGFIKCCQRTKPQSFSVLLQLPPPQLLSVLQTSPDLRDPLLVHVRAFTPHQLAHVPHSIMAILEAES 1093          
BLAST of Symplekin vs. Ensembl Xenopus
Match: vps8 (VPS8, CORVET complex subunit [Source:Xenbase;Acc:XB-GENE-988494])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 365/1110 (32.88%), Postives = 604/1110 (54.41%), Query Frame = 1
Query:  124 EEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGY-------------LSLESKEKRETFQDESNSNSILEDFPMS--GYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLP---------------TETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELIT-SDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  V++FIE ACK+D++L+ K +  L  L++DE+ NV+K+    M  +Y ++L    + +  S      +     +   ++  ++S N G+    +K +E +++  S R PDSE+PK +E D+SL++IP+D     L+   L   G +    L+K +     SS ++   L SL +IA+QRP FM+ VI+++E  H N+P  L + QV+S+RK LK  LLS+L+HPS  E+   ++TLL+DLG +Q EI R LP   + +   RKR  E+    ++          +  L  +D        P++   +PS +       ++ E L  L +  NV +LVL+SM+ LP++MP +FQ+ YTP+ +AGT  QI HL+RL++ Q+ S G              +  E   K E    +   +++ +   +S  G  ++K+K +    +  P + ++P  +   T+  P               TE + E+  +S K   V  +L  E     +  +                   R  +L  L + L     +  E++ + + D + R D+ L+ L +EY  Y++                 A    Y   L+G+L  L    D ++  F +++LEAPL+T  AL++LR YC  +  +  G   +R+L   RP  + + L ++LD SS +  ++R  +L   K  +   E+    I  FA   L  L+   P + +      T +   WT++ V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +HILTDK  PSP +V++++ +YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P +LLVA+H ++ +  ++K VI+A+ +CF  + ++T E L++V+ QL+D   LP L MRT++Q+  MYPR+ G+++N+L+RLI KQVWK   +W+GFI+CC +   QSF+VLLQLP  +L SV  + P+ R  +  ++   T  Q  H  ++I++++ ++S
Sbjct:    8 DSKITMLKQVQELIINKDPTLLDNFLDEIIAFQADKSVEVRKFVVNFIEEACKLDNELLIKLIANLHMLLKDENVNVVKKSILTMTQLYKVALQWVARSRPPSEQQESCWDLVTEMAADILLLLESDNDGIRTHAVKFVESLIVTLSPRTPDSEVPKRQEGDISLEQIPSDHAF--LKYNTLRDVGKQAVKELLKFMAHPAISSINLTAALGSLASIARQRPMFMAEVIQAYETLHANLPPTLAKSQVSSVRKNLKLQLLSVLRHPSSYEYQGPISTLLLDLGTSQGEITRHLPPPRDSN---RKRAREDGEGGQK--------KSHIPLPDDDDDKDTIQLPTIPAPAPSTQS---ATDITAEFLRPLLSPENVANLVLISMVYLPDSMPASFQATYTPVESAGTDAQIRHLARLMATQMTSVGIGPGVEQTKDVPVDVVEEENTKPEGLVIKRRISALTKGQAISVLGCQSEKAKEEEEEEEDAPLAKKRPEPILPATQIRPSGVGGRKKVFRLKEVTEPLTEVQMKSLKLGAVQRILQAERTVGSSGASQM-----------------RVKVLARLVTQL--DISVKAEVLSHFLSDPRMRLDLALAWLYQEYCEYQSG----------------AGEEAYQECLIGILTGLQERPDQRDGVFTKVVLEAPLLTDSALDVLRKYCEDEGRSYLGMSTLRDLILTRPARQFQYLHLLLDLSSHEKDKIRQQSLHFIKR-MYEKESLRPYIEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEDTVKQCLYLYLALLPQNHKLIHELASVYTEATADIKRTVLRVIETPIRGMGMNSPELLLLVENCPKGAETLVTRCLHILTDKVPPSPELVKRVRELYHKRLPDVRFLIPVLNGLDKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEVSSSMSPLTPGDLLVALHNIDSSKCDMKSVIKATNLCFSARSVYTSEVLAVVLQQLMDTTPLPMLLMRTVIQALGMYPRLGGFIMNILTRLIYKQVWKYPKVWEGFIKCCQRTKPQSFSVLLQLPPPQLLSVLQTSPDLRDPLLVHVRAFTPHQLAHVPHSIMAILEAES 1060          
BLAST of Symplekin vs. Ensembl Xenopus
Match: vps8 (VPS8, CORVET complex subunit [Source:Xenbase;Acc:XB-GENE-988494])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 371/1125 (32.98%), Postives = 612/1125 (54.40%), Query Frame = 1
Query:   82 VVDLCN-STIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGY-------------LSLESKEKRETFQDESNSNSILEDFPMS--GYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLP---------------TETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELIT-SDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            VV+L N + + T D+  K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  V++FIE ACK+D++L+ K +  L  L++DE+ NV+K+    M  +Y ++L    + +  S      +     +   ++  ++S N G+    +K +E +++  S R PDSE+PK +E D+SL++IP+D     L+   L   G +    L+K +     SS ++   L SL +IA+QRP FM+ VI+++E  H N+P  L + QV+S+RK LK  LLS+L+HPS  E+   ++TLL+DLG +Q EI R LP   + +   RKR  E+    ++             L  +D        P++   +PS +       ++ E L  L +  NV +LVL+SM+ LP++MP +FQ+ YTP+ +AGT  QI HL+RL++ Q+ S G              +  E   K E    +   +++ +   +S  G  ++K+K +    +  P + ++P  +   T+  P               TE + E+  +S K   V  +L  E     +  +                   R  +L  L + L     +  E++ + + D + R D+ L+ L +EY  Y++                 A    Y   L+G+L  L    D ++  F +++LEAPL+T  AL++LR YC  +  +  G   +R+L   RP  + + L ++LD SS +  ++R  +L   K  +   E+    I  FA   L  L+   P + +      T +   WT++ V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +HILTDK  PSP +V++++ +YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P +LLVA+H ++ +  ++K VI+A+ +CF  + ++T E L++V+ QL+D   LP L MRT++Q+  MYPR+ G+++N+L+RLI KQVWK   +W+GFI+CC +   QSF+VLLQLP  +L SV  + P+ R  +  ++   T  Q  H  ++I++++ ++S
Sbjct:   19 VVELLNMAALATNDS--KITMLKQVQELIINKDPTLLDNFLDEIIAFQADKSVEVRKFVVNFIEEACKLDNELLIKLIANLHMLLKDENVNVVKKSILTMTQLYKVALQWVARSRPPSEQQESCWDLVTEMAADILLLLESDNDGIRTHAVKFVESLIVTLSPRTPDSEVPKRQEGDISLEQIPSDHAF--LKYNTLRDVGKQAVKELLKFMAHPAISSINLTAALGSLASIARQRPMFMAEVIQAYETLHANLPPTLAKSQVSSVRKNLKLQLLSVLRHPSSYEYQGPISTLLLDLGTSQGEITRHLPPPRDSN---RKRAREDGEGGQKKNIP---------LPDDDDDKDTIQLPTIPAPAPSTQS---ATDITAEFLRPLLSPENVANLVLISMVYLPDSMPASFQATYTPVESAGTDAQIRHLARLMATQMTSVGIGPGVEQTKDVPVDVVEEENTKPEGLVIKRRISALTKGQAISVLGCQSEKAKEEEEEEEDAPLAKKRPEPILPATQIRPSGVGGRKKVFRLKEVTEPLTEVQMKSLKLGAVQRILQAERTVGSSGASQV---------------IMRVKVLARLVTQL--DISVKAEVLSHFLSDPRMRLDLALAWLYQEYCEYQSG----------------AGEEAYQECLIGILTGLQERPDQRDGVFTKVVLEAPLLTDSALDVLRKYCEDEGRSYLGMSTLRDLILTRPARQFQYLHLLLDLSSHEKDKIRQQSLHFIKR-MYEKESLRPYIEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEDTVKQCLYLYLALLPQNHKLIHELASVYTEATADIKRTVLRVIETPIRGMGMNSPELLLLVENCPKGAETLVTRCLHILTDKVPPSPELVKRVRELYHKRLPDVRFLIPVLNGLDKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEVSSSMSPLTPGDLLVALHNIDSSKCDMKSVIKATNLCFSARSVYTSEVLAVVLQQLMDTTPLPMLLMRTVIQALGMYPRLGGFIMNILTRLIYKQVWKYPKVWEGFIKCCQRTKPQSFSVLLQLPPPQLLSVLQTSPDLRDPLLVHVRAFTPHQLAHVPHSIMAILEAES 1085          
BLAST of Symplekin vs. Ensembl Xenopus
Match: vps8 (VPS8, CORVET complex subunit [Source:Xenbase;Acc:XB-GENE-988494])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 371/1125 (32.98%), Postives = 611/1125 (54.31%), Query Frame = 1
Query:   82 VVDLCN-STIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGY-------------LSLESKEKRETFQDESNSNSILEDFPMS--GYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLP---------------TETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELIT-SDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            VV+L N + + T D+  K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  V++FIE ACK+D++L+ K +  L  L++DE+ NV+K+    M  +Y ++L    + +  S      +     +   ++  ++S N G+    +K +E +++  S R PDSE+PK +E D+SL++IP+D     L+   L   G +    L+K +     SS ++   L SL +IA+QRP FM+ VI+++E  H N+P  L + QV+S+RK LK  LLS+L+HPS  E+   ++TLL+DLG +Q EI R LP   + ++             KRAR              +D+I      P++   +PS +       ++ E L  L +  NV +LVL+SM+ LP++MP +FQ+ YTP+ +AGT  QI HL+RL++ Q+ S G              +  E   K E    +   +++ +   +S  G  ++K+K +    +  P + ++P  +   T+  P               TE + E+  +S K   V  +L  E     +  +                   R  +L  L + L     +  E++ + + D + R D+ L+ L +EY  Y++                 A    Y   L+G+L  L    D ++  F +++LEAPL+T  AL++LR YC  +  +  G   +R+L   RP  + + L ++LD SS +  ++R  +L   K  +   E+    I  FA   L  L+   P + +      T +   WT++ V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +HILTDK  PSP +V++++ +YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P +LLVA+H ++ +  ++K VI+A+ +CF  + ++T E L++V+ QL+D   LP L MRT++Q+  MYPR+ G+++N+L+RLI KQVWK   +W+GFI+CC +   QSF+VLLQLP  +L SV  + P+ R  +  ++   T  Q  H  ++I++++ ++S
Sbjct:    3 VVELLNMAALATNDS--KITMLKQVQELIINKDPTLLDNFLDEIIAFQADKSVEVRKFVVNFIEEACKLDNELLIKLIANLHMLLKDENVNVVKKSILTMTQLYKVALQWVARSRPPSEQQESCWDLVTEMAADILLLLESDNDGIRTHAVKFVESLIVTLSPRTPDSEVPKRQEGDISLEQIPSDHAF--LKYNTLRDVGKQAVKELLKFMAHPAISSINLTAALGSLASIARQRPMFMAEVIQAYETLHANLPPTLAKSQVSSVRKNLKLQLLSVLRHPSSYEYQGPISTLLLDLGTSQGEITRHLPPPRDSNR-------------KRARE-------------DDTI----QLPTIPAPAPSTQS---ATDITAEFLRPLLSPENVANLVLISMVYLPDSMPASFQATYTPVESAGTDAQIRHLARLMATQMTSVGIGPGVEQTKDVPVDVVEEENTKPEGLVIKRRISALTKGQAISVLGCQSEKAKEEEEEEEDAPLAKKRPEPILPATQIRPSGVGGRKKVFRLKEVTEPLTEVQMKSLKLGAVQRILQAERTVGSSGASQV---------------IMRVKVLARLVTQL--DISVKAEVLSHFLSDPRMRLDLALAWLYQEYCEYQSG----------------AGEEAYQECLIGILTGLQERPDQRDGVFTKVVLEAPLLTDSALDVLRKYCEDEGRSYLGMSTLRDLILTRPARQFQYLHLLLDLSSHEKDKIRQQSLHFIKR-MYEKESLRPYIEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEDTVKQCLYLYLALLPQNHKLIHELASVYTEATADIKRTVLRVIETPIRGMGMNSPELLLLVENCPKGAETLVTRCLHILTDKVPPSPELVKRVRELYHKRLPDVRFLIPVLNGLDKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEVSSSMSPLTPGDLLVALHNIDSSKCDMKSVIKATNLCFSARSVYTSEVLAVVLQQLMDTTPLPMLLMRTVIQALGMYPRLGGFIMNILTRLIYKQVWKYPKVWEGFIKCCQRTKPQSFSVLLQLPPPQLLSVLQTSPDLRDPLLVHVRAFTPHQLAHVPHSIMAILEAES 1051          
BLAST of Symplekin vs. Ensembl Mouse
Match: Sympk (symplekin [Source:MGI Symbol;Acc:MGI:1915438])

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 401/1128 (35.55%), Postives = 621/1128 (55.05%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSS-KRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSL--ESKEKRETFQDES----NSNSILEDFPMSGYANQKSKNQMTL---------LKKHP--------------FSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINS 3354
            +RVVDL N     +  + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+K+    M  +Y ++L   +K  S    D++  + C  +V ++  ++    DS N G+    IK +E +++  S R  DSE+P+ +E+D+SLD+IP D   P +Q  +L + G      L+K +     SS ++ T L SL NIA+QRP FMS VI+++E  H N+P  L + QV+S+RK LK  LLS+LKHP+ LEF +Q+TTLL+DLG  Q+EI R +P     S+  RKR  ++  S+ K+ +   N   D  D             PS   K+ +         ++ E L  L T  NV +LVL+SM+ LPETMP +FQ+ YTP+ +AGT+ QI HL+RL++ Q+ +AG      ++K+ +E  ++E      S  I     + G A     +Q T+          K+ P                 +K F L  V K L    ++ +   + KRIL            RA    + +               R  IL SL +    G     E++ + ++DV+ R D+  + L +EY +Y A   +              T+  Y+  L+ +L  L    D K+  F +++LEAPLIT  AL ++R YC  +  A  G   + +L   RP  + + L ++LD SS +   VRS AL   K  +   E   E +  FA   L  L+   P + +      T +   WT+E V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +H LTDK  PSP +V++++++YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P ELL+A+H ++    ++K +I+A+ +CF E+ ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+L+RLI KQVWK   +W+GFI+CC +   QSF V+LQLP  +L +VF+  PE R  +  ++ + T  Q+ H  N+I++++ +
Sbjct:   34 ERVVDLLNQAA-LITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVK--SRVISDLQ--EACWDMVSSMAGEIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEVPRRQEHDISLDRIPRDH--PYIQYNVLWEEGKAAVEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPS----SKDSRKRPRDDTDSTLKKMKLEPNLGEDDEDKDLE-------PGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPETMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKPESVLIKRRLSVQGQAISVVGSQSTMSPLEEEVPQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSDVLKPLTDAQVEAMKLGAVKRIL------------RAEKAVACSGAAQV----------RIKILASLVTQFDSG--FKAEVLSFILEDVRARLDLAFAWLYQEYNAYLAAGTS-------------GTLDKYEDCLICLLSGLQEKPDQKDGIFTKVVLEAPLITESALEVIRKYCEDESRAYLGMSTLGDLIFKRPSRQFQYLHVLLDLSSHEKDRVRSQALLFIKR-MYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEGNSALSPLNPGELLIALHNIDSVKCDMKSIIKATNLCFAERNVYTSEVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFVMNILARLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVRSFTPHQQAHIPNSIMTILEA 1100          
BLAST of Symplekin vs. Ensembl Mouse
Match: Sympk (symplekin [Source:MGI Symbol;Acc:MGI:1915438])

HSP 1 Score: 113.62 bits (283), Expect = 1.210e-28
Identity = 51/108 (47.22%), Postives = 76/108 (70.37%), Query Frame = 1
Query: 2989 ERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQ 3312
            E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+L+RLI KQVWK   +W+GFI+CC +   QSF V+LQLP  +L +VF+  PE R  +  ++ + T  Q
Sbjct:    3 EVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFVMNILARLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVRSFTPHQ 110          
BLAST of Symplekin vs. Ensembl Mouse
Match: Sympk (symplekin [Source:MGI Symbol;Acc:MGI:1915438])

HSP 1 Score: 115.546 bits (288), Expect = 2.552e-28
Identity = 68/191 (35.60%), Postives = 113/191 (59.16%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPAD 636
            +RVVDL N     +  + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+K+    M  +Y ++L   +  KS    D++  + C  +V ++  ++    DS N G+    IK +E +++  S R  DSE+P+ +E+D+SLD+IP D
Sbjct:   34 ERVVDLLNQA-ALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMV--KSRVISDLQ--EACWDMVSSMAGEIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEVPRRQEHDISLDRIPRD 219          
BLAST of Symplekin vs. Ensembl Mouse
Match: Sympk (symplekin [Source:MGI Symbol;Acc:MGI:1915438])

HSP 1 Score: 87.0409 bits (214), Expect = 8.197e-19
Identity = 56/170 (32.94%), Postives = 95/170 (55.88%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRF 573
            +RVVDL N     +  + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+K+    M  +Y ++L   +  KS    D++  + C  +V ++  ++    DS N G+    IK +E +++  S R 
Sbjct:   34 ERVVDLLNQA-ALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMV--KSRVISDLQ--EACWDMVSSMAGEIILLLDSDNDGIRTHAIKFVEGLIVTLSPRM 198          
BLAST of Symplekin vs. UniProt/SwissProt
Match: sp|Q92797|SYMPK_HUMAN (Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 397/1112 (35.70%), Postives = 628/1112 (56.47%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSS-KRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSL--ESKEKRETFQDES--NSNSILEDFPMSGYANQ----KSKNQMTLLKKH-PFSTQKPFNLESVT--KTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            +RVVDL N     +  + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+K+    M  +Y ++L   +K +  S    E  + C  +V A+   +    DS N G+    IK +E +++  S R  DSEIP+ +E+D+SLD+IP D   P +Q  +L + G      L+K +     SS ++ T L SL NIA+QRP FMS VI+++E  H N+P  L + QV+S+RK LK  LLS+LKHP+ LEF +Q+TTLL+DLG  Q+EI R +P + +     RKR  +++ S+ K+ +   N   D  D             PS   K+ +         ++ E L  L T  NV +LVL+SM+ LPE MP +FQ+ YTP+ +AGT+ QI HL+RL++ Q+ +AG      ++K+ +E  ++E    + S+L    +S          S + M+ L++  P + ++P  +  VT  +       ++IF  S    ++ PL + +++  +      +       +        R  IL SL +    G  L  E++ + ++DV+ R D+  + L +EY +Y A   +              ++  Y+  L+ +L  L    D K+  F +++LEAPLIT  AL ++R YC  +     G   +R+L   RP  + + L ++LD SS +  +VRS AL   K  +   E   E +  FA   L  L+   P + +      T +   WT+E V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +H LTDK  PSP +V++++++YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P ELL+A+H ++    ++K +I+A+ +CF E+ ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+LSRLI KQVWK   +W+GFI+CC +   QSF V+LQLP  +L +VF+  PE R  +  ++ + T  Q+ H  N+I++++ +  
Sbjct:   34 ERVVDLLNQAA-LITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVIS----ELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDH--PYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDT----RKRPRDDSDSTLKKMKLEPNLGEDDEDKDLE-------PGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSD---VLKPLTDAQVEAMKLGAVKRILRAEKAVACSGAAQV-RIKILASLVTQFNSG--LKAEVLSFILEDVRARLDLAFAWLYQEYNAYLAAGAS-------------GSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAPLITESALEVVRKYCEDESRTYLGMSTLRDLIFKRPSRQFQYLHVLLDLSSHEKDKVRSQALLFIKR-MYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEGNSALSPLNPGELLIALHNIDSVKCDMKSIIKATNLCFAERNVYTSEVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFVMNILSRLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVRSFTPHQQAHIPNSIMTILEASG 1102          
BLAST of Symplekin vs. UniProt/SwissProt
Match: sp|Q80X82|SYMPK_MOUSE (Symplekin OS=Mus musculus OX=10090 GN=Sympk PE=1 SV=2)

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 401/1128 (35.55%), Postives = 621/1128 (55.05%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSS-KRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSL--ESKEKRETFQDES----NSNSILEDFPMSGYANQKSKNQMTL---------LKKHP--------------FSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINS 3354
            +RVVDL N     +  + K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+K+    M  +Y ++L   +K  S    D++  + C  +V ++  ++    DS N G+    IK +E +++  S R  DSE+P+ +E+D+SLD+IP D   P +Q  +L + G      L+K +     SS ++ T L SL NIA+QRP FMS VI+++E  H N+P  L + QV+S+RK LK  LLS+LKHP+ LEF +Q+TTLL+DLG  Q+EI R +P     S+  RKR  ++  S+ K+ +   N   D  D             PS   K+ +         ++ E L  L T  NV +LVL+SM+ LPETMP +FQ+ YTP+ +AGT+ QI HL+RL++ Q+ +AG      ++K+ +E  ++E      S  I     + G A     +Q T+          K+ P                 +K F L  V K L    ++ +   + KRIL            RA    + +               R  IL SL +    G     E++ + ++DV+ R D+  + L +EY +Y A   +              T+  Y+  L+ +L  L    D K+  F +++LEAPLIT  AL ++R YC  +  A  G   + +L   RP  + + L ++LD SS +   VRS AL   K  +   E   E +  FA   L  L+   P + +      T +   WT+E V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +H LTDK  PSP +V++++++YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P ELL+A+H ++    ++K +I+A+ +CF E+ ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+L+RLI KQVWK   +W+GFI+CC +   QSF V+LQLP  +L +VF+  PE R  +  ++ + T  Q+ H  N+I++++ +
Sbjct:   34 ERVVDLLNQAA-LITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVK--SRVISDLQ--EACWDMVSSMAGEIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEVPRRQEHDISLDRIPRDH--PYIQYNVLWEEGKAAVEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPS----SKDSRKRPRDDTDSTLKKMKLEPNLGEDDEDKDLE-------PGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPETMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKPESVLIKRRLSVQGQAISVVGSQSTMSPLEEEVPQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSDVLKPLTDAQVEAMKLGAVKRIL------------RAEKAVACSGAAQV----------RIKILASLVTQFDSG--FKAEVLSFILEDVRARLDLAFAWLYQEYNAYLAAGTS-------------GTLDKYEDCLICLLSGLQEKPDQKDGIFTKVVLEAPLITESALEVIRKYCEDESRAYLGMSTLGDLIFKRPSRQFQYLHVLLDLSSHEKDRVRSQALLFIKR-MYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEGNSALSPLNPGELLIALHNIDSVKCDMKSIIKATNLCFAERNVYTSEVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFVMNILARLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVRSFTPHQQAHIPNSIMTILEA 1100          
BLAST of Symplekin vs. UniProt/SwissProt
Match: sp|Q8MSU4|SYMPK_DROME (Symplekin OS=Drosophila melanogaster OX=7227 GN=Sym PE=1 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 2.169e-127
Identity = 320/1136 (28.17%), Postives = 562/1136 (49.47%), Query Frame = 1
Query:   79 RVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLS---SKRARTSVNAHSDYS---DLTYNDSIIKKFAAPSLEQK--SPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLV------SAGYLSLESKEKRETFQ-----------DESNSNSILED-FPMSGYANQK-------SKNQMTLLKKHPFSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITSDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSI--HPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSL-IHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPL--MVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSN---AILSLINSDSV 3363
            +VVD CN  +       K   + +++E ++     L + F E +L L  + N  VR  V+ F+E  CKV  +L+   +  +  L+ D S  V+KR+  A  +IY   L     L        +A+    +I   ++  +D+ N G+    IK +E +V+LQS  F D +  K ++ D SL  +P   T+   + E L++ G  + ++L++     H SS ++    +SL  IAK RP FM  V+E+F+  + N+P  L + QV+S+RK+LK  L +LLK+    EF S +  +L+DLG + +EI + +PK D+    +R+++   N +   +KRAR +           +L   +   +K  +  + +K  +   R P  V  L  E LP L                 P  +P  F   YTPI     Q Q+ ++SR    QL        A   S E   + +  Q           DE     + E+ F     A +K       +K + T+++K      K   L+ +TK LP    ++   ++ +RIL      N  ++C                 +     S+   L ++ +A F     Y  ++++ ++D+K R D+  S L +EY+  + +        EN   P  A     + ++ G+ +     D K     R+ LEAP++   ++  L         + +G ++I++L   RP  +   + ++L+FS  + +++R  A +    +    +     I +FA   L ++ Q  P  ++        T  P DW ++  + C  L   L+P    + +  + +VFV     +KRTI++ +DIPIK+MG+ S  +L+L+E+C      L+IR+I+ILT++ +PSP   +V +++++Y NK  DVR++IP+L GLT++E+I +LPKL+ LN  +V EVF RLL + A      +F  +T  + P ++LVA+H ++ +  ++K +++A+ +C  E+ ++TQE L  V+ QL+++  LPTL MRT +QS ++YPR+  +V+N+L RLI KQVW+   +W+GF++   +L  QS  +LL LP  +L       P+ R  +  Y ++  Q + ++ S     +L +I+  SV
Sbjct:   29 KVVDWCNELV-IASPSTKCELLAKVQETVLGSCAELAEEFLESVLSLAHDSNMEVRKQVVAFVEQVCKVKVELLPHVINVVSMLLRDNSAQVIKRVIQACGSIYKNGLQYLCSLMEPGDSAEQAWNILSLIKAQILDMIDNENDGIRTNAIKFLEGVVVLQS--FADEDSLK-RDGDFSLADVPDHCTL--FRREKLQEEGNNILDILLQFHGTTHISSVNLIACTSSLCTIAKMRPIFMGAVVEAFKQLNANLPPTLTDSQVSSVRKSLKMQLQTLLKNRGAFEFASTIRGMLVDLGSSTNEIQKLIPKMDKQEMARRQKRILENAAQSLAKRARLACEQQDQQQREMELDTEELERQKQKSTRVNEKFLAEHFRNPETVVTLVLEFLPSL-----------------PTEVPQKFLQEYTPIREMSIQQQVTNISRFFGEQLSEKRLGPGAATFSREPPMRVKKVQAIESTLTAMEVDEDAVQKLSEEEFQRKEEATKKLRETMERAKGEQTVIEKMK-ERAKTLKLQEITKPLPRNLKEKFLTDAVRRIL------NSERQC-----------------IKGGVSSKRRKLVTVIAATFPDNVRYG-IMEFILEDIKQRIDLAFSWLFEEYSLLQGFTRHTYVKTENR--PDHAYNELLNKLIFGIGERCDHKD-KIILIRRVYLEAPILPEVSIGHLVQLSLDDEFSQHGLELIKDLAVLRPPRKNRFVRVLLNFSVHERLDLRDLAQAHLVSLYHVHKILPARIDEFALEWLKFIEQESPPAAVFSQDFGRPTEEP-DWREDTTKVCFGLAFTLLPYKPEVYLQQICQVFVSTSAELKRTILRSLDIPIKKMGVESPTLLQLIEDCPKGMETLVIRIIYILTER-VPSPHEELVRRVRDLYQNKVKDVRVMIPVLSGLTRSELISVLPKLIKLNPAVVKEVFNRLLGIGA------EFAHQTMAMTPTDILVALHTIDTSVCDIKAIVKATSLCLAERDLYTQEVLMAVLQQLVEVTPLPTLMMRTTIQSLTLYPRLANFVMNLLQRLIIKQVWRQKVIWEGFLKTVQRLKPQSMPILLHLPPAQLVDALQQCPDLRPALSEYAES-MQDEPMNGSGITQQVLDIISGKSV 1104          
BLAST of Symplekin vs. UniProt/SwissProt
Match: sp|Q7ZYV9|SYMPK_XENLA (Symplekin OS=Xenopus laevis OX=8355 GN=sympk PE=1 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 3.884e-102
Identity = 195/519 (37.57%), Postives = 310/519 (59.73%), Query Frame = 1
Query: 1807 ELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELIT-SDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            E++ + + D + R D+ L+ L +EY  Y++                 A    Y   L+G+L  L    D ++  F +++LEAPL+T  AL++LR YC  +  +  G   +R+L   RP  + + L ++LD SS +  ++R  +L   K  +   E+    I  FA   L  L+   P + +      T +   WT++ V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +HILTDK  PSP +V++++ +YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P +LLVA+H ++ +  ++K VI+A+ +CF  + ++T E L++V+ QL+D   LP L MRT++Q+  MYPR+ G+++N+L+RLI KQVWK   +W+GFI+CC +   QSF+VLLQLP  +L SV  + P+ R  +  ++   T  Q  H  ++I++++ ++S
Sbjct:  597 EVLSHFLNDPRMRLDLALAWLYQEYCEYQSG----------------AGEEGYQECLIGILTGLQERPDQRDGVFTKVVLEAPLLTDSALDVLRKYCEDEGRSYLGMSTLRDLILTRPARQFQYLHLLLDLSSHEKDKIRQQSLHFIKR-MYEKESLRPYIEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEDTVKQCLYLYLALLPQNHKLIHELASVYTEATADIKRTVLRVIETPIRGMGMNSPELLLLVENCPKGAETLVTRCLHILTDKVPPSPELVKRVRELYHKRLPDVRFLIPVLNGLDKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEVSSSLSPLTPGDLLVALHNIDSSKCDMKSVIKATNLCFSARSVYTSEVLAVVLQQLMDTTPLPMLLMRTVIQALGMYPRLGGFIMNILTRLIYKQVWKYPKVWEGFIKCCQRTKPQSFSVLLQLPPPQLLSVLQTSPDLRDPLLAHVRAFTPHQLAHVPHSIMAILEAES 1093          

HSP 2 Score: 251.906 bits (642), Expect = 4.769e-67
Identity = 157/445 (35.28%), Postives = 259/445 (58.20%), Query Frame = 1
Query:   67 SIFDRVVDLCN-STIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAG 1398
            S  +RVV+L N + + T D   K   + Q++ELI+ K+P+LLDNF ++I+    +++  VR  V++FIE ACK+D++L+ K +  L  L++DE+ NV+K+    M  +Y ++L    + +  S      +     +   ++  ++S N GM    +K +E +++  S R  DSE+PK ++ D+SL++IP D     L+   L   G +    L+K +     SS ++   L SL +IA+QRP FM+ VI+++E  H N+P  L + QV+S+RK LK  LLS+L+HPS  E+   ++TLL+DLG +Q EI R LP   + S  KR R E+     K++RT +        L  +D        P++   +PS +       ++ + +  L +  NV +LVL+SM+ LP++MP +FQS YTP+ +AGT +QI HL+RL++ Q+ +AG
Sbjct:   21 STSERVVELLNMAALATNDT--KITMLKQVQELIINKDPTLLDNFLDEIIAFQADKSVEVRKIVVNFIEEACKLDNELLIKLIANLHMLLKDENVNVVKKSILTMTQLYKVALQWVARSRPPSEQQESCWDLVTEMAADILLLLESDNDGMRTHAVKFVESLIVTLSPRTADSEVPKRQDGDISLEQIPPDHQF--LKYNTLRDLGKQAVKELLKFMAHPAISSINLTAALGSLASIARQRPMFMAEVIQAYETLHANLPPTLAKSQVSSVRKNLKLQLLSVLRHPSSYEYQGPISTLLLDLGTSQGEITRHLPPPRD-SNRKRAR-EDGEGGQKKSRTDI-------PLPDDDDDKDTMQLPTIPAPAPSTQS---ATDITADFVRPLLSPENVANLVLISMVYLPDSMPASFQSTYTPVESAGTDSQIRHLARLMATQMSAAG 449          
BLAST of Symplekin vs. TrEMBL
Match: A0A2T7PFV1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07725 PE=4 SV=1)

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 420/1137 (36.94%), Postives = 658/1137 (57.87%), Query Frame = 1
Query:   79 RVVDLCN-STIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTS-----VNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGY------LSLES-------KEKRET--FQDES---NSNS---ILEDFPM-------SGYANQKSKNQMTLLKKHPF--STQKP--------FNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTAT--PRLATISDYDAVLVGVLKELIT-SDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLI 3348
            +VVDL N +++ T D E+  L + Q++ELI++K+P LLDNF ++++    +R+ +V+  +I F+E ACK D + + + +  L  L  DE+ NV K++  +  TIY  +L    K KS  ++    +++   I   ++  +DS N G+   ++K +E + +  S++ P+SE+PK +E DLSLD++  +  +  ++++ LE+ G   F  L++     H SS ++ T++ +LTNIA+QRPQF  +V++ FE  HVN+P  L + QV+S+RK LK  +L LL+HP   +F  Q+TTLL DLG TQSEI +ALPK +     KRK +E    + K+A+T      ++   D     + D   K+   P+      SL++   ++  +++LLP+L +V +V DLVLLSM+MLPE MP  FQS YTPIAAAGT  QI H+SRLL+ QL  AG       L L++       K+  ET  + D S   NS+S   ++   P+        G   ++ + +   +K+  F   T  P        F LESVTK L +ET+  +    FKRIL      +  +    N                    +R  IL+ L S  FGG  L   L  Y   D++NRYD+  S L +EYT+ + Y         N+A+   + A +S YD  L  +LK L    D K+  F R++LEAP+IT  A+ I+R +C+ + + + G + +R+L   RP +R + + ++L F++ +  E+R+ A+  A+  L  ++     I  +A   L  LL+ +P  S    +        W +E ++  LYL+L L+P NH+LIH LA ++      +KRTI+++++ P+K MGM+S E+LRLVENC      L++RVIHILTDKA+PSP +V+ ++++YH +  DVR +IP+L GL+K E+I  LPKL+ LN  +V EVF RL+   A       +V   SP+ P+ELLVA+H ++    ++K +I+A+ MCF E+ I+TQE L+IV+ +L++   LPTL MRT++QS SMYPR++G+V+N+L RLI KQVW    +W+GFI+CC +   QSF VLLQLP  +L +VF   P+ R  +  ++ + T  Q  H    I+ ++
Sbjct:    7 QVVDLLNRASVLTKDNEKTGL-LKQVQELIIHKDPELLDNFLDEMIAFQTDRSVDVKKCIIGFMEEACKKDPECLPRVMPSLAHLFADENINVQKKVILSFATIYRSALQWVSKAKSVRSEMTAVWEHVNQIKSRMVEMLDSDNDGVRTHIVKFLEGLTLALSKKSPESEMPKKQEGDLSLDQVMENNRL--IRLKKLEEEGQTSFLTLLQFQGSLHISSINLMTVMGALTNIARQRPQFFDQVVQGFEALHVNLPPTLAKSQVSSVRKNLKMQMLMLLRHPMSADFVPQITTLLTDLGATQSEINKALPKEE---SRKRKTEEPGPSALKKAKTEPLLPEIDDDDDIGMTPWTDRTRKQ---PT------SLQRQTAIDITAEDLLPRL-SVQHVADLVLLSMVMLPEAMPAQFQSTYTPIAAAGTDAQIKHISRLLATQLTMAGMGKGVGELKLQAMKKVDDQKDGGETPAYDDGSTSPNSSSRLWLILFLPVDMFITVTGGLTAREEEERAEHMKRTDFLPPTSAPLPRKGLRQFKLESVTKPLDSETLDAMTVAIFKRIL------DSERMASVNHIQG----------------ARTKILSCLTSQ-FGGC-LKDILEGYIFDDLRNRYDLAFSWLYQEYTNCQNY---------NSASIPGKAADMSSYDECLTRLLKGLSEMPDQKDGLFHRLILEAPVITDNAMQIIRKFCANEAHTEAGMKTLRDLIMMRPKNRLDFMDVMLTFTASERPEIRNPAIQTAQ-KLYENKQLRPSIEFYAIKQLKQLLETRPETSADQKRWQGGNAESWGEESIKAHLYLYLGLLPANHALIHELANIYTATSADIKRTILRVLEGPVKGMGMDSPELLRLVENCPKGSETLVMRVIHILTDKAVPSPELVDHIRDLYHKRVPDVRFLIPVLNGLSKKEVIAALPKLIKLNPMVVKEVFNRLM--GAHITANASYV---SPLTPDELLVALHNIDPLKCDMKTIIKAANMCFSERSIYTQEVLAIVMQRLMEQTPLPTLLMRTVIQSLSMYPRLIGFVLNILQRLILKQVWNQKKVWEGFIKCCQRTKPQSFQVLLQLPPAQLSNVFQISPDLRIPLLTHVRSFTPLQLAHIPPEIMHVL 1088          
BLAST of Symplekin vs. TrEMBL
Match: A0A210PW07 (Symplekin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09900 PE=4 SV=1)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 413/1121 (36.84%), Postives = 637/1121 (56.82%), Query Frame = 1
Query:   67 SIFDRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKG--KENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLT-YNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSLESKEKRETFQDESNSN-------------------SILEDFPMSGYANQKSKNQMTLLKKHPFSTQ-KPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSD 3357
            S +DRVVDL N         +K   + Q++ELI++KEP+LLDNF +++L    +R  +VR  VI F+E ACK D +L+ K +  L+ L+EDE+ N+ K++   M  +Y   L      K  + + +  ++    +   L+   DS N G+   ++K +E +V++ S    +SE PK    E+D++L  +P D     L+++ LE  G  +F  ++      H SS ++ T++ S+T IAKQRP F  +V+++FE   VN+P  L + QV+S+RK LK  +LSLL+H    ++ +Q+TTLL DLG T SE+++A+PK DE    KRK +E   ++ K     V    D + +T + D    K +AP+++Q+S +      V+  S++L  +LN   NV DLVL+SM+MLP+TMP  FQS YTPIAAAGT+ QI H++RLLS QL +AG     ++ + ++ ++E                        + +D P    A   S    ++    P     K F L SVT+ L  + + ++   +  RIL     N E    + N              +P    +R  +L  L S  FGG EL   L +Y  +D+++R+D+  + L +EY +   +   + K  +    P LA+   YD  L  +L  L+   D+KE +F R+L+EAP +T  A+ IL+ YC  +     G   ++EL   RP HR   L ++L+  S D  EVRS A+   K  L      +  I ++A   L YLL  KP + + P      +P  W +++++ CLYL+L L+P NH LI  LA V+  A   +KRTI+++++ P+K MGM S E+L LVENC      L+ RVIHILTDKA PS  +VE+++++YH +  DVR +IP+L GL K E+I  LPKL+ LN  +V EVF RLL        +  F   +SP+ P ELL+++H ++    ++K +I+A+ +CF EK ++TQE L++V+  L++   LPTLFMRT++QS SMYPR++G+V+N+L RLI KQVWK   +W+GFI+CC +   QSF VLLQLP  +L+SVF S PE R  +  ++ + T+ Q  H   AI++++  D
Sbjct:   26 STYDRVVDLINKASLMQKDAQKINNLKQVQELIIHKEPNLLDNFLDEMLAFQSDRTVDVRKFVISFMEEACKKDMELLPKILPCLQLLLEDENVNIQKKVILIMSQVYKCVLQWMCSAKGVNDEKMYVWEMVKSMKIKLLEMADSENDGVRTHVVKFLEGMVMILSHSTSESEFPKNFKPESDINLSIVPEDSDNKYLKLKRLEDEGKNIFETMLHFQASPHISSINLMTVMGSITAIAKQRPAFFGKVVQAFESLQVNLPPTLAKSQVSSVRKNLKMHMLSLLRHRCSADYMTQITTLLTDLGATNSEVMKAMPKIDESK--KRKAEESTQVAKKAKIEEVELDDDDAGMTPFVDRTTTK-SAPTVKQQSTA------VDITSEDLESRLNAQ-NVADLVLISMVMLPDTMPAHFQSTYTPIAAAGTEGQIKHIARLLSTQLTTAGMGKGVAETQAQSEENEGAGGESPAYQPSSPKQLIQTVVGGLTDDLP----ALPSSSKAQSMQPPAPVRRGIKQFKLSSVTQELNRDDLDQMTISAVGRIL-----NAEKSATQGNV-------------LP----ARTKLLAGLTSQ-FGG-ELRDLLEEYIFEDLRSRFDLAFAWLYQEYANCMGFCAPLMKLEK----PSLAS---YDECLTRLLAGLLGRVDLKEGFFQRVLIEAPAVTDNAILILKKYCLDENRVVAGMSTLKELILTRPVHRHRFLNVMLESCSHDKPEVRSTAIRFTKK-LYEKPQIAPHIEEYASKMLKYLLLPKPPSEMFPRSRSGDLPQSWIEDIIKMCLYLYLGLLPSNHKLIQELAVVYTSATADIKRTILRVLENPVKGMGMQSPELLLLVENCPKGAETLVTRVIHILTDKAAPSQELVERVRDLYHKRVPDVRFLIPVLTGLHKREVILALPKLIKLNPVVVKEVFNRLLGGHG----ETSF---SSPLTPAELLISLHNIDPNKCDMKTIIKATNLCFSEKNVYTQEALAVVMKSLMEQAPLPTLFMRTVLQSLSMYPRLLGFVLNILQRLITKQVWKQKRVWEGFIKCCQRTKPQSFQVLLQLPSLQLKSVFESCPELREPLLNHVKSFTEHQITHIPKAIMAVLEKD 1093          
BLAST of Symplekin vs. TrEMBL
Match: A0A433U5Q7 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_003086 PE=4 SV=1)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 401/1107 (36.22%), Postives = 641/1107 (57.90%), Query Frame = 1
Query:   67 SIFDRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSLESKEKRETFQDESNSNS---ILEDFPMSGYANQKSKNQ-------MTLLKKHPFSTQ-KPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITSDVK--ETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLI 3348
            S +D VV+L N       + EK   + + +ELI++K   LLDNF +++L    +++ +V+  ++ F+E ACK D + + K +  +  L+ D+  NV K++   + +++ L+L+   K K + A+  + + +   +   +   ++S N G+    +K +E + +  S+R  DSE+PK  E D S++++P +  I  + I  LE+ G + F  +++     H SS ++ T++ SL NIAKQRP+F  +V++SFE  HVN+P  L + QV+S+RK LK  ++ LL+H + L+F  Q++TLL DLG +QSEI +  PK D  S+ ++  KE +    K+AR  ++   D     Y D   KK      + K+        ++  ++++LP+LN   NVTDLVLLSM+MLP  MP  F+S YTP+AAAGTQ QI+H++RLL+ QL  A           E  +D+   +S   I++   + G   ++   Q       M+ L   P   + K F L   TK L  E M+ + + + +RIL       E   C                        R  +L +L S+LFG + + + L+ + + D++ R D+L + L +EY + + Y  A +  +   ++ + AT+  Y   L  VL EL+  +    ++ F R+LLEAPL+T  A+ I+R YC+   + + G + + +L NNRP HR   L I+LD+++ +  E+R+ A+ AAK  L  S    EEI  +A   L  LL +KP +   P   L  +P  WT++ ++  LYL L L+P NH LIH LA V+      +KRTI+++++ P+K MGM+S E+L LVENC      L++RVIHILTDKA+PSP +VE+++++YH +  DVR +IP+L GL+KTE++E LPKL+ LN  +V EVF RL+          +  +  SP+ P ELLVA+H ++    ++K  I+A+ +CF EK  +TQE L+IV+ QL++   LPTL MRT++QS SMYPR++G+V+N+L RLI K+VW+   +W+GFIRCC +   QSF VLLQLP  +L+ VF   P+ R  +  ++   T+ QK H + A+++L+
Sbjct:   63 STYDTVVELLNQAAVMTKSAEKISSLRKAQELIIHKSSDLLDNFLDEMLAFQSDQSKDVKRFIVGFMEEACKKDFECLPKVMPSMVMLLGDDDVNVQKKVILTVSSMFRLTLAWISKAKQTRAEMKDVWVHLNELKNLMYDFLESINDGIRTHAVKFLEGLTLTLSKRTADSEVPKKNEEDFSVEQMPENNGI--VDIASLEEEGRKAFTTMLQFQGSPHISSINLMTVMNSLANIAKQRPEFFDQVVQSFEALHVNLPPTLAKSQVSSVRKNLKTQMMGLLRHSASLDFLPQISTLLTDLGASQSEIAKNTPK-DLESRKRKAFKEPSGFGPKKARIELDEDDDGM-TPYVDRTTKKSKPEPAQNKT-------AIDVTAEDILPRLN-AQNVTDLVLLSMVMLPNNMPALFESTYTPVAAAGTQAQISHIARLLATQLTMAAIA--------EGIKDDEQPSSPKQIIQ--TVVGLKTEEQTEQPPDKKLKMSQLPMPPGIRKIKQFQLSHATKPLQEEEMESMVNMALQRIL-----KAEKAACTGQVEQ-----------------HRTKLLAAL-SSLFGQS-VKKNLLAFILGDLRCRQDLLFAWLYQEYANCQGYSSAAAGGK---SSLQGATVGSYSNCLTSVLTELLEMEDHHADSLFHRVLLEAPLLTDNAVIIVRKYCNIPEHTEAGMKTLSQLINNRPAHRIRFLEIMLDYTAHEKQEIRNLAIQAAK-TLHVSGKMKEEIEQYANQQLKKLLLSKPPSP--PGVKLEDLPEAWTEDAIKAHLYLHLGLLPSNHKLIHELANVYTATNADIKRTILRVLEPPVKGMGMDSPELLTLVENCPKGSETLVMRVIHILTDKAVPSPQLVERIRDLYHKRVPDVRFLIPVLNGLSKTEVMEALPKLIKLNPMVVKEVFNRLMGSHV-----NNESMYQSPLTPVELLVALHNIDPNKCDIKTTIKAANLCFAEKATYTQEVLAIVMQQLMEQEPLPTLLMRTVLQSLSMYPRLLGFVLNILQRLIVKKVWRQKKVWEGFIRCCQRAKPQSFQVLLQLPASQLKDVFEVCPDLREPLFNHVQTFTENQKAHINKAVMTLL 1112          
BLAST of Symplekin vs. TrEMBL
Match: V4AJ75 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_215976 PE=4 SV=1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 409/1116 (36.65%), Postives = 649/1116 (58.15%), Query Frame = 1
Query:  127 EKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLT-YNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYL----SLESKEKRETFQDESNSN-----------------------SILEDFPMSGYANQKSKNQMT------LLKKHPFSTQK--PFNLESVTKTLPTETMQEIFHESFKRILVMPLL--NNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSD 3357
            +K  Y+ Q++ELI++K+P+LLDNF +++L  + +R+ +V+  +I F+E ACK D +++ K++  +  L+ D++ NV K++  ++ +I+  SL    K K+ S++    ++  +   + ++  ++S N G+   ++K +E +V++ S+R  DS IPK  E D++LD+IP   T   L++  LE+ G + F +L++     H SS ++ T++ +LTNIAKQRP F+ +V++  E  HVN+P  L + QV+S+RK LK  +L+LLKHP+ ++  +Q+TTLL DLG +QSEI + +PK DE    KRK ++ +  +SK+A+  ++   D   +T +    IK+  APS+ Q+  +      ++  ++++LPKLN+  NV DLVLLSM+MLP+TMP  F+S YTPIAAAGT+ QIAHL+RLL+ QL  AG+      L+ K   E  +D+ ++                        + LED   SG  N+ S +  T      L    P + +K   F L ++T  L    + E+   + KR+L    +  NN +   R                          IL +L +A FGG  L   L  +  +D+K R DI  + L +EY + + +I       +  +      ++ YD  L  +L  L+   D ++  F R++LEAP++T  A+ +LR Y + +     G + +R+L   RP+ R   L ++L+F+  D  EVR+ A+   K  L+     +  I  +A  NL  LL  KP            +  +WT+E ++  LYL+L L+P NHSLIH L+ V+      VKR I++M++ P+K MGM+S E+L +VENC      L++RVIHILTDK+ PSP +VEK++++YH +  DVR +IP+L GLTK E+   LPKL+ LN  +V EVF RL+            V  TSP+ P ELLVA+H ++ +  ++K VI+A+ +CF EK I+T E L+I + QL+++  LPTL MRT++QS SMYPR++G+V+N+L RLI KQVWK   +W+GFI+CC K   QSF VLLQLP  +L+ VF   P+ R+ +  ++ + T  Q+ H S A+LS + +D
Sbjct:    6 DKIKYLRQVQELIIHKDPTLLDNFLDEMLAFISDRSVDVKKLLIGFLEEACKKDKEILPKALPGVTILLADDNANVKKKVILSLTSIFKYSLQWIAKAKTPSSEMTSVWENMMKTKKQVLELLESENDGIRTHVVKFLEGVVLVLSKRSTDSMIPKNMEGDITLDQIPESNTY--LKVNKLEEDGKKSFILLLQFQASPHISSINLMTVMGALTNIAKQRPIFLDQVVQGLEALHVNLPPTLAKSQVSSVRKNLKMQMLALLKHPASVDHLTQITTLLTDLGASQSEINKNMPKMDE--NRKRKLEQTSTSTSKKAKVEIDLDDDEVQMTPFVPQGIKR--APSVSQRQTA------IDITAEDILPKLNSQ-NVADLVLLSMVMLPDTMPAQFESTYTPIAAAGTEAQIAHLARLLATQLTMAGFGRGLGELQRKFLEEGVKDDGSTTPASPMDASYPSPKQLIQTLVGGTTNLED---SGTDNKPSSSSSTGVPGSFLQPSMPAAPRKLRQFKLSTITNPLDAGKIDEMTIATMKRVLTAETIAQNNNITSVRVK------------------------ILATL-TAQFGGG-LKDMLQTFIFEDLKTRSDIAFAWLYQEYANCQGFISVADPQTDKNS------LASYDECLTRLLSMLLDRPDQRDGLFSRLILEAPVVTDNAVEMLRRYSANESQTQNGMETLRKLILMRPNRRLHFLDVLLEFTGHDQPEVRNKAIEITK-TLLEKYQLNSPIETYALNNLKKLLLPKPLPEFFTGAKAKDVQEEWTEECIKMHLYLYLGLLPTNHSLIHELSNVYTATSADVKRAILRMLESPVKGMGMDSPELLTMVENCPKGAETLVMRVIHILTDKSAPSPELVEKIRDLYHKRVPDVRFLIPVLTGLTKKEVTGALPKLIKLNPVVVKEVFHRLMGGHG-----ESSVAYTSPLTPAELLVALHNIDPSKCDMKTVIKAANLCFSEKTIYTTEVLAIAMQQLMEINPLPTLLMRTVLQSLSMYPRLIGFVLNILHRLITKQVWKQQKVWEGFIKCCQKTKPQSFQVLLQLPPQQLQGVFEIAPDLRSPLYTHVQSLTPHQQAHISKAVLSTLEND 1067          
BLAST of Symplekin vs. TrEMBL
Match: K9J0G0 (Putative mrna cleavage and polyadenylation factor ii complex subunit pta1 OS=Desmodus rotundus OX=9430 PE=2 SV=1)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 400/1112 (35.97%), Postives = 629/1112 (56.56%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSS-KRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSL--ESKEKRETFQDE--SNSNSILEDFPMSGYANQKS-----KNQMTLLKKHPFSTQKPFNLESVT--KTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            +RVVDL N     + ++ K   + Q++ELI+ K+P+LLDNF ++I+   ++++  VR  VI FIE ACK D +L+ K +  L  L+ DE+ NV+KR    M  +Y ++L   +K +  S    E  + C  +V A+   +    DS N G+    IK +E  ++  S R  DSE+P+  E+D+SLD++P D   P +Q  +L + G      L+K +     SS ++ T L SL NIA+QRP FMS VI+++E  H N+P  L + QV+S+RK LK  LLS+LKHP+ LEF +Q+TTLL+DLG  Q+EI R +P   +     RKR  +++ SS K+ +   N   D  D             PS   K+ +         ++ E L  L T  NV +LVL+SM+ LPETMP +FQ+ YTP+ +AGT+ QI HL+RL++ Q+ +AG      ++K+ +E  ++E  +   S+L    +S      S      +  TL ++ P + ++P  +  VT  +       ++IF  S    ++ PL + +++  +      +       +       +R  IL SL +    G  L  E++ + ++DV+ R D+  + L +EY +Y A   +              T+  Y+  L+ +L  L    D K+  F +++LEAPLIT  AL ++R YC  +     G   +R+L   RP  + + L ++LD SS +  +VRS AL   K  +   E   E +  FA   L  L+   P + +      T +   WTDE V+ CLYL+LAL+P NH LIH LA V+ +A   +KRT++++I+ PI+ MGMNS E+L LVENC      L+ R +H LTDK  PSP +V++++++YH +  DVR +IP+L GL K E+I+ LPKL+ LN  +V EVF RLL         G+     SP+ P ELL+A+H ++ +  ++K +I+A+ +CF E+ ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+LSRLI KQVWK   +W+GFI+CC +   QSF V+LQLP  +L +VF+  PE R  +  ++ + T  Q+ H  N+I++++ +  
Sbjct:   34 ERVVDLLNQAA-LITSDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQVDKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKRAILTMTQLYKVALQWMVKSRVIS----ELQEACWDMVSAMAGDIILMLDSDNDGVRTHAIKFVEAFIVTLSPRMADSEVPRRHEHDVSLDRVPRDH--PYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPNNKDA----RKRPRDDSDSSLKKMKLEPNLGEDDEDKDLE-------PGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPETMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQSKEEPKEEKVAKPESVLIKRRLSAQGQAISVVGSLSSMSTLEEEAPQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSD---VLKPLTDAQVEAMKLGAVKRILRAEKAVACSGAAQQARVKILASLVTQFDSG--LKAEVLAFVLEDVRARLDLAFAWLYQEYNAYLAAGAS-------------GTLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAPLITESALEVIRKYCEDESRTYLGMSTLRDLIFKRPSRQFQYLHVLLDLSSHEKDKVRSQALLFIKR-MYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTDETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HGEGNSALSPLNPGELLIALHNIDSSKCDMKSIIKATNLCFAERNVYTSEVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFVMNILSRLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVRSFTPHQQAHIPNSIMTILEASG 1103          
BLAST of Symplekin vs. Ensembl Cavefish
Match: sympk (symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361])

HSP 1 Score: 533.872 bits (1374), Expect = 1.671e-168
Identity = 358/1073 (33.36%), Postives = 583/1073 (54.33%), Query Frame = 1
Query:  178 PSLLDNFYE-DILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLS--LESKEKRETFQDESNSNSILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVK--------NRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELIT-SDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            P L +  +E  ++    +++  VR  VI FIE ACK D++L+ K +  L  L++DES NV+K+    +  +Y +SL   ++ KS S      +     + E +++ +DS N G+    IK  E ++I  S R PDS++PK +E D+SLDKIP D +   ++ ++L + G      L+K +     SS ++ T L SL  +A+QRP FMS V++++E  H N+P  L + QV+S+RK LK  L+S+L+HPS ++FHSQ++TLL DLGM QSEI R +P A   +Q +++ + E     KR +       D  D        K+  AP +  K  +         L+ + +  L T  NV +LVL+SM+ LPE MP +FQ+ YTP+ +AGT  QI HL+RL+ A  ++A  L   LE  + R     E    + +E+          SK+ + + K    S  +  ++    K+ P E   +       + L  P+L +   + +A  ++     F  +  +     S+   LT++       AE  + + +  M  V+         + D+  SLL +EY  Y + + +              ++  Y+  L  +L  L    + ++  F +++LEAPLIT  AL ++R                           +  L+   +  S D  +VRS AL+  K  +   ++  E I  FA   +  L+   P + +  +   T +   WT+E VR CLYL+L+L+P+NH L+H LA V+ +A   +KR+++++I+ PI+ MGMNS ++L LVENC      L+ R +HILTDK  PSP +VE+++++YH +  DVR +IP++ GL K E+I+ LPKL+ LN  +V EVF RLL          +     SP+ P ELL+A+H ++    ++K +I+A+ +CF EK ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+LSRLI KQVWK   +W+GF++CC +   QS++VLLQLP  +L SVF   PE R  + +++ + T  Q+ H  ++I++++ + S
Sbjct:   76 PFLHNQMFELHMIAFQTDKSIEVRKFVIGFIEEACKRDNELLLKLIANLNMLLKDESVNVVKKAILTLTHLYKVSLQWLVQSKSVSEMQEACWNMVTQMKEEVLALLDSDNDGVRTHAIKFTESLIIALSPRKPDSDVPKKQEGDISLDKIPKDHSY--IRYDVLCEEGKSALEQLLKFMVHPAISSINLTTALGSLATLARQRPMFMSEVVQAYETLHANLPPTLAKSQVSSVRKNLKLHLVSVLRHPSSVDFHSQISTLLQDLGMAQSEIARCVPAA---AQPRKRSRHEPYSEGKRIKIEPALIEDDED--------KEEPAPVVAPKPSTTTGTQSAIDLTADFIRPLLTPENVANLVLISMVYLPEVMPASFQATYTPVESAGTDAQIKHLARLM-ATQMTAAGLGPGLEQCKARGEEGKEGEGEASMEE--------SSSKDPLIIRKVSAVSLGQAISVVGAYKSQPAEETPQ------AKKLPEPILPS--TQSKAPGSSGRKKVFRLADVVQPLSDSQLEKLTNMAVKRILQAE--KAIARSGMSHVRVKLLARLMTQSDLAFSLLYQEYNQYLSQLPS-------------GSLDSYEHCLFSLLSGLQERPEQRDGLFTKLVLEAPLITESALEVIR---------------------------RTFLLQTCEHYSHDKEKVRSTALTFIKR-MYEKDHLREYIEKFALNYMQLLVHPNPPSLLFGVGEDTEVASPWTEETVRQCLYLYLSLLPLNHRLVHELAAVYTEAIADIKRSVLRVIEQPIRGMGMNSPDLLLLVENCPKGAETLVTRCLHILTDKVPPSPDLVERVRDLYHKRVPDVRFLIPVINGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HSEGSPSMSPLTPGELLIALHNIDSTKCDMKSIIKATNLCFGEKNVYTSEVLAVVMQQLMEQNPLPMLLMRTVIQSLTMYPRLGGFVMNILSRLILKQVWKYPKVWEGFVKCCQRTKPQSYSVLLQLPPAQLISVFERCPEMREPLLQHVRSFTPHQQAHIPSSIMAILEASS 1070          
BLAST of Symplekin vs. Ensembl Cavefish
Match: sympk (symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361])

HSP 1 Score: 371.318 bits (952), Expect = 1.309e-108
Identity = 195/518 (37.64%), Postives = 319/518 (61.58%), Query Frame = 1
Query: 1810 LVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDS 3360
            ++++ ++D++ R D+  SLL +EY  Y + + +              ++  Y+  L  +L  L    + ++  F +++LEAPLIT  AL ++R YC  +     G   ++EL   RP  + + L ++LD SS D  +VRS AL+  K  +   ++  E I  FA   +  L+   P + +  +   T +   WT+E VR CLYL+L+L+P+NH L+H LA V+ +A   +KR+++++I+ PI+ MGMNS ++L LVENC      L+ R +HILTDK  PSP +VE+++++YH +  DVR +IP++ GL K E+I+ LPKL+ LN  +V EVF RLL          +     SP+ P ELL+A+H ++    ++K +I+A+ +CF EK ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+LSRLI KQVWK   +W+GF++CC +   QS++VLLQLP  +L SVF   PE R  + +++ + T  Q+ H  ++I++++ + S
Sbjct:  618 MLRFILEDMRTRSDLAFSLLYQEYNQYLSQLPS-------------GSLDSYEHCLFSLLSGLQERPEQRDGLFTKLVLEAPLITESALEVIRRYCEDESRVYLGMTTLKELILKRPSRQFQYLHVLLDLSSHDKEKVRSTALTFIKR-MYEKDHLREYIEKFALNYMQLLVHPNPPSLLFGVGEDTEVASPWTEETVRQCLYLYLSLLPLNHRLVHELAAVYTEAIADIKRSVLRVIEQPIRGMGMNSPDLLLLVENCPKGAETLVTRCLHILTDKVPPSPDLVERVRDLYHKRVPDVRFLIPVINGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HSEGSPSMSPLTPGELLIALHNIDSTKCDMKSIIKATNLCFGEKNVYTSEVLAVVMQQLMEQNPLPMLLMRTVIQSLTMYPRLGGFVMNILSRLILKQVWKYPKVWEGFVKCCQRTKPQSYSVLLQLPPAQLISVFERCPEMREPLLQHVRSFTPHQQAHIPSSIMAILEASS 1116          

HSP 2 Score: 275.789 bits (704), Expect = 9.301e-76
Identity = 166/441 (37.64%), Postives = 261/441 (59.18%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAG 1398
            ++VVDL N     +  ++K   + Q++ELI+ K+PSLLDNF ++++    +++  VR  VI FIE ACK D++L+ K +  L  L++DES NV+K+    +  +Y +SL   ++ KS S      +     + E +++ +DS N G+    IK  E ++I  S R PDS++PK +E D+SLDKIP D +   ++ ++L + G      L+K +     SS ++ T L SL  +A+QRP FMS V++++E  H N+P  L + QV+S+RK LK  L+S+L+HPS ++FHSQ++TLL DLGM QSEI R +P A   +Q +++ + E     KR +       D  D        K+  AP +  K  +         L+ + +  L T  NV +LVL+SM+ LPE MP +FQ+ YTP+ +AGT  QI HL+RL++ Q+ +AG
Sbjct:   53 EKVVDLLNQAA-FMSTDDKLTALKQVQELIINKDPSLLDNFLDEMIAFQTDKSIEVRKFVIGFIEEACKRDNELLLKLIANLNMLLKDESVNVVKKAILTLTHLYKVSLQWLVQSKSVSEMQEACWNMVTQMKEEVLALLDSDNDGVRTHAIKFTESLIIALSPRKPDSDVPKKQEGDISLDKIPKDHSY--IRYDVLCEEGKSALEQLLKFMVHPAISSINLTTALGSLATLARQRPMFMSEVVQAYETLHANLPPTLAKSQVSSVRKNLKLHLVSVLRHPSSVDFHSQISTLLQDLGMAQSEIARCVPAA---AQPRKRSRHEPYSEGKRIKIEPALIEDDED--------KEEPAPVVAPKPSTTTGTQSAIDLTADFIRPLLTPENVANLVLISMVYLPEVMPASFQATYTPVESAGTDAQIKHLARLMATQMTAAG 479          
BLAST of Symplekin vs. Ensembl Sea Lamprey
Match: sympk (symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361])

HSP 1 Score: 387.111 bits (993), Expect = 2.905e-116
Identity = 221/608 (36.35%), Postives = 341/608 (56.09%), Query Frame = 1
Query: 1534 HPFSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELI-TSDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPV--DWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLI 3348
             P   +K F +  V + L +E M+ + H +  RIL     +    R  A                      RN +L  L +A FGG E+  +L++  + D++ + D+  + L +EY +Y               + + + + +YD  L G+L  L+   D ++  F R++LEAP +T  AL +LR YC  +     G   +REL   RP  +   + ++L+  S D  +VRS AL   K  L   E     I  FA   L  L+   P +        T   V   WTD+ +R CLY++L+L+P+NH+LIH LA V+ +A   +KRTI+++I+ PI+ MGMNS E+L LVE+C      L+ R +HILT+KA PSP +V++++++Y  + SDVR +IP+L GL K E+I  LPKL+ LN  +V EVF RLL         G+  V  SP+ P ELLVA+H ++    ++K +I+A+ +CF E+ +++ E L++V+ QL++   LP L MRT++QS SMYPRM  +V+N+L RLI KQVWK   +W+GFI+CC +   QSF VLLQLP  +L  VF+  PE R  +  ++ + T  Q+ H S + ++++
Sbjct:  477 QPGIRRKVFRVADVLQPLSSEEMERMSHAAVGRILQA---DRTCMRGGAG-------------------HVRNQLLARL-AARFGG-EMRAQLLECVLADMRTQGDLAFTWLFQEYATY-------------LESEQPSALENYDNCLTGLLSGLLEKGDQRDGLFSRIVLEAPRMTGRALEVLRRYCEDETRVYLGMSTLRELVLKRPSQKMLYMHVLLELCSHDKDKVRSQALMFVKR-LYEKEELRNCIETFALNMLQCLVHPNPPSVCFADDRDTDAEVASSWTDDSIRQCLYVYLSLLPLNHTLIHELAAVYTEAIADIKRTILRIIEQPIRGMGMNSPELLLLVESCPKGAETLVTRSLHILTEKAPPSPELVKRVRDLYQKRVSDVRFLIPVLNGLEKKEVIAALPKLIKLNPIVVKEVFNRLLGTQ-----HGEGGVAMSPLTPGELLVALHNIDTTKCDMKSIIKATSLCFAERWVYSSEVLAVVMQQLMEQNPLPVLLMRTVIQSLSMYPRMGAFVMNILQRLIIKQVWKYPKVWEGFIKCCQRTKPQSFGVLLQLPPTQLAVVFDKCPEIREPLLMHVRSLTLQQQNHISKSTIAVL 1041          

HSP 2 Score: 199.904 bits (507), Expect = 1.586e-52
Identity = 135/391 (34.53%), Postives = 220/391 (56.27%), Query Frame = 1
Query:  226 ERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAG 1398
            +R   +R  +I F+E ACK D++L+ K +  +  L+ DE+ NV+KR   ++  +Y + L      +  S +    ++    +   ++  +DS N G+    IK +E +V+  S R  DSE+ K +E +  +++IP D   P L+   L + G      L+  +     SS ++   L SL  IA+QRP FM+RV++++E  H N+P  L + QV+S+RK LK  LL LLK PS +EFH Q++TLL DLG +  E+ R +P A E+   +R  +++    SK+ +  V    D  D    D   +   AP   + +P     + ++  ++ +LP L T   V +LVL+SM++LP+TMP +FQ+ YTPI +AGT  QI HL+RL++ Q+ +AG
Sbjct:    8 DRLLEIRKFIIGFMEEACKKDNELLLKLIANINMLLHDENVNVVKRAILSLTQLYRVMLQWLAGHRKVSEEQEAVWEMMSAMRNDIMQLLDSENDGVRTHAIKFVEMLVVAMSPRTQDSEVTKRQEGEACMERIPRDH--PLLKQSQLREMGEAALERLLSFMVHPAISSINLTAALGSLATIARQRPVFMARVVQAYETLHANLPPTLAKSQVSSVRKNLKLHLLGLLKLPSSIEFHPQMSTLLYDLGTSPQELQRNMPSARELR--RRMHRDDTEQHSKKMKM-VETMQDEDD----DKEAEAVPAPR-PKAAPLPSVLSAIDVTAQHILPML-TPDKVANLVLVSMVLLPDTMPASFQATYTPIESAGTHAQIQHLARLMATQISNAG 387          
BLAST of Symplekin vs. Ensembl Nematostella
Match: EDO46859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP74])

HSP 1 Score: 254.218 bits (648), Expect = 1.239e-76
Identity = 124/281 (44.13%), Postives = 189/281 (67.26%), Query Frame = 1
Query: 2539 MGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDSVVTVQTA 3381
            +GM S E+L+LVENC +    LI R+++I+TDKA PS  +V ++K++YH + SDVR +IP+L GL K E+I +LPKL+  +  +V EVF RLL       V G     TSP+ P ELLVA+H +E    ++K V++A  +CF EK I+TQE L+IV+ QL+++  LPTLFMRT++QS S+ PR++G+V+++L++LI KQVWK   +W GF++CC     QSF+VLLQLP  +LES F   PE R  +  ++ + T  Q+ H   ++L +++ +  +  + +
Sbjct:    1 IGMASPELLQLVENCPTGAETLIARILNIITDKAAPSSDLVRRVKDLYHKRVSDVRFLIPVLTGLEKQEIIAVLPKLIKQSPSVVKEVFNRLLGCFHSSKVSG-----TSPLSPSELLVALHSIE-GKSDMKAVMKAISLCFAEKAIYTQEVLAIVLQQLMEINPLPTLFMRTVIQSLSICPRLIGFVMSILAKLITKQVWKQPKVWQGFVKCCQMTKPQSFSVLLQLPPRQLESAFEICPELRDNLVAHVQSFTPHQRAHIPRSVLLILDKEKKIKTEKS 275          
BLAST of Symplekin vs. Ensembl Nematostella
Match: EDO33007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STE5])

HSP 1 Score: 222.631 bits (566), Expect = 1.294e-63
Identity = 159/439 (36.22%), Postives = 251/439 (57.18%), Query Frame = 1
Query:   79 RVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSA 1395
            +V+DL N     ++ E K   + Q++E IV K+PSLLDNF +++L    +R+A VR  V+ FIE ACK D +L+ K +  L   + D++  V KR+   +  +Y  +L    K +  S +  + ++    +   +I  + S N G+    IK ME +V++QS +  DSE  K  E D+SLD +P     P ++++ L + G      L+ L+     SS ++   L +L+NIA+QRP FMS V+++FE  H N+P  L + QV+S+RK LK  L+SLL+HPS  EF  Q+TTLL DLG +Q+E+ + +PKA   S +K K + +   ++K+A+           L  ND I              ++     ++  + +L+P+L+    VT+LVL+SM+ LP+ MP  F   YTPIAAAG Q Q+AHL+RLL++Q+ +A
Sbjct:    1 QVIDLLNQA--QLEKEGKLNCLKQVQEFIVNKDPSLLDNFLDEMLVFQQDRSAEVRKFVVGFIEEACKKDIELLGKVLSSLAVALGDDNVAVQKRVMLCVTQLYKFALQHVCKKRVISEELEQMWELLTQMKNQIIGMLASDNDGIRTHAIKFMEMLVLVQSTKSQDSESSKKGEADISLDVVPR--AHPLVKMQELREEGGTTLEALLSLIASPTISSVNLMAGLGTLSNIARQRPVFMSTVVQTFESLHANLPTSLSKSQVSSVRKNLKLHLMSLLRHPSSFEFLPQITTLLTDLGASQAELEKNMPKATPES-LKLKAESDTAAANKKAK-----------LLDNDDI-----------DMITMSNAEAIDLTANDLIPRLDKEA-VTNLVLISMLTLPDRMPSHFNDTYTPIAAAGGQAQVAHLARLLASQMTTA 411          
BLAST of Symplekin vs. Ensembl Medaka
Match: sympk (symplekin [Source:NCBI gene;Acc:101158983])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 374/1113 (33.60%), Postives = 625/1113 (56.15%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKR-KEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYL-SLESKE-------KRETFQDESNSNSILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFNL----ESVTKTLPTETMQEIFHESFKRI--LVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINS 3354
            ++VV+L N     +  +EK   + Q++ELI+ K+PSLLDNF ++I+    +++  V+  VI FIE ACK D++L+ + +  L  L++DES NV+K+    +  +Y ++L   +  K+ S    E  + C  ++  +  +V    DS N G+    IK  E ++I  S R PDS++PK ++ D+SLDK+P D +   +    L + G      L+K +     SS ++ T L SL  IA+QRP FMS V++++E  H N+P  L + QV+S+RK LK  L+++LKHP  +EF  Q++TLL+DLGM Q+EI R  P    V +  RKR + E     K+ +       D  D        K+  AP    K  ++        L+ E L  L T  NV +LVL+SM+ LP+ MP +FQ+ YTP+ +AGT  QI HL+R+++ Q+ +AG    LE  +       K E  +++S +  IL    +      ++ + +    + P +T+ P       E +  + PT+ M     +   R+  +V PL + + ++  ++    +       +     +  R  +L+ L +   G   +  +++++ ++D+++R D+  SLL +EY +Y + + +               +  YD  L  +L  L    + ++  F +++LEAP+IT  AL ++R YC  +     G   ++EL   RP  + + L ++LD SS +  +VR+ AL+  K  +   +   + I  FA   L  L+   P + +      T +   WT+E VR CL+L+L+L+P+NH L+H LA V+ +A   +KR++++ I+ PI+ MGMNS E+L LVENC      L+ R +HILTDK  PSP +VE+++++YH +  DVR +IP++ GL K E+I+ LPKL+ LN  +V EVF RLL          +     SP+ P +LL+A+H ++    ++K +I+A+ +CF E+ ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+LSRLI KQVWK   +W+GF++CC +   QS++VLLQLP  +L SVF   PE R  + +++ + T  Q+ H  ++I++++ +
Sbjct:   20 EKVVELLNQA-SLIPTDEKLTALKQVQELIINKDPSLLDNFLDEIIAFQTDKSIEVKKFVIGFIEEACKRDNELLVRLIANLNMLLKDESVNVVKKAILTLTQLYKVTLQWLVSSKTLS----EMQEACWDLITQMKGEVLALLDSDNDGVRTHSIKFTESLIITLSPRTPDSDVPKRQDADISLDKVPKDHSY--IHYGTLCEEGKSALEKLLKFMVHPAISSINLTTALGSLATIARQRPMFMSEVVQAYETLHANLPPTLAKSQVSSVRKNLKLHLVAVLKHPCSVEFQGQISTLLLDLGMPQTEITRNTP----VPREPRKRPRYEQYTEGKKVKIEPALMEDDED--------KEEPAPLAAPKPAAVPAVQSALDLTAEFLHPLLTPENVANLVLISMVYLPDVMPASFQATYTPVESAGTDAQIKHLARMMATQMTAAGIGPGLEQSKAKGDEACKEEQSEEDSTAKDILIKRKVPAVILGQAISVVGGYSEKPSATEPPAAPKRLPEPILPSAPTKLMGASGRKKVFRLSDVVQPLSDTQNEKLTSSAVKRILHSEKAIAQSGMSHI-RVKLLSRLVTQFEGM--MKEDVLQFILEDIRSRSDLAFSLLYQEYNTYLSQLPS-------------GLLDSYDQCLFTLLSGLQEKPEQRDGLFTKLVLEAPIITESALEVIRRYCEDESRVYLGMTTLKELIVKRPSRQFQYLHVLLDLSSNEKEKVRTTALAFLKR-MYEKDQLRDYIEKFALNYLQLLVHPNPPSLLFGADKDTEVAAPWTEETVRQCLFLYLSLLPLNHRLVHELASVYTEAIADIKRSVLRAIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHILTDKVPPSPELVERVRDLYHKRVPDVRFLIPVINGLEKNEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HSEGSSSVSPLTPGDLLIALHNIDSVKCDMKSIIKATNLCFAERNVYTSEVLAVVMQQLMEQNPLPMLLMRTVIQSLTMYPRLGGFVMNILSRLIVKQVWKYPKVWEGFVKCCQRTKPQSYSVLLQLPPAQLASVFERCPEMRAPLLQHVHSFTPHQQAHIPSSIMAVLEA 1091          
BLAST of Symplekin vs. Ensembl Medaka
Match: sympk (symplekin [Source:NCBI gene;Acc:101158983])

HSP 1 Score: 561.992 bits (1447), Expect = 1.341e-179
Identity = 355/1077 (32.96%), Postives = 597/1077 (55.43%), Query Frame = 1
Query:  184 LLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKR-KEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYL-SLESKE-------KRETFQDESNSNSILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFNL----ESVTKTLPTETMQEIFHESFKRI--LVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINS 3354
            L ++  ++I+    +++  V+  VI FIE ACK D++L+ + +  L  L++DES NV+K+    +  +Y ++L   +  K+ S    E  + C  ++  +  +V    DS N G+    IK  E ++I  S R PDS++PK ++ D+SLDK+P D +   +    L + G      L+K +     SS ++ T L SL  IA+QRP FMS V++++E  H N+P  L + QV+S+RK LK  L+++LKHP  +EF  Q++TLL+DLGM Q+EI R  P    V +  RKR + E     K+ +       D  D      +     A     +S           L+ E L  L T  NV +LVL+SM+ LP+ MP +FQ+ YTP+ +AGT  QI HL+R+++ Q+ +AG    LE  +       K E  +++S +  IL    +      ++ + +    + P +T+ P       E +  + PT+ M     +   R+  +V PL + + ++  ++    +       +     +  R  +L+ L +   G   +  +++++ ++D+++R D+  SLL +EY +Y + + +               +  YD  L  +L  L    + ++  F +++LEAP+IT  AL ++R YC  +     G   ++EL   RP  + + L ++LD SS +  +VR+ AL+  K  +   +   + I  FA   L  L+   P + +      T +   WT+E VR CL+L+L+L+P+NH L+H LA V+ +A   +KR++++ I+ PI+ MGMNS E+L LVENC      L+ R +HILTDK  PSP +VE+++++YH +  DVR +IP++ GL K E+I+ LPKL+ LN  +V EVF RLL          +     SP+ P +LL+A+H ++    ++K +I+A+ +CF E+ ++T E L++V+ QL++   LP L MRT++QS +MYPR+ G+V+N+LSRLI KQVWK   +W+GF++CC +   QS++VLLQLP  +L SVF   PE R  + +++ + T  Q+ H  ++I++++ +
Sbjct:    5 LANSILQEIIAFQTDKSIEVKKFVIGFIEEACKRDNELLVRLIANLNMLLKDESVNVVKKAILTLTQLYKVTLQWLVSSKTLS----EMQEACWDLITQMKGEVLALLDSDNDGVRTHSIKFTESLIITLSPRTPDSDVPKRQDADISLDKVPKDHSY--IHYGTLCEEGKSALEKLLKFMVHPAISSINLTTALGSLATIARQRPMFMSEVVQAYETLHANLPPTLAKSQVSSVRKNLKLHLVAVLKHPCSVEFQGQISTLLLDLGMPQTEITRNTP----VPREPRKRPRYEQYTEGKKVKIEPALMEDDEDKEEPAPLAAPKPAAVPAVQS--------ALDLTAEFLHPLLTPENVANLVLISMVYLPDVMPASFQATYTPVESAGTDAQIKHLARMMATQMTAAGIGPGLEQSKAKGDEACKEEQSEEDSTAKDILIKRKVPAVILGQAISVVGGYSEKPSATEPPAAPKRLPEPILPSAPTKLMGASGRKKVFRLSDVVQPLSDTQNEKLTSSAVKRILHSEKAIAQSGMSHI-RVKLLSRLVTQFEGM--MKEDVLQFILEDIRSRSDLAFSLLYQEYNTYLSQLPS-------------GLLDSYDQCLFTLLSGLQEKPEQRDGLFTKLVLEAPIITESALEVIRRYCEDESRVYLGMTTLKELIVKRPSRQFQYLHVLLDLSSNEKEKVRTTALAFLKR-MYEKDQLRDYIEKFALNYLQLLVHPNPPSLLFGADKDTEVAAPWTEETVRQCLFLYLSLLPLNHRLVHELASVYTEAIADIKRSVLRAIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHILTDKVPPSPELVERVRDLYHKRVPDVRFLIPVINGLEKNEVIQALPKLIKLNPIVVKEVFNRLLGTQ-----HSEGSSSVSPLTPGDLLIALHNIDSVKCDMKSIIKATNLCFAERNVYTSEVLAVVMQQLMEQNPLPMLLMRTVIQSLTMYPRLGGFVMNILSRLIVKQVWKYPKVWEGFVKCCQRTKPQSYSVLLQLPPAQLASVFERCPEMRAPLLQHVHSFTPHQQAHIPSSIMAVLEA 1041          
BLAST of Symplekin vs. Ensembl Medaka
Match: sympk (symplekin [Source:NCBI gene;Acc:101158983])

HSP 1 Score: 458.373 bits (1178), Expect = 1.500e-142
Identity = 320/973 (32.89%), Postives = 530/973 (54.47%), Query Frame = 1
Query:   76 DRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKV----DSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKR-KEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSLESKE---KRETFQDESNSNSILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFN----LESVTKTLPTETMQEIFHESFKRI--LVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS-DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEA 2949
            ++VV+L N     +  +EK   + Q++ELI+ K+PSLLDNF ++I+    +++  V+  VI FIE ACK D++L+ + +  L  L++DES NV+K+    +  +Y ++L   +  K+ S    E  + C  ++  +  +V    DS N G+    IK  E ++I  S R PDS++PK ++ D+SLDK+P D +   +    L + G      L+K +     SS ++ T L SL  IA+QRP FMS V++++E  H N+P  L + QV+S+RK LK  L+++LKHP  +EF  Q++TLL+DLGM Q+EI R  P    V +  RKR + E     K+ +       D  D        K+  AP    K  ++        L+ E L  L T  NV +LVL+SM+ LP+ MP +FQ+ YTP+ +AGT  QI HL+R+++ Q+ +AG    E  +   K E  +++S +  IL    +      ++ + +    + P +T+ P       E +  + PT+ M     +   R+  +V PL + + ++    T+++V         + +   S    L S     F G  +  +++++ ++D+++R D+  SLL +EY +Y + + +               +  YD  L  +L  L    + ++  F +++LEAP+IT  AL ++R YC  +     G   ++EL   RP  + + L ++LD SS +  +VR+ AL+  K  +   +   + I  FA   L  L+   P + +      T +   WT+E VR CL+L+L+L+P+NH L+H LA V+ +A   +KR++++ I+ PI+ MGMNS E+L LVENC      L+ R +HILTDK  PSP +VE+++++YH +  DVR +IP++ GL K E+I+ LPKL+ LN  +V EVF RLL     +   G   V  SP+ P +LL+A+H ++    ++K +I+A
Sbjct:   20 EKVVELLNQA-SLIPTDEKLTALKQVQELIINKDPSLLDNFLDEIIAFQTDKSIEVKKFVIGFIEEACKRDNELLVRLIANLNMLLKDESVNVVKKAILTLTQLYKVTLQWLVSSKTLS----EMQEACWDLITQMKGEVLALLDSDNDGVRTHSIKFTESLIITLSPRTPDSDVPKRQDADISLDKVPKDHSY--IHYGTLCEEGKSALEKLLKFMVHPAISSINLTTALGSLATIARQRPMFMSEVVQAYETLHANLPPTLAKSQVSSVRKNLKLHLVAVLKHPCSVEFQGQISTLLLDLGMPQTEITRNTP----VPREPRKRPRYEQYTEGKKVKIEPALMEDDED--------KEEPAPLAAPKPAAVPAVQSALDLTAEFLHPLLTPENVANLVLISMVYLPDVMPASFQATYTPVESAGTDAQIKHLARMMATQMTAAGIGPGEHHKRACKEEQSEEDSTAKDILIKRKVPAVILGQAISVVGGYSEKPSATEPPAAPKRLPEPILPSAPTKLMGASGRKKVFRLSDVVQPLSDTQNEKL---TSSAVKRILHSEKAIAQSGMSHVIKLLSRLVTQFEGM-MKEDVLQFILEDIRSRSDLAFSLLYQEYNTYLSQLPS-------------GLLDSYDQCLFTLLSGLQEKPEQRDGLFTKLVLEAPIITESALEVIRRYCEDESRVYLGMTTLKELIVKRPSRQFQYLHVLLDLSSNEKEKVRTTALAFLKR-MYEKDQLRDYIEKFALNYLQLLVHPNPPSLLFGADKDTEVAAPWTEETVRQCLFLYLSLLPLNHRLVHELASVYTEAIADIKRSVLRAIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHILTDKVPPSPELVERVRDLYHKRVPDVRFLIPVINGLEKNEVIQALPKLIKLNPIVVKEVFNRLLGTQHSE---GSSSV--SPLTPGDLLIALHNIDSVKCDMKSIIKA 950          
BLAST of Symplekin vs. Planmine SMEST
Match: SMESG000046152.1 (SMESG000046152.1)

HSP 1 Score: 2358.56 bits (6111), Expect = 0.000e+0
Identity = 1203/1204 (99.92%), Postives = 1203/1204 (99.92%), Query Frame = 1
Query:   58 MPHSIFDRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKAXXXXXXXXXXHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSLESKEKRETFQDESNSNSILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTXXXXXXXXXXXXXMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITSDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDSVVTVQTATVENVVPNGNGAQNPANSDTVPIPNESITTETVVAFVTPKIEKFTSSSLAKAAMXXXXXXXXXXXXXXXXXXXXXGGNKISFFPLKPSDSSNKEAK 3669
            MPHSIFDRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKALKGSLLSLLKHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSLESKEKRETFQDESNSNSILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTNNSVNSFFVDSSNMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITSDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDSVVTVQTATVENVVPNGN AQNPANSDTVPIPNESITTETVVAFVTPKIEKFTSSSLAKAAMDKEKLDEDRKKKEKAKQLLEKGGNKISFFPLKPSDSSNKEAK
Sbjct:    1 MPHSIFDRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYEDILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVMKRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPNGGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQIEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRVIESFELTHVNMPDKLGEIQVNSIRKALKGSLLSLLKHPSCLEFHSQVTTLLIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYSDLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDLVLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLSLESKEKRETFQDESNSNSILEDFPMSGYANQKSKNQMTLLKKHPFSTQKPFNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTNNSVNSFFVDSSNMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDILLSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITSDVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRPDHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTNLNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIHLLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLIIRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEILPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQLEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRTLMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFAVLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSDSVVTVQTATVENVVPNGNSAQNPANSDTVPIPNESITTETVVAFVTPKIEKFTSSSLAKAAMDKEKLDEDRKKKEKAKQLLEKGGNKISFFPLKPSDSSNKEAK 1204          
The following BLAST results are available for this feature:
BLAST of Symplekin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYMPK0.000e+035.70symplekin [Source:HGNC Symbol;Acc:HGNC:22935][more]
SYMPK2.704e-15734.46symplekin [Source:HGNC Symbol;Acc:HGNC:22935][more]
SYMPK2.704e-15734.46symplekin [Source:HGNC Symbol;Acc:HGNC:22935][more]
SYMPK8.362e-8032.92symplekin [Source:HGNC Symbol;Acc:HGNC:22935][more]
SYMPK1.605e-1848.05symplekin [Source:HGNC Symbol;Acc:HGNC:22935][more]
back to top
BLAST of Symplekin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
symk-12.497e-6324.51SYMpleKin cleavage and polyadenylation factor [So... [more]
back to top
BLAST of Symplekin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sym2.164e-12828.17gene:FBgn0037371 transcript:FBtr0078723[more]
back to top
BLAST of Symplekin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sympk0.000e+034.30symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361][more]
sympk0.000e+034.30symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361][more]
back to top
BLAST of Symplekin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps80.000e+033.36VPS8, CORVET complex subunit [Source:Xenbase;Acc:X... [more]
vps80.000e+033.36VPS8, CORVET complex subunit [Source:Xenbase;Acc:X... [more]
vps80.000e+032.88VPS8, CORVET complex subunit [Source:Xenbase;Acc:X... [more]
vps80.000e+032.98VPS8, CORVET complex subunit [Source:Xenbase;Acc:X... [more]
vps80.000e+032.98VPS8, CORVET complex subunit [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Symplekin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Sympk0.000e+035.55symplekin [Source:MGI Symbol;Acc:MGI:1915438][more]
Sympk1.210e-2847.22symplekin [Source:MGI Symbol;Acc:MGI:1915438][more]
Sympk2.552e-2835.60symplekin [Source:MGI Symbol;Acc:MGI:1915438][more]
Sympk8.197e-1932.94symplekin [Source:MGI Symbol;Acc:MGI:1915438][more]
back to top
BLAST of Symplekin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q92797|SYMPK_HUMAN0.000e+035.70Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV... [more]
sp|Q80X82|SYMPK_MOUSE0.000e+035.55Symplekin OS=Mus musculus OX=10090 GN=Sympk PE=1 S... [more]
sp|Q8MSU4|SYMPK_DROME2.169e-12728.17Symplekin OS=Drosophila melanogaster OX=7227 GN=Sy... [more]
sp|Q7ZYV9|SYMPK_XENLA3.884e-10237.57Symplekin OS=Xenopus laevis OX=8355 GN=sympk PE=1 ... [more]
back to top
BLAST of Symplekin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PFV10.000e+036.94Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A210PW070.000e+036.84Symplekin OS=Mizuhopecten yessoensis OX=6573 GN=KP... [more]
A0A433U5Q70.000e+036.22Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
V4AJ750.000e+036.65Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
K9J0G00.000e+035.97Putative mrna cleavage and polyadenylation factor ... [more]
back to top
BLAST of Symplekin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sympk1.671e-16833.36symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361][more]
sympk1.309e-10837.64symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361][more]
back to top
BLAST of Symplekin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sympk2.905e-11636.35symplekin [Source:ZFIN;Acc:ZDB-GENE-060526-361][more]
back to top
BLAST of Symplekin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Symplekin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO468591.239e-7644.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330071.294e-6336.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Symplekin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sympk0.000e+033.60symplekin [Source:NCBI gene;Acc:101158983][more]
sympk1.341e-17932.96symplekin [Source:NCBI gene;Acc:101158983][more]
sympk1.500e-14232.89symplekin [Source:NCBI gene;Acc:101158983][more]
back to top
BLAST of Symplekin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000046152.10.000e+099.92SMESG000046152.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023927 ID=SMED30023927|Name=Symplekin|organism=Schmidtea mediterranea sexual|type=transcript|length=3753bp
CGAAAATTATTTAAAATAATTATTTCTATTTTGTAAATATATTAATTTTT
TATATTTATGCCTCATTCTATATTTGACCGAGTAGTAGATCTATGTAATT
CTACAATTGAGACTGTAGACGCAGAAGAAAAAGCTTTGTATATTAATCAA
ATAAAAGAATTGATAGTTTACAAAGAACCAAGCTTATTAGATAATTTTTA
CGAGGATATTCTTGGACTATTAATTGAAAGAAATGCCAATGTCCGCGTAA
CTGTTATTGATTTTATTGAGAATGCATGTAAAGTCGATTCTGATTTAGTG
AATAAATCTGTTGAAAGATTGAGATTTTTAATTGAAGATGAAAGCTTCAA
TGTCATGAAGCGACTTGCTACTGCAATGATGACAATTTATCCTTTAAGTT
TATCTCAAGCAATTAAATTAAAATCAAGTAGTGCAGATGATATTGAAGCT
TTCCAATATTGTCTAGTAATTGTTGAAGCGTTAATATCGAAAGTTGATTC
ACCAAACGGTGGAATGCTTTTAATGTTAATAAAGTTGATGGAGTGCATAG
TGATTTTGCAATCTCAGCGCTTTCCAGATTCAGAAATACCGAAAGGCAAG
GAAAATGATCTTAGTCTAGATAAGATACCGGCAGATTTGACAATACCTTG
TCTGCAAATTGAGATTTTAGAGAAATCGGGATTACGCTTATTCAATGTCC
TGATAAAACTTCTTAATCGCGAGCACTCCTCATCCTCTCATATTCACACT
TTACTCGCATCGTTAACTAATATCGCTAAGCAACGTCCACAGTTTATGAG
TCGAGTTATTGAGAGTTTTGAATTAACCCATGTAAATATGCCTGATAAAT
TAGGTGAAATTCAAGTAAACTCTATTCGAAAGGCCCTGAAAGGCAGTCTT
CTGTCTTTATTAAAACATCCCTCTTGCTTAGAGTTCCATAGTCAAGTAAC
CACTCTGTTAATTGATCTTGGAATGACTCAATCTGAGATTGTTCGGGCTT
TACCAAAAGCTGACGAAGTATCACAAATGAAACGAAAAAGAAAAGAAGAA
AATAATTTGTCAAGTAAACGTGCAAGAACAAGTGTGAATGCTCATTCCGA
TTATTCTGATCTCACATACAATGACAGTATTATCAAAAAGTTTGCTGCTC
CATCTTTAGAGCAAAAATCTCCGTCACTAAGGAAACCAAATTACGTGGAA
CAGTTATCCAAAGAACTATTACCAAAATTAAATACAGTTATCAACGTAAC
AGATCTTGTGTTGTTGAGTATGATGATGCTACCAGAAACCATGCCTCCAG
CATTCCAGTCTGCCTATACTCCCATTGCTGCCGCTGGAACACAGACTCAG
ATTGCGCATTTGTCGAGATTGTTGTCTGCGCAATTAGTGTCAGCCGGCTA
TTTGTCACTCGAATCCAAAGAGAAAAGGGAAACCTTTCAAGATGAAAGTA
ATAGTAATTCCATTCTTGAAGATTTCCCTATGAGTGGCTATGCCAATCAG
AAAAGTAAAAATCAAATGACACTGTTGAAAAAGCATCCTTTCAGTACACA
GAAGCCATTCAATCTAGAATCAGTTACCAAAACATTGCCAACGGAAACAA
TGCAAGAAATATTCCATGAGTCATTTAAGCGTATTTTAGTAATGCCATTG
TTGAATAATGAGCTAAAGCGATGTCGTGCAAACACTAATAACTCAGTGAA
CTCGTTTTTTGTCGACAGTTCCAATATGCCTAAATGGTACTTCAGTCGCA
ACACAATCCTGACTTCTCTGCCATCAGCATTGTTCGGGGGTGCTGAATTA
TACAGAGAACTTGTGAAATACTGCATGAAAGATGTCAAAAACAGATATGA
TATACTATTATCGCTATTAATTAAAGAATACACAAGCTATAAAGCCTATA
TATTGGCGATTTCTAAGCATCGTGAAAATACAGCTACACCTAGATTGGCA
ACGATTTCCGATTATGACGCGGTTTTAGTGGGGGTATTGAAGGAACTGAT
AACTTCCGATGTGAAGGAAACCTATTTCGGTAGAATGCTGTTGGAAGCTC
CTTTGATTACTACTGGGGCTTTAAACATTCTCAGATCGTATTGTTCCGCA
AAGGTAAATGCGGATTACGGGTTTCAAATCATACGGGAGCTGTTTAATAA
CCGCCCCGATCATAGGAAAGAATTATTGATGATAATTCTTGATTTTTCAT
CTGAGGATAACATGGAAGTTCGTTCAGCAGCACTAAGTGCTGCTAAATGG
ATTTTAATGACTTCTGAAAACTTTTCAGAGGAAATTTTAGATTTTGCTAA
AACCAATCTCAATTATCTTTTACAAGCCAAGCCATCTAACTCTATTCACC
CACTCCAGCATCTTACTGTAATGCCGGTAGATTGGACAGATGAAGTAGTA
AGGCCGTGTTTGTACTTGTTTCTCGCCCTAATGCCCGTAAATCATTCTTT
AATCCACCTGTTGGCCGAGGTATTCGTTAAAGCCTGCCAAATTGTGAAAA
GAACGATTATCAAAATGATAGATATTCCTATTAAGGAAATGGGGATGAAT
TCAGAGGAAATATTGCGATTGGTGGAGAATTGCGATAGTAACCAAGTGGT
TCTAATTATTAGGGTTATTCATATTCTAACAGATAAGGCTATGCCATCAC
CATTGATGGTGGAAAAGCTGAAAAATATCTACCATAATAAGTATTCAGAT
GTGCGATTGATTATTCCGATTTTAAAAGGATTGACAAAGACTGAGATGAT
TGAAATTCTTCCGAAATTAGTAGTTCTAAACGATAAACTTGTTTCTGAAG
TTTTTCGTCGTTTGCTAGACGTATCAGCATTTGACCCTGTGAAAGGAGAC
TTTGTAGTAAAAACCAGCCCAATATTGCCCGAAGAATTGCTTGTTGCAGT
GCATCAACTTGAATTCGCAAATGTGGAATTGAAAGTCGTAATTGAAGCCA
GTAAAATGTGTTTTAGGGAAAAGCAAATTTTCACCCAAGAAAGATTGTCG
ATAGTAATCGGGCAATTGCTAGATTTACCCGTTCTACCGACATTGTTCAT
GAGAACGTTAATGCAATCGTTTTCCATGTATCCTCGAATGGTTGGCTATG
TGGTCAATGTCCTATCTCGATTGATCAAGAAACAAGTTTGGAAAAATTCC
TCACTCTGGGATGGATTTATTCGATGTTGCGTTAAACTCGGTCAGCAATC
ATTTGCGGTGCTTCTCCAGTTACCGGTCGATAAATTGGAATCCGTATTCA
ATTCCGTCCCGGAGTTCCGCACCCAAATGAGGCGATATATTGATAATTGC
ACTCAAGCACAGAAACTGCATTTTTCCAATGCGATCTTGAGTCTGATTAA
CAGTGATTCGGTTGTTACAGTTCAGACGGCTACGGTGGAAAATGTCGTTC
CGAATGGTAATGGCGCGCAAAATCCCGCCAATTCTGACACAGTTCCCATA
CCGAATGAATCGATTACCACGGAAACGGTTGTAGCTTTTGTTACACCGAA
AATTGAAAAGTTTACCAGTAGTTCCTTGGCTAAAGCTGCCATGGATAAGG
AGAAATTGGACGAAGATCGCAAGAAAAAAGAAAAGGCAAAACAACTCTTG
GAAAAGGGTGGCAATAAAATTTCATTTTTCCCCCTAAAGCCCTCTGATTC
GAGTAATAAGGAAGCTAAATGAGTCACTGATTTCTAATAAACATTATATA
TTATTTTGTTATAGTTGTTCGATAAATTTGTTCTAGTGAAAAAAAAGATC
GGA
back to top

protein sequence of SMED30023927-orf-1

>SMED30023927-orf-1 ID=SMED30023927-orf-1|Name=SMED30023927-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1205bp
MPHSIFDRVVDLCNSTIETVDAEEKALYINQIKELIVYKEPSLLDNFYED
ILGLLIERNANVRVTVIDFIENACKVDSDLVNKSVERLRFLIEDESFNVM
KRLATAMMTIYPLSLSQAIKLKSSSADDIEAFQYCLVIVEALISKVDSPN
GGMLLMLIKLMECIVILQSQRFPDSEIPKGKENDLSLDKIPADLTIPCLQ
IEILEKSGLRLFNVLIKLLNREHSSSSHIHTLLASLTNIAKQRPQFMSRV
IESFELTHVNMPDKLGEIQVNSIRKALKGSLLSLLKHPSCLEFHSQVTTL
LIDLGMTQSEIVRALPKADEVSQMKRKRKEENNLSSKRARTSVNAHSDYS
DLTYNDSIIKKFAAPSLEQKSPSLRKPNYVEQLSKELLPKLNTVINVTDL
VLLSMMMLPETMPPAFQSAYTPIAAAGTQTQIAHLSRLLSAQLVSAGYLS
LESKEKRETFQDESNSNSILEDFPMSGYANQKSKNQMTLLKKHPFSTQKP
FNLESVTKTLPTETMQEIFHESFKRILVMPLLNNELKRCRANTNNSVNSF
FVDSSNMPKWYFSRNTILTSLPSALFGGAELYRELVKYCMKDVKNRYDIL
LSLLIKEYTSYKAYILAISKHRENTATPRLATISDYDAVLVGVLKELITS
DVKETYFGRMLLEAPLITTGALNILRSYCSAKVNADYGFQIIRELFNNRP
DHRKELLMIILDFSSEDNMEVRSAALSAAKWILMTSENFSEEILDFAKTN
LNYLLQAKPSNSIHPLQHLTVMPVDWTDEVVRPCLYLFLALMPVNHSLIH
LLAEVFVKACQIVKRTIIKMIDIPIKEMGMNSEEILRLVENCDSNQVVLI
IRVIHILTDKAMPSPLMVEKLKNIYHNKYSDVRLIIPILKGLTKTEMIEI
LPKLVVLNDKLVSEVFRRLLDVSAFDPVKGDFVVKTSPILPEELLVAVHQ
LEFANVELKVVIEASKMCFREKQIFTQERLSIVIGQLLDLPVLPTLFMRT
LMQSFSMYPRMVGYVVNVLSRLIKKQVWKNSSLWDGFIRCCVKLGQQSFA
VLLQLPVDKLESVFNSVPEFRTQMRRYIDNCTQAQKLHFSNAILSLINSD
SVVTVQTATVENVVPNGNGAQNPANSDTVPIPNESITTETVVAFVTPKIE
KFTSSSLAKAAMDKEKLDEDRKKKEKAKQLLEKGGNKISFFPLKPSDSSN
KEAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR021850Symplekin/Pta1
IPR032460Symplekin/Pta1_N
IPR022075Symplekin_C
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0097165nuclear stress granule
Vocabulary: biological process
TermDefinition
GO:0006378mRNA polyadenylation
GO:0035307positive regulation of protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1157..1184
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1161..1182
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1160..1204
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 319..342
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 319..336
NoneNo IPR availablePANTHERPTHR15245SYMPLEKIN-RELATEDcoord: 8..1097
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 2..336
e-value: 4.7E-88
score: 297.4
IPR022075Symplekin C-terminalPFAMPF12295Symplekin_Ccoord: 881..1065
e-value: 1.1E-59
score: 201.6
IPR032460Symplekin/Pta1, N-terminalPFAMPF11935DUF3453coord: 98..320
e-value: 2.9E-37
score: 128.5
IPR021850Symplekin/Pta1PANTHERPTHR15245:SF20SYMPLEKINcoord: 8..1097
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 4..891