MAM domain-containing protein

Overview
NameMAM domain-containing protein
Smed IDSMED30023911
Length (bp)1916
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MAM domain-containing protein (SMED30023911) t-SNE clustered cells

Violin plots show distribution of expression levels for MAM domain-containing protein (SMED30023911) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023911

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023911h1SMcG0012633 SmedASXL_013789SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30023911h1SMcG0012633 Contig35256newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023911h1SMcG0012633 Contig17456newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023911h1SMcG0012633 Contig17456uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30023911h1SMcG0012633 dd_Smed_v4_1725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30023911h1SMcG0012633 dd_Smed_v6_22965_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MAM domain-containing protein vs. TrEMBL
Match: A0A5K4F7Q4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.810e-33
Identity = 94/252 (37.30%), Postives = 135/252 (53.57%), Query Frame = 1
Query:  112 LDCSFDDG-FCKWSNDQNNWLINWVRME------HGVCL----TLSSVVKMVRIPQEKPITARLWSAFM-----YSDIKLACVSFAYRLAN--VEKSKLTLMRREMGSCKSTIDENGLPALLCGNVPIWSTKNS---PTKNVNSWTTVFISIN-------ESNSGDFKLILEGTIPSGNPNAKICVDNITSSAEPCEVIK----PGPSVGAAYTYHSWVELFGITFAGALALGLTIPIAVFVVCLFERKRRR 771
            L+C+++DG  C W+ D  + L  W  ++        +CL     LS    +  +  E  I+ARLWS  +       D ++ C+ F Y + +    KS+LT+MR    +C   +   G PA++C N PIWS+ NS   P  N + W  VFI ++       ES   D+KLILEGTIP+G P+A+ICVDNITS  EPC  ++    P PS        SW + FG+TF GAL LGL IP+   V+ ++  +RR 
Sbjct:   32 LNCTYEDGTLCGWNMDPRDVLALWQVVDIPSFKTKALCLLPNPDLSLYQDVSDLKFETNISARLWSGHVRVKKQLKDHEIRCLQFTYFIPSKTALKSRLTIMRHSDRACDR-VTYRGDPAVVCANKPIWSSVNSNSLPDFNQSIWQIVFIQLDQQITNQSESTLSDYKLILEGTIPAGYPDARICVDNITSYTEPCSALEKASAPLPS------QWSWAQYFGLTFVGALILGLLIPVLFLVILIWACRRRH 276          
BLAST of MAM domain-containing protein vs. TrEMBL
Match: A0A5K4F897 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.071e-33
Identity = 95/301 (31.56%), Postives = 145/301 (48.17%), Query Frame = 1
Query:   61 TISKMFLLSCRILATSD-----------LDCSFDDGFCKWSNDQNNWLINWVR---------MEHG---------VCLTLSSVVKMVRIPQEKPITARLWSAFMYSDIKLACVSFAYRLANVEKS----------------------KLTLMRREMGSCKSTIDENGLPALLCGNVPIWS------TKNSPTKNVNSWTTVFISINESNSG---DFKLILEGTIPSGNPNAKICVDNITSSAEPCEVIK----PGPSVGAAYTYHSWVELFGITFAGALALGLTIPIAVFVVCLFERKRRR 771
            +I  +F+LS + +  ++           L+C F +  C W ND NNW +NW           ++H          +CL++    K      +  ITARL+S  +    + +C+   Y +  V  S                      KL+L+RR+MGSC     +    +LLC N  +W+      T+N    +++ W T+ +S+ +SN     D+KLILEGTIP+G P+A+ICVDNITS  EPC  ++    P PS        SW + FG+TF GAL LGL IP+   V+ ++  +RR 
Sbjct:    6 SILFLFVLSVKAIQVTESMDYSSESDMNLECEFKESMCNWGNDPNNWPVNWRLNAMSYKEEFLKHSEMSTVERNSICLSIQG--KSNNHQSDHDITARLFSPIISIMKQPSCIQLIYNIQYVSGSLRDEISLSGRELNMYSVGDKLPKLSLLRRQMGSCTKKTVDGRKESLLCENEKLWTSDYSFHTQNELLSSISLWKTITLSLIDSNEQIITDYKLILEGTIPAGYPDARICVDNITSYTEPCSALEKASAPLPS------QWSWAQYFGLTFVGALILGLLIPVLFLVILIWACRRRH 298          
BLAST of MAM domain-containing protein vs. TrEMBL
Match: A0A5K4FBY4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 7.021e-33
Identity = 92/244 (37.70%), Postives = 132/244 (54.10%), Query Frame = 1
Query:  112 LDCSFDDG-FCKWSNDQNNWLINWVRME------HGVCLTLSSVVKMVRIPQEKPI--TARLWSAFMYSDI--KLACVSFAY------RLANVEKSKLTLMRREMGSCKSTID-ENGLPALLCGNVPIWSTKNSPT--KNVNSWTTVFISINESNSGDFKLILEGTIPSGNPNAKICVDNITSSAEPCEVIK----PGPSVGAAYTYHSWVELFGITFAGALALGLTIPIAVFVVCLFERKRRR 771
            + CSF++G FC W++D  + L  W  +       H  CL LS+    V    +  +  +ARLWS  + S    K+ C+ F Y      RL ++   +L LM+   GSCK ++D E     + CGN  +WS+ N          W TV +++N ++  DFKLILEGTIP+G P+A+ICVDNITS  EPC  ++    P PS        SW + FG+TF GAL LGL IP+   V+ ++  +RR 
Sbjct:   32 VSCSFEEGNFCGWNDDPRDVLAWWQVIHLPEFHTHAACLHLSTSPFFVESGDKLIVEGSARLWSGQVRSHPTNKIQCLGFKYIVLFNKRLPHI---RLNLMKHSTGSCKPSLDPETRQFGVFCGNAQLWSSSNDKQFMHTTTKWLTVVVNLNSTDQ-DFKLILEGTIPAGYPDARICVDNITSYTEPCSALEKASAPLPS------QWSWAQYFGLTFVGALILGLLIPVLFLVILIWACRRRH 265          
BLAST of MAM domain-containing protein vs. TrEMBL
Match: A0A5K4F892 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.193e-30
Identity = 94/280 (33.57%), Postives = 135/280 (48.21%), Query Frame = 1
Query:  112 LDCSFDDG---FCKWSNDQNNWLINW------VRMEHGV-CLTLSSV----VKMVRIPQEKPITARLWSAFMYSDI------------------KLACVSFAYRL----ANVEKS----------KLTLMRREMGSCKSTIDENGLPALLCGNVPIWSTKNS---PTKNVNSWTTVFISIN-------ESNSGDFKLILEGTIPSGNPNAKICVDNITSSAEPCEVIK----PGPSVGAAYTYHSWVELFGITFAGALALGLTIPIAVFVVCLFERKRRR 771
            L C FD+    FC W  D  N   +W        + +G+ CL   ++    ++ +   Q   +TARLWS  +   I                   L C+ F Y++    +NV+             L+L++   G+C   +   G PA++C N PIWS+ NS   P  N + W  VFI ++       ES   D+KLILEGTIP+G P+A+ICVDNITS  EPC  ++    P PS        SW + FG+TF GAL LGL IP+   V+ ++  +RR 
Sbjct:   40 LYCDFDNAKMEFCHWQGDPRNDKAHWKHEYMTTDLHNGIICLQPRNIQTYRLRKIYSDQRNSLTARLWSETVEPVITSNENSDYMEYSLNSPQNSLRCIQFQYKIQLHDSNVDPPTSNSIDNALINLSLLKHSTGACDR-VTYRGDPAVVCANKPIWSSVNSNSLPDFNQSIWQIVFIQLDQQITNQSESTLSDYKLILEGTIPAGYPDARICVDNITSYTEPCSALEKASAPLPS------QWSWAQYFGLTFVGALILGLLIPVLFLVILIWACRRRH 312          
BLAST of MAM domain-containing protein vs. TrEMBL
Match: A0A5K4FBY0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 3.056e-29
Identity = 85/260 (32.69%), Postives = 133/260 (51.15%), Query Frame = 1
Query:   88 CRILATSD-LDCSFDD-GFCKWSNDQNNWLINWV------RMEHGVCLTLS-----------SVVKMVRIPQEKPITARLWSAFMYSDIK--LACVSFAYRLA--NVEKSKLTLMRREMGSCKSTIDEN-GLPALLCGNVPIWSTKNSPTKNV--NSWTTVFISI--NESNSGDFKLILEGTIPSGNPNAKICVDNITSSAEPCEVIK----PGPSVGAAYTYHSWVELFGITFAGALALGLTIPIAVFVVCLFERKRRR 771
            C ++   D ++C+++    CKW +D  + + +W          H +C+  +           S++  V +      +ARLWS  ++ D    + C+SF + +   ++ K++LTLM+   GSC+    E  G   + C N  +W    SP+ +   + W  V I +    S   DFKLILEGTIP+G P+A+ICVDNITS  EPC  ++    P PS        SW + FG+TF GAL LGL IP+   V+ ++  +RR 
Sbjct:   23 CNLIPGLDPVNCTYEQKNLCKWKDDPRDEMASWKVYYFSDYHTHAMCMQSNKIFFPSKTPSQSIIPTVAVQSIHEFSARLWSGHVFYDPDNLIKCLSFQFMVTTRHIAKTRLTLMKHSSGSCEEIRREQTGALGVFCSNDQLWQ---SPSHHELDSDWMNVKIDLVSKSSKPTDFKLILEGTIPAGYPDARICVDNITSYTEPCSALEKASAPLPSQW------SWAQYFGLTFVGALILGLLIPVLFLVILIWACRRRH 273          
BLAST of MAM domain-containing protein vs. Planmine SMEST
Match: SMESG000074171.1 (SMESG000074171.1)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 395/419 (94.27%), Postives = 401/419 (95.70%), Query Frame = 1
Query:  430 NVPIWSTKNSPTKNVNSWTTVFISINESNSGDFKLILEGTIPSGNPNAKICVDNITSSAEPCEVIKPGPSVGAAYTYHSWVELFGITFAGALALGLTIPIAVFVVCLFERKRRRGMKNKRVIRHADELDLPEGMNTASCEDTYPLPQKYANSQVGVGHPRLMNRAMSTPAGTNGQGGNYTMGKRNGTPQQPMGPRSNSGQMSHTMGRGGLEGGWMMSSQHGDLMENDEYTIDSDYTTHRQMSVPVSGYISVXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQNRQVPQPQTXXXXXXXXXXXPFGTPANVGISGTGQDNRSLAGSHAANFSNDENRATPGLPFYPPRYEEAMGFNHGQPIPMEEKPPLLPPRVPEGNISGAGTSCSTXXXXXXXXXXISGHPSAGRFNIGAPGAQSGNEL 1686
            ++PIW + +       SW    + + E  S DFKLILEGTIPSGNPNAKICVDNITSSAEPCEVIKPGPSVGAAYTYHSWVELFGITFAGALALGLTIPIAVFVVCLFERKRRRGMKNKRVIRHADELDLPEGMNTASCEDTYPLPQKYANSQVGVGHPRLMNRAMSTPAGTNGQGGNYTMGKRNGTPQQPMGPRSNSGQMSHTMGRGGLEGGWMMSSQHGDLMENDEYTIDSDYTTHRQMSVPVSGYISVAGQGDAGMMQGQVSSMSGMQQMGNQSVMYQNRQVPQPQTNVVVSSSASNNPFGTPANVGISGTGQDNRSLAGSHAANFSNDENRATPGLPFYPPRYEEAMGFNHGQPIPMEEKPPLLPPRVPEGNISGAGTSCSTPLPPAPPPLPISGHPSAGRFNIGAPGAQSGNEL
Sbjct:   19 SLPIWQSLDG----AKSWNVALVDLKEVTS-DFKLILEGTIPSGNPNAKICVDNITSSAEPCEVIKPGPSVGAAYTYHSWVELFGITFAGALALGLTIPIAVFVVCLFERKRRRGMKNKRVIRHADELDLPEGMNTASCEDTYPLPQKYANSQVGVGHPRLMNRAMSTPAGTNGQGGNYTMGKRNGTPQQPMGPRSNSGQMSHTMGRGGLEGGWMMSSQHGDLMENDEYTIDSDYTTHRQMSVPVSGYISVAGQGDAGMMQGQVSSMSGMQQMGNQSVMYQNRQVPQPQTNVVVSSSASNNPFGTPANVGISGTGQDNRSLAGSHAANFSNDENRATPGLPFYPPRYEEAMGFNHGQPIPMEEKPPLLPPRVPEGNISGAGTSCSTPLPPAPPPLPISGHPSAGRFNIGAPGAQSGNEL 432          
BLAST of MAM domain-containing protein vs. Planmine SMEST
Match: SMESG000074172.1 (SMESG000074172.1)

HSP 1 Score: 216.468 bits (550), Expect = 8.262e-68
Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
Query:   73 MFLLSCRILATSDLDCSFDDGFCKWSNDQNNWLINWVRMEHGVCLTLSSVVKMVRIPQEKPITARLWSAFMYSDIKLACVSFAYRLANVEKSKLTLMRREMG 378
            MFLLSCRILATSDLDCSFDDGFCKWSNDQNNWLINWVRMEHGVCLTLSSVVKMVRIPQEKPITARLWSAFMYSDIKLACVSFAYRLANVEKSKLTLMRREMG
Sbjct:    1 MFLLSCRILATSDLDCSFDDGFCKWSNDQNNWLINWVRMEHGVCLTLSSVVKMVRIPQEKPITARLWSAFMYSDIKLACVSFAYRLANVEKSKLTLMRREMG 102          
BLAST of MAM domain-containing protein vs. Planmine SMEST
Match: SMESG000074173.1 (SMESG000074173.1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.509e-19
Identity = 45/109 (41.28%), Postives = 59/109 (54.13%), Query Frame = 1
Query:   94 ILATSDLDCSFDDGFCKWSNDQNNWLINWVRM--------------EHGVCLTLSSVVKMVRIPQEKPITARLWSAFMYSDIKLACVSFAYRLANVEKSKLTLMRREMG 378
            IL    LDC+F++ FCKW ND NNW +NW +                 G CL  S       I  E  +TARLWS  +  ++KL C++F YR+   + +KLTLMRREMG
Sbjct:   19 ILGQKLLDCNFENEFCKWGNDFNNWKMNWKQTAMYELGFINTQNTENGGACLIAS------EIADESALTARLWSPEVMKNVKLGCLAFQYRIDGDKSTKLTLMRREMG 121          
BLAST of MAM domain-containing protein vs. Planmine SMEST
Match: SMESG000074174.1 (SMESG000074174.1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.972e-15
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = 1
Query:  112 LDCSFDDGFCKWSNDQNNWLINWV--------RMEHGVCLTLSSVVKMVRIPQE-KPITARLWSAFMYSDIKLACVSFAYRLANVEKSKLTLMRREMG 378
            LDCSF++ FCKW+ND NNW +NW          ++  V     + VK      E + +T+RLW   +    K+ C++F Y++     SKLTLMRREMG
Sbjct:  115 LDCSFENNFCKWANDLNNWDLNWQLTAMNEIGMIDRHVIENKGACVKSTEFSDEVRTMTSRLWGPPVSKIEKIGCITFQYKIKEKNHSKLTLMRREMG 212          
BLAST of MAM domain-containing protein vs. Planmine SMEST
Match: SMESG000074174.1 (SMESG000074174.1)

HSP 1 Score: 52.373 bits (124), Expect = 6.632e-8
Identity = 34/107 (31.78%), Postives = 49/107 (45.79%), Query Frame = 1
Query:  109 DLDCSFDDGFCKWSNDQNNWLINW--------------VRMEHGVCLTLSSVVKMVRIPQEKPITARLWSAFMYSDIK---LACVSFAYRLANVEKSKLTLMRREMG 378
            +++C F+   C W ND NNWL NW                  +G+C+ L +    V    E  I  RL S  +    +   L C++F Y  +    +K+TLMRREMG
Sbjct:   23 NINCQFESSLCHWINDGNNWLGNWKVSNLNTVIPEKPTKYKTNGICVVLEN----VESSSEGLIAVRLLSTVVRKSNRISPLKCITFNYLKSG--NTKMTLMRREMG 123          
The following BLAST results are available for this feature:
BLAST of MAM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F7Q41.810e-3337.30Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F8974.071e-3331.56Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4FBY47.021e-3337.70Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F8923.193e-3033.57Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4FBY03.056e-2932.69Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of MAM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074171.10.000e+094.27SMESG000074171.1[more]
SMESG000074172.18.262e-68100.00SMESG000074172.1[more]
SMESG000074173.11.509e-1941.28SMESG000074173.1[more]
SMESG000074174.11.972e-1539.80SMESG000074174.1[more]
SMESG000074174.16.632e-831.78SMESG000074174.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023911 ID=SMED30023911|Name=MAM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1916bp
AAAAAAAATCTAAAATTATTAAACAAAATTAAACACTTGTGAGTTTTGTT
CTCAAGAAAAACGATATCAAAAATGTTTTTATTGTCGTGTCGAATTTTAG
CAACATCAGATCTGGATTGTAGTTTTGATGATGGATTTTGTAAGTGGAGC
AATGATCAAAATAATTGGCTAATAAACTGGGTCCGAATGGAACATGGAGT
TTGCTTGACGTTGTCATCTGTTGTCAAAATGGTACGAATTCCCCAAGAAA
AACCGATAACTGCTCGACTATGGAGTGCATTCATGTACAGTGATATTAAA
TTAGCATGTGTTTCATTTGCCTATCGGTTAGCGAATGTTGAAAAATCTAA
ATTGACTTTGATGAGAAGAGAGATGGGATCATGCAAATCGACAATTGATG
AAAATGGATTGCCGGCTCTTCTTTGTGGAAATGTTCCCATTTGGTCGACT
AAAAATTCGCCGACGAAAAATGTTAATTCATGGACAACGGTTTTTATTTC
AATTAACGAGTCAAATTCTGGAGATTTTAAGTTGATCTTGGAAGGCACTA
TTCCATCGGGAAACCCAAATGCGAAAATCTGTGTGGACAATATTACGAGC
TCGGCTGAACCTTGTGAAGTCATTAAACCTGGTCCAAGTGTTGGAGCTGC
ATACACTTATCATTCATGGGTTGAATTGTTTGGAATTACTTTTGCTGGTG
CATTGGCTCTTGGTCTCACTATTCCGATTGCGGTTTTCGTTGTTTGCTTG
TTTGAACGCAAAAGACGACGTGGAATGAAAAATAAACGAGTTATTAGACA
TGCTGACGAACTCGATCTTCCGGAAGGAATGAACACTGCATCATGTGAAG
ACACTTATCCACTTCCACAAAAATATGCCAATAGTCAAGTTGGAGTTGGA
CATCCACGATTGATGAACCGAGCAATGAGCACCCCTGCTGGAACCAATGG
ACAAGGTGGAAATTATACAATGGGAAAGAGAAACGGCACTCCTCAACAAC
CCATGGGCCCAAGAAGTAACAGTGGACAAATGAGCCATACTATGGGCAGA
GGTGGATTGGAAGGTGGGTGGATGATGTCCTCTCAACACGGTGACCTCAT
GGAAAATGATGAATACACAATTGATTCGGATTATACTACTCATAGACAAA
TGAGTGTGCCTGTAAGCGGATATATTTCAGTTGCGGGTCAAGGTGATGCC
GGTATGATGCAAGGACAAGTCTCATCCATGAGTGGAATGCAACAAATGGG
TAATCAATCGGTTATGTATCAAAATAGACAAGTTCCACAGCCACAAACTA
ATGTTGTCGTGTCATCATCGGCCTCTAATAATCCTTTTGGTACCCCGGCT
AACGTTGGAATTTCTGGAACTGGACAAGATAATCGTTCTCTAGCTGGAAG
TCATGCTGCAAACTTCTCGAATGACGAAAATAGAGCCACTCCTGGACTAC
CGTTTTATCCACCACGATACGAAGAGGCTATGGGATTCAACCACGGACAA
CCAATACCAATGGAAGAGAAACCCCCTCTTTTGCCACCACGAGTACCTGA
AGGTAACATCTCTGGAGCTGGAACAAGTTGCTCGACTCCTTTACCACCGG
CTCCACCTCCGCTACCAATATCTGGGCATCCATCGGCCGGACGATTCAAT
ATTGGAGCACCCGGTGCTCAATCTGGCAATGAATTGTAAACGTAATTAAA
CCTGAGAAATAAAACAGAATTCGATTGAAGATTTAGTGATGGCTATTTGT
CGAACGAAGATATTTATACTGTTTGTCTGATTATTTCTTGTCTGGGTCTT
TAGCTTGAGTCATTTTAGCTTGACGTTTTAGGAATTCATTTTTTATTTTT
CTCACCTTACTGGATTCTACATTTTATTTTATTGAACATTTTATATCGCG
TTATATTTCACTGTCA
back to top

protein sequence of SMED30023911-orf-1

>SMED30023911-orf-1 ID=SMED30023911-orf-1|Name=SMED30023911-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=539bp
MFLLSCRILATSDLDCSFDDGFCKWSNDQNNWLINWVRMEHGVCLTLSSV
VKMVRIPQEKPITARLWSAFMYSDIKLACVSFAYRLANVEKSKLTLMRRE
MGSCKSTIDENGLPALLCGNVPIWSTKNSPTKNVNSWTTVFISINESNSG
DFKLILEGTIPSGNPNAKICVDNITSSAEPCEVIKPGPSVGAAYTYHSWV
ELFGITFAGALALGLTIPIAVFVVCLFERKRRRGMKNKRVIRHADELDLP
EGMNTASCEDTYPLPQKYANSQVGVGHPRLMNRAMSTPAGTNGQGGNYTM
GKRNGTPQQPMGPRSNSGQMSHTMGRGGLEGGWMMSSQHGDLMENDEYTI
DSDYTTHRQMSVPVSGYISVAGQGDAGMMQGQVSSMSGMQQMGNQSVMYQ
NRQVPQPQTNVVVSSSASNNPFGTPANVGISGTGQDNRSLAGSHAANFSN
DENRATPGLPFYPPRYEEAMGFNHGQPIPMEEKPPLLPPRVPEGNISGAG
TSCSTPLPPAPPPLPISGHPSAGRFNIGAPGAQSGNEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000998MAM_dom
IPR013320ConA-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000998MAM domainSMARTSM00137MAM_2coord: 11..183
e-value: 3.9E-5
score: 9.9
IPR000998MAM domainPFAMPF00629MAMcoord: 16..181
e-value: 3.4E-11
score: 43.3
IPR000998MAM domainPROSITEPS50060MAM_2coord: 14..183
score: 13.892
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 13..182
e-value: 3.4E-8
score: 35.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 496..538
NoneNo IPR availableTMHMMTMhelixcoord: 205..227
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 12..181