Pogo transposable element with ZNF domain

Overview
NamePogo transposable element with ZNF domain
Smed IDSMED30023910
Length (bp)682
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pogo transposable element with ZNF domain (SMED30023910) t-SNE clustered cells

Violin plots show distribution of expression levels for Pogo transposable element with ZNF domain (SMED30023910) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pogo transposable element with ZNF domain (SMED30023910) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pogo transposable element with ZNF domain (SMED30023910) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023910

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023910SMESG000014324.1 SmedASXL_019067SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023910SMESG000014324.1 SmedASXL_019067SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30023910SMESG000014324.1 MF411143smed_ncbi_20200123PMID:29557542
Han et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30023910SMESG000014324.1 MF411143smed_ncbi_20200123PMID:29557542
Han et al., 2019
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023910SMESG000014324.1 MF411143smed_ncbi_20200123PMID:29557542
Han et al., 2019
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30023910SMESG000014324.1 dd_Smed_v4_2118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023910SMESG000014324.1 dd_Smed_v4_2118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023910SMESG000014324.1 dd_Smed_v4_2118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30023910SMESG000014324.1 dd_Smed_v4_2118_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: A0A2Z3D3W2 (Factor for initiating regeneration 1 OS=Schmidtea mediterranea OX=79327 GN=Fir1 PE=2 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 5.724e-148
Identity = 209/213 (98.12%), Postives = 209/213 (98.12%), Query Frame = 3
Query:   27 MDFGSSMFYSRQXPXFAFPSISLSMICXDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQKYV 665
            MDFGSSMFYSRQ   FAFPSISLSMIC DEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQKYV
Sbjct:    1 MDFGSSMFYSRQDRNFAFPSISLSMICHDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQKYV 213          
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: A0A3P6QL59 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS291 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 8.299e-80
Identity = 115/191 (60.21%), Postives = 148/191 (77.49%), Query Frame = 3
Query:   90 SLSMICXDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPR-PSKQMLSQEGDFEIVSTEQGIMVQK 659
            +L+++C DE LS+ Q K+Y+TRLQEY+ +L++V+RLANC NVCITEE V IGE GLLTGE+LNALQHAG+ISVYN  QQ+NWE+P   EGE  V++ H  + DEFLD E+PIR DWPS+H+++CFV+ +KAKLHGS  PLR +LPP+I FRNAAD+DD + PEP  P       E   EIVST +G+ V+K
Sbjct:   85 TLALLCEDESLSDAQLKAYQTRLQEYQTFLEAVSRLANCGNVCITEEAVMIGENGLLTGESLNALQHAGAISVYNTLQQNNWEFPVPEEGEAVVIKTHTTMPDEFLDQEKPIRSDWPSIHISECFVEGEKAKLHGSVRPLRTFLPPSIVFRNAADIDDDM-PEPEIPVSNSTGIEAGLEIVSTSEGLAVRK 274          
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: G4VE17 (Putative suppressor of hairy wing homolog OS=Schistosoma mansoni OX=6183 GN=Smp_021950.1 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 1.431e-79
Identity = 117/190 (61.58%), Postives = 153/190 (80.53%), Query Frame = 3
Query:   90 SLSMICXDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQK 659
            +LS+IC DE LS+ Q K+Y+TRLQEY+ +LD+V+RLA C NVC+TEE V+IGE GLLTGE+LNALQHAG+ISVYN  QQ+NWE+P + EGE+A+V+ H P+ DEFLDSE+PIR DWP+VH+++CFV+ ++AKLHGS  PLR +LPPTI FRNAADVD+ + PEP  +      EG  EIV + +G+ V+K
Sbjct:   21 TLSLICDDESLSDAQLKAYQTRLQEYRTFLDAVSRLALCSNVCVTEEAVTIGEHGLLTGESLNALQHAGAISVYNTLQQNNWEFPISEEGEVAIVKAHVPIPDEFLDSEKPIRSDWPAVHISECFVEGERAKLHGSVRPLRTFLPPTIVFRNAADVDEDV-PEPEVNIINSGPEGSIEIVQSLKGLSVKK 209          
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: A0A183VR92 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS2998 PE=4 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.152e-78
Identity = 117/190 (61.58%), Postives = 152/190 (80.00%), Query Frame = 3
Query:   90 SLSMICXDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQK 659
            +LS+IC DEPLS+ Q K+Y+TRLQEY+ +LD+V+RLA C NVC+TEE V+IGE GLLTGE+LNALQHAG+ISVYN  QQ+NWE+P + EGE+A+V+ H P+ DEFLDSE+PIR DWP+VH+++CFV+ ++AKLHGS  PLR +LPPTI FRNAADVD+ +  EP  +      EG  EIV +  G+ V+K
Sbjct:   21 TLSLICDDEPLSDAQLKAYQTRLQEYRTFLDAVSRLALCGNVCVTEEAVTIGEHGLLTGESLNALQHAGAISVYNTLQQNNWEFPISEEGEVAIVKAHVPIPDEFLDSEKPIRSDWPAVHISECFVEGERAKLHGSVRPLRTFLPPTIVFRNAADVDEDV-AEPEVNIINSGPEGSIEIVQSSHGLSVKK 209          
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: A0A4E0R5K4 (Suppressor of hairy wing OS=Fasciola hepatica OX=6192 GN=D915_006654 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 3.505e-78
Identity = 115/193 (59.59%), Postives = 155/193 (80.31%), Query Frame = 3
Query:   90 SLSMICXDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPR---PSKQMLSQEGDFEIVSTEQGIMVQK 659
            +LS++C DEPLS+ Q K+Y+TRLQEY+ +LD+V+RLA C NVC+TEE V+IGE GLLTGE+LNALQHAG+ISVYN  QQ+NWE+    +GE+AV++ HNP+ DEFLDSE+PIR DWP++H+++CFVD ++AK+HGS  PLR +LPPT+ FRNAADVD+ I PEP    PS    + +G  E+V + +GI V++
Sbjct:   17 TLSLLCDDEPLSDAQLKAYQTRLQEYRTFLDAVSRLALCGNVCVTEEAVTIGEHGLLTGESLNALQHAGAISVYNTLQQNNWEFSIAEDGEVAVIKTHNPIPDEFLDSEKPIRSDWPAIHISECFVDGERAKIHGSVRPLRTFLPPTVVFRNAADVDEDI-PEPELNVPSTS--NNDGTVELVPSAKGITVKR 206          
BLAST of Pogo transposable element with ZNF domain vs. Planmine SMEST
Match: SMESG000014324.1 (SMESG000014324.1)

HSP 1 Score: 428.713 bits (1101), Expect = 7.686e-147
Identity = 203/207 (98.07%), Postives = 203/207 (98.07%), Query Frame = 3
Query:   45 MFYSRQXPXFAFPSISLSMICXDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQKYV 665
            MFYSRQ   FAFPSISLSMIC DEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQKYV
Sbjct:    1 MFYSRQDRNFAFPSISLSMICHDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQKYV 207          
BLAST of Pogo transposable element with ZNF domain vs. Planmine SMEST
Match: SMESG000014324.1 (SMESG000014324.1)

HSP 1 Score: 399.823 bits (1026), Expect = 1.076e-135
Identity = 188/189 (99.47%), Postives = 188/189 (99.47%), Query Frame = 3
Query:   99 MICXDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQKYV 665
            MIC DEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQKYV
Sbjct:    1 MICHDEPLSEVQFKSYKTRLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSISVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHLTKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQMLSQEGDFEIVSTEQGIMVQKYV 189          
The following BLAST results are available for this feature:
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Z3D3W25.724e-14898.12Factor for initiating regeneration 1 OS=Schmidtea ... [more]
A0A3P6QL598.299e-8060.21Uncharacterized protein OS=Dibothriocephalus latus... [more]
G4VE171.431e-7961.58Putative suppressor of hairy wing homolog OS=Schis... [more]
A0A183VR921.152e-7861.58Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A4E0R5K43.505e-7859.59Suppressor of hairy wing OS=Fasciola hepatica OX=6... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000014324.17.686e-14798.07SMESG000014324.1[more]
SMESG000014324.11.076e-13599.47SMESG000014324.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023910 ID=SMED30023910|Name=Pogo transposable element with ZNF domain|organism=Schmidtea mediterranea sexual|type=transcript|length=682bp
GGGGCTACGANCTATATAAATCTTATATGGATTTTGGAAGCTCTATGTTT
TATTCGCGACAAGANCCNNTTTTCGCTTTTCCAAGTATTTCATTGTCTAT
GATATGTCNCGATGAACCTCTTTCTGAAGTGCAATTTAAATCTTACAAGA
CTAGATTACAAGAATATAAAAATTATTTGGATAGCGTCAATCGTTTAGCG
AATTGCGTAAATGTTTGTATTACAGAAGAACCAGTTTCTATTGGTGAAAC
TGGACTACTCACAGGCGAAGCCCTAAATGCCCTTCAACATGCGGGATCGA
TTTCAGTTTATAATTTTTTTCAGCAACACAATTGGGAATATCCCTCAAAT
CCAGAAGGTGAAATGGCTGTTGTTAGACCTCACAATCCAGTTGCAGATGA
GTTCTTAGATTCTGAACAACCTATTAGACCAGACTGGCCATCAGTTCATT
TAACTAAATGTTTTGTTGATCAAGATAAAGCCAAACTCCATGGATCAGCT
TTACCTCTTCGAAATTATTTGCCTCCGACTATTTCATTTAGAAATGCAGC
TGATGTTGATGATGCAATTGAACCCGAACCAAGGCCATCTAAACAAATGC
TATCTCAAGAAGGTGATTTTGAAATTGTATCTACCGAACAGGGAATAATG
GTTCAGAAATATGTAAAAAAAAAAAAAAAAAA
back to top

protein sequence of SMED30023910-orf-1

>SMED30023910-orf-1 ID=SMED30023910-orf-1|Name=SMED30023910-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=226bp
GYXLYKSYMDFGSSMFYSRQXXXFAFPSISLSMICXDEPLSEVQFKSYKT
RLQEYKNYLDSVNRLANCVNVCITEEPVSIGETGLLTGEALNALQHAGSI
SVYNFFQQHNWEYPSNPEGEMAVVRPHNPVADEFLDSEQPIRPDWPSVHL
TKCFVDQDKAKLHGSALPLRNYLPPTISFRNAADVDDAIEPEPRPSKQML
SQEGDFEIVSTEQGIMVQKYVKKKKK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell