Cyclin-dependent kinase-like 1

Overview
NameCyclin-dependent kinase-like 1
Smed IDSMED30023903
Length (bp)1685
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclin-dependent kinase-like 1 (SMED30023903) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclin-dependent kinase-like 1 (SMED30023903) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclin-dependent kinase-like 1 (SMED30023903) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclin-dependent kinase-like 1 (SMED30023903) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023903

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023903SMESG000041875.1 SmedASXL_010029SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30023903SMESG000041875.1 dd_Smed_v6_9353_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30023903SMESG000041875.1 OX_Smed_1.0.04489ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023903SMESG000041875.1 dd_Smed_v4_9353_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Human
Match: CDKL4 (cyclin dependent kinase like 4 [Source:HGNC Symbol;Acc:HGNC:19287])

HSP 1 Score: 442.58 bits (1137), Expect = 4.459e-152
Identity = 207/335 (61.79%), Postives = 260/335 (77.61%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKI 1497
            M+KYEK+ + GEG+YGVV+KCRN+ +G++VA+KKF ESEDDPV+ KIA+REIR LKQLKH NLVNLIEVF+RKR++HLVF+Y DHTLLNELE+ PNG+    I  +  Q L A+ FCH HNCIHRD+KPENIL+TK G +K+CDFGFA+IL PGD YTDYVATRWYRAPELLVGDTQYG  VD+WAIGCVFAE+L GQPLWPG SD+DQ+YLII+TLG L+PR + IF++N FF GIS+PE +  E LE+KF+ + P+     ++FM+ C +M P DR TC QLL+  YFDSF + +      +R  R + +NRRR +  APK       +K+KI
Sbjct:    1 MEKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGIIKICDFGFAQILIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPV----ALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQ-----IKRKARNEGRNRRRQQQ-APKSAFPRLFLKTKI 325          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Human
Match: CDKL4 (cyclin dependent kinase like 4 [Source:HGNC Symbol;Acc:HGNC:19287])

HSP 1 Score: 439.499 bits (1129), Expect = 6.240e-152
Identity = 202/323 (62.54%), Postives = 255/323 (78.95%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAPK 1461
            M+KYEK+ + GEG+YGVV+KCRN+ +G++VA+KKF ESEDDPV+ KIA+REIR LKQLKH NLVNLIEVF+RKR++HLVF+Y DHTLLNELE+ PNG+    I  +  Q L A+ FCH HNCIHRD+KPENIL+TK G +K+CDFGFA+IL PGD YTDYVATRWYRAPELLVGDTQYG  VD+WAIGCVFAE+L GQPLWPG SD+DQ+YLII+TLG L+PR + IF++N FF GIS+PE +  E LE+KF+ + P+     ++FM+ C +M P DR TC QLL+  YFDSF + +      +R  R + +NRRR +++  K
Sbjct:    1 MEKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGIIKICDFGFAQILIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPV----ALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQ-----IKRKARNEGRNRRRQQVLPLK 314          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Human
Match: CDKL1 (cyclin dependent kinase like 1 [Source:HGNC Symbol;Acc:HGNC:1781])

HSP 1 Score: 428.328 bits (1100), Expect = 6.761e-147
Identity = 198/317 (62.46%), Postives = 249/317 (78.55%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 1440
            M+KYEKIG+IGEG+YGVV+KCRNR+TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKRRLHLVF+Y DHT+L+EL++   G+    +  IT Q L A+ FCH+HNCIHRDVKPENIL+TK   +KLCDFGFAR+L+ P D YTDYVATRWYR+PELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F  N +F G+ +P+ +  EPLE KF    P +S   +  ++ C  M+P  R TC+QLL H YF++  ++ED ++   +P R   +  R+
Sbjct:    2 MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKF----PNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRK 314          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Human
Match: CDKL1 (cyclin dependent kinase like 1 [Source:HGNC Symbol;Acc:HGNC:1781])

HSP 1 Score: 391.734 bits (1005), Expect = 1.068e-133
Identity = 180/256 (70.31%), Postives = 217/256 (84.77%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSI 1257
            M+KYEKIG+IGEG+YGVV+KCRNR+TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKRRLHLVF+Y DHT+L+EL++   G+    +  IT Q L A+ FCH+HNCIHRDVKPENIL+TK   +KLCDFGFAR+L+ P D YTDYVATRWYR+PELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F  N +F G+ +P+ +  EPLE KF +I
Sbjct:    2 MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNI 257          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Human
Match: CDKL2 (cyclin dependent kinase like 2 [Source:HGNC Symbol;Acc:HGNC:1782])

HSP 1 Score: 370.933 bits (951), Expect = 1.648e-122
Identity = 185/353 (52.41%), Postives = 246/353 (69.69%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARIL-SPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF--DSFP-----DLEDDSQATERPNRADK--QNRRRD-----------KLVAPKDRRVDPSVK 1488
            M+KYE +G +GEG+YG+V KCRN++TG +VAIKKF ES+DD ++ KIAMREI+ LKQL+HENLVNL+EV K+K+R +LVF+++DHT+L++LE  PNGLD + + K   Q++  I FCH HN IHRD+KPENILV++SG VKLCDFGFAR L +PG+ YTDYVATRWYRAPELLVGD +YG  VDVWAIGC+  EM  G+PL+PG SD+DQ+Y I+  LG+L+PR +E+F  N  F G+ LPE K +EPLE ++    P LS   I   +KC  ++P  R  C +LL H++F  D F      +L+   Q   R     K  QNR+++           K +  +D   DP +K
Sbjct:    1 MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEPLFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLERRY----PKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIK 349          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Celegans
Match: cdkl-1 (Cyclin-dependent kinase-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2H1])

HSP 1 Score: 401.749 bits (1031), Expect = 5.265e-135
Identity = 181/294 (61.56%), Postives = 234/294 (79.59%), Query Frame = 1
Query:  490 SMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSF 1371
            +MDKY+++ ++GEG+YGVVYKC+NR+TG++VAIKKF E+EDDP I KIA+REIR LKQLKH+NLV LIEVFKR R+LHLVF+  D T+L+ELE+ P+G++ E I KI  QLL A++FCH H CIHRDVKPENI +T++ QVKL DFGFARI++  + YTDYVATRWYR+PELLVGD QYGPPVD+WA+GCV+AE+L G+ LWPG SD+DQ+Y I KTLG+ LPR   IF+ N FF G+S+PE +  EPL  K     P  SS ++ F+QKCF+M P  R++C +L+ H  F ++
Sbjct:  131 AMDKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLVGLIEVFKRNRKLHLVFELCDRTVLHELEKNPHGVNDELIKKIIYQLLEALKFCHSHKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTEMYTDYVATRWYRSPELLVGDVQYGPPVDIWAVGCVYAELLTGEALWPGRSDIDQLYHIRKTLGEFLPRHISIFRTNQFFFGLSIPEPEHLEPLPSKL----PNASSAQLDFLQKCFEMSPDRRFSCSELMLHGIFSNW 420          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Celegans
Match: cdkl-1 (Cyclin-dependent kinase-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2H1])

HSP 1 Score: 397.897 bits (1021), Expect = 6.774e-135
Identity = 181/294 (61.56%), Postives = 234/294 (79.59%), Query Frame = 1
Query:  490 SMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSF 1371
            +MDKY+++ ++GEG+YGVVYKC+NR+TG++VAIKKF E+EDDP I KIA+REIR LKQLKH+NLV LIEVFKR R+LHLVF+  D T+L+ELE+ P+G++ E I KI  QLL A++FCH H CIHRDVKPENI +T++ QVKL DFGFARI++  + YTDYVATRWYR+PELLVGD QYGPPVD+WA+GCV+AE+L G+ LWPG SD+DQ+Y I KTLG+ LPR   IF+ N FF G+S+PE +  EPL  K     P  SS ++ F+QKCF+M P  R++C +L+ H  F ++
Sbjct:   30 AMDKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLVGLIEVFKRNRKLHLVFELCDRTVLHELEKNPHGVNDELIKKIIYQLLEALKFCHSHKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTEMYTDYVATRWYRSPELLVGDVQYGPPVDIWAVGCVYAELLTGEALWPGRSDIDQLYHIRKTLGEFLPRHISIFRTNQFFFGLSIPEPEHLEPLPSKL----PNASSAQLDFLQKCFEMSPDRRFSCSELMLHGIFSNW 319          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Celegans
Match: cdkl-1 (Cyclin-dependent kinase-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2H1])

HSP 1 Score: 396.356 bits (1017), Expect = 8.193e-135
Identity = 181/293 (61.77%), Postives = 233/293 (79.52%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSF 1371
            MDKY+++ ++GEG+YGVVYKC+NR+TG++VAIKKF E+EDDP I KIA+REIR LKQLKH+NLV LIEVFKR R+LHLVF+  D T+L+ELE+ P+G++ E I KI  QLL A++FCH H CIHRDVKPENI +T++ QVKL DFGFARI++  + YTDYVATRWYR+PELLVGD QYGPPVD+WA+GCV+AE+L G+ LWPG SD+DQ+Y I KTLG+ LPR   IF+ N FF G+S+PE +  EPL  K     P  SS ++ F+QKCF+M P  R++C +L+ H  F ++
Sbjct:    1 MDKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLVGLIEVFKRNRKLHLVFELCDRTVLHELEKNPHGVNDELIKKIIYQLLEALKFCHSHKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTEMYTDYVATRWYRSPELLVGDVQYGPPVDIWAVGCVYAELLTGEALWPGRSDIDQLYHIRKTLGEFLPRHISIFRTNQFFFGLSIPEPEHLEPLPSKL----PNASSAQLDFLQKCFEMSPDRRFSCSELMLHGIFSNW 289          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Celegans
Match: cdk-1 (Cyclin-dependent kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:P34556])

HSP 1 Score: 210.305 bits (534), Expect = 5.854e-63
Identity = 124/322 (38.51%), Postives = 181/322 (56.21%), Query Frame = 1
Query:  442 DSFRFGNQPNPSKSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQ--KPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGI-SLPESKTQEP------LEDKF---TSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDS 1368
            D  R G   +   S Y+++ + K+ +IGEG YGVVYK +NR T  +VA+KK     +D  +   A+REI  LK+L+H N+V L  V  ++ RL L+F+++   L   ++Q  K   L  E +   T Q+L A+ FCHQ   IHRD+KP+N+LV  +G +KL DFG AR +  P   YT  V T WYRAPE+L+G  +Y   VD+W+IGC+FAEM   +PL+ G S++D+++ I + LG   P   E       + G+ SLP+ K   P      L DKF    + + LL     S ++     +P  R    + L H YFD+
Sbjct:    2 DPIREGEVAHEGDSVYTLNDFTKLEKIGEGTYGVVYKGKNRRTNAMVAMKKIRLESEDEGVPSTAVREISLLKELQHPNVVGLEAVIMQENRLFLIFEFLSFDLKRYMDQLGKDEYLPLETLKSYTFQILQAMCFCHQRRVIHRDLKPQNLLVDNNGAIKLADFGLARAIGIPIRVYTHEVVTLWYRAPEILMGAQRYSMGVDMWSIGCIFAEMATKKPLFQGDSEIDELFRIFRVLGT--PTELE-------WNGVESLPDYKATFPKWRENFLRDKFYDKKTGKHLLDDTAFSLLEGLLIYDPSLRLNAKKALVHPYFDN 314          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Celegans
Match: cdk-1 (Cyclin-dependent kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:P34556])

HSP 1 Score: 210.305 bits (534), Expect = 5.854e-63
Identity = 124/322 (38.51%), Postives = 181/322 (56.21%), Query Frame = 1
Query:  442 DSFRFGNQPNPSKSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQ--KPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGI-SLPESKTQEP------LEDKF---TSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDS 1368
            D  R G   +   S Y+++ + K+ +IGEG YGVVYK +NR T  +VA+KK     +D  +   A+REI  LK+L+H N+V L  V  ++ RL L+F+++   L   ++Q  K   L  E +   T Q+L A+ FCHQ   IHRD+KP+N+LV  +G +KL DFG AR +  P   YT  V T WYRAPE+L+G  +Y   VD+W+IGC+FAEM   +PL+ G S++D+++ I + LG   P   E       + G+ SLP+ K   P      L DKF    + + LL     S ++     +P  R    + L H YFD+
Sbjct:    2 DPIREGEVAHEGDSVYTLNDFTKLEKIGEGTYGVVYKGKNRRTNAMVAMKKIRLESEDEGVPSTAVREISLLKELQHPNVVGLEAVIMQENRLFLIFEFLSFDLKRYMDQLGKDEYLPLETLKSYTFQILQAMCFCHQRRVIHRDLKPQNLLVDNNGAIKLADFGLARAIGIPIRVYTHEVVTLWYRAPEILMGAQRYSMGVDMWSIGCIFAEMATKKPLFQGDSEIDELFRIFRVLGT--PTELE-------WNGVESLPDYKATFPKWRENFLRDKFYDKKTGKHLLDDTAFSLLEGLLIYDPSLRLNAKKALVHPYFDN 314          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0343389)

HSP 1 Score: 414.461 bits (1064), Expect = 9.027e-141
Identity = 198/349 (56.73%), Postives = 252/349 (72.21%), Query Frame = 1
Query:  421 DNQINSKDSFRFGNQ----PNPSKSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVA 1455
            D     K  + FGN     P   + S  MD+YEK+ ++GEG+YGVVYKCR+RETG LVA+K+F ESEDDP I KIA+REIR LK LKH NLV+L+EVF+RKRRLHLVF++ + T+L+ELE+ P G       +I  Q LL + +CH+  C+HRD+KPENIL+T  GQVKLCDFGFAR+LSPG+ YTDYVATRWYRAPELLVGDTQYG PVDVWAIGC+FAE++RG+ LWPG SD+DQ+YLI KTLGDLLPR  +IF  N +F+GI+LP   T EPLEDK  + +   +   I F++KC   +P  R++C++L KH YFD   D     +  E  N  +  N R+ +L +
Sbjct:    2 DKWFGEKRLWLFGNHLPLLPRRPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPA-KSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFD---DYIAKQRELEHVNSLEAANLRQQQLAS 346          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0343388)

HSP 1 Score: 410.609 bits (1054), Expect = 1.991e-139
Identity = 192/326 (58.90%), Postives = 245/326 (75.15%), Query Frame = 1
Query:  478 KSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVA 1455
            + S  MD+YEK+ ++GEG+YGVVYKCR+RETG LVA+K+F ESEDDP I KIA+REIR LK LKH NLV+L+EVF+RKRRLHLVF++ + T+L+ELE+ P G       +I  Q LL + +CH+  C+HRD+KPENIL+T  GQVKLCDFGFAR+LSPG+ YTDYVATRWYRAPELLVGDTQYG PVDVWAIGC+FAE++RG+ LWPG SD+DQ+YLI KTLGDLLPR  +IF  N +F+GI+LP   T EPLEDK  + +   +   I F++KC   +P  R++C++L KH YFD   D     +  E  N  +  N R+ +L +
Sbjct:   16 QGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPA-KSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFD---DYIAKQRELEHVNSLEAANLRQQQLAS 337          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0302950)

HSP 1 Score: 410.994 bits (1055), Expect = 3.661e-139
Identity = 192/326 (58.90%), Postives = 245/326 (75.15%), Query Frame = 1
Query:  478 KSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVA 1455
            + S  MD+YEK+ ++GEG+YGVVYKCR+RETG LVA+K+F ESEDDP I KIA+REIR LK LKH NLV+L+EVF+RKRRLHLVF++ + T+L+ELE+ P G       +I  Q LL + +CH+  C+HRD+KPENIL+T  GQVKLCDFGFAR+LSPG+ YTDYVATRWYRAPELLVGDTQYG PVDVWAIGC+FAE++RG+ LWPG SD+DQ+YLI KTLGDLLPR  +IF  N +F+GI+LP   T EPLEDK  + +   +   I F++KC   +P  R++C++L KH YFD   D     +  E  N  +  N R+ +L +
Sbjct:   39 QGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPA-KSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFD---DYIAKQRELEHVNSLEAANLRQQQLAS 360          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0343387)

HSP 1 Score: 410.609 bits (1054), Expect = 4.413e-139
Identity = 192/326 (58.90%), Postives = 245/326 (75.15%), Query Frame = 1
Query:  478 KSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVA 1455
            + S  MD+YEK+ ++GEG+YGVVYKCR+RETG LVA+K+F ESEDDP I KIA+REIR LK LKH NLV+L+EVF+RKRRLHLVF++ + T+L+ELE+ P G       +I  Q LL + +CH+  C+HRD+KPENIL+T  GQVKLCDFGFAR+LSPG+ YTDYVATRWYRAPELLVGDTQYG PVDVWAIGC+FAE++RG+ LWPG SD+DQ+YLI KTLGDLLPR  +IF  N +F+GI+LP   T EPLEDK  + +   +   I F++KC   +P  R++C++L KH YFD   D     +  E  N  +  N R+ +L +
Sbjct:   42 QGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPA-KSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFD---DYIAKQRELEHVNSLEAANLRQQQLAS 363          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Fly
Match: Cdk1 (gene:FBgn0004106 transcript:FBtr0080051)

HSP 1 Score: 212.616 bits (540), Expect = 3.252e-64
Identity = 115/299 (38.46%), Postives = 175/299 (58.53%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKP--NGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGI-SLPESKTQEPL--EDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSF 1371
            M+ +EKI +IGEG YGVVYK RNR TG++VA+KK     DD  +   A+REI  LK+LKHEN+V L +V   + R++L+F+++   L   ++  P    ++ E +     Q+  AI FCH+   +HRD+KP+N+L+ KSG +K+ DFG  R    P   YT  + T WYRAPE+L+G  +Y  PVD+W+IGC+FAEM   +PL+ G S++DQ++ + + L                + G+ SLP+ K   P    ++ T+    L +  I  +QK    +P  R +   +L+H YF+ F
Sbjct:    1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKT---------PTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFNGF 290          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Zebrafish
Match: cdkl1 (cyclin-dependent kinase-like 1 (CDC2-related kinase) [Source:NCBI gene;Acc:445316])

HSP 1 Score: 424.091 bits (1089), Expect = 1.631e-145
Identity = 200/323 (61.92%), Postives = 253/323 (78.33%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAP 1458
            M+KYEKI +IGEG+YGVV+KCRN++TG++VAIKKF ESEDDP+I KIA+REIR LKQLKH NLVNL+EVF+RKR+LHLVF+Y DHT+LNEL++ P G+    +  I  Q L A+ FCH+ NCIHRDVKPENIL+TK   +KLCDFGFARIL+ P D YTDYVATRWYRAPELLVGDTQYGPPVDVWA+GCVFAE+L G PLWPG SD+DQ+YLI KTLG+L+PR +++F  N FF G+ +PE +  EPLE K+    P LS + +S M+ C +M+P +R +C+QLL+  YFDS   L ++S++  R     K+ R+  K + P
Sbjct:    1 MEKYEKISKIGEGSYGVVFKCRNKDTGQIVAIKKFVESEDDPIIKKIALREIRMLKQLKHPNLVNLMEVFRRKRKLHLVFEYCDHTVLNELDRYPRGVPEHMVKSIIWQTLQAVNFCHKQNCIHRDVKPENILITKHQVIKLCDFGFARILTGPCDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAVGCVFAELLSGAPLWPGKSDVDQLYLIRKTLGELIPRHQQVFSTNQFFSGVCVPEPQEMEPLELKY----PNLSYQALSLMKGCLRMDPAERLSCEQLLEQPYFDS---LREESESVTRELDRKKRTRQPRKHLPP 316          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Zebrafish
Match: cdkl5 (cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZDB-GENE-081022-110])

HSP 1 Score: 277.33 bits (708), Expect = 6.879e-82
Identity = 131/314 (41.72%), Postives = 205/314 (65.29%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDE--YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQ 1428
            M+K+E +G +GEGAYGVV KCR++ET ELVAIKKF +SE++  + +  +RE++ L+ LK +N+V L E F+R+ +L+LVF+Y++  +L  LE+ PNG   +++     QL+ AI +CH++  +HRD+KPEN+L++ +  +KLCDFGFAR LS G +  YT+YVATRWYR+PELL+G   YG  VD+W++GC+  E+  GQPL+PG S++DQ++ I K LG L P   ++F +N  F G+  P     + L+ ++  I   ++   +  M+    + P +R+  +Q L H  F      E  +  +  P R+ K+
Sbjct:   10 MNKFEVLGIVGEGAYGVVLKCRHKETKELVAIKKFKDSEENEEVKETTLRELKMLRTLKQDNIVELKEAFRRRGKLYLVFEYVEKNMLELLEELPNGALPDKVRSYIFQLIKAIHWCHKNEIVHRDIKPENLLISANDILKLCDFGFARNLSEGSDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPPEQMKLFYSNPRFAGLRFPSVSHPQTLDRRYLGI---INGLMLDLMKNLLCLNPTERFLTEQCLNHPVFQGLRGPEQPAVPSPTPPRSSKR 319          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Zebrafish
Match: cdkl5 (cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZDB-GENE-081022-110])

HSP 1 Score: 277.33 bits (708), Expect = 6.879e-82
Identity = 131/314 (41.72%), Postives = 205/314 (65.29%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDE--YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQ 1428
            M+K+E +G +GEGAYGVV KCR++ET ELVAIKKF +SE++  + +  +RE++ L+ LK +N+V L E F+R+ +L+LVF+Y++  +L  LE+ PNG   +++     QL+ AI +CH++  +HRD+KPEN+L++ +  +KLCDFGFAR LS G +  YT+YVATRWYR+PELL+G   YG  VD+W++GC+  E+  GQPL+PG S++DQ++ I K LG L P   ++F +N  F G+  P     + L+ ++  I   ++   +  M+    + P +R+  +Q L H  F      E  +  +  P R+ K+
Sbjct:   10 MNKFEVLGIVGEGAYGVVLKCRHKETKELVAIKKFKDSEENEEVKETTLRELKMLRTLKQDNIVELKEAFRRRGKLYLVFEYVEKNMLELLEELPNGALPDKVRSYIFQLIKAIHWCHKNEIVHRDIKPENLLISANDILKLCDFGFARNLSEGSDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPPEQMKLFYSNPRFAGLRFPSVSHPQTLDRRYLGI---INGLMLDLMKNLLCLNPTERFLTEQCLNHPVFQGLRGPEQPAVPSPTPPRSSKR 319          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Zebrafish
Match: cdkl5 (cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZDB-GENE-081022-110])

HSP 1 Score: 277.33 bits (708), Expect = 6.879e-82
Identity = 131/314 (41.72%), Postives = 205/314 (65.29%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDE--YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQ 1428
            M+K+E +G +GEGAYGVV KCR++ET ELVAIKKF +SE++  + +  +RE++ L+ LK +N+V L E F+R+ +L+LVF+Y++  +L  LE+ PNG   +++     QL+ AI +CH++  +HRD+KPEN+L++ +  +KLCDFGFAR LS G +  YT+YVATRWYR+PELL+G   YG  VD+W++GC+  E+  GQPL+PG S++DQ++ I K LG L P   ++F +N  F G+  P     + L+ ++  I   ++   +  M+    + P +R+  +Q L H  F      E  +  +  P R+ K+
Sbjct:   10 MNKFEVLGIVGEGAYGVVLKCRHKETKELVAIKKFKDSEENEEVKETTLRELKMLRTLKQDNIVELKEAFRRRGKLYLVFEYVEKNMLELLEELPNGALPDKVRSYIFQLIKAIHWCHKNEIVHRDIKPENLLISANDILKLCDFGFARNLSEGSDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPPEQMKLFYSNPRFAGLRFPSVSHPQTLDRRYLGI---INGLMLDLMKNLLCLNPTERFLTEQCLNHPVFQGLRGPEQPAVPSPTPPRSSKR 319          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Zebrafish
Match: cdkl5 (cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZDB-GENE-081022-110])

HSP 1 Score: 277.715 bits (709), Expect = 7.872e-82
Identity = 131/314 (41.72%), Postives = 205/314 (65.29%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDE--YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQ 1428
            M+K+E +G +GEGAYGVV KCR++ET ELVAIKKF +SE++  + +  +RE++ L+ LK +N+V L E F+R+ +L+LVF+Y++  +L  LE+ PNG   +++     QL+ AI +CH++  +HRD+KPEN+L++ +  +KLCDFGFAR LS G +  YT+YVATRWYR+PELL+G   YG  VD+W++GC+  E+  GQPL+PG S++DQ++ I K LG L P   ++F +N  F G+  P     + L+ ++  I   ++   +  M+    + P +R+  +Q L H  F      E  +  +  P R+ K+
Sbjct:   10 MNKFEVLGIVGEGAYGVVLKCRHKETKELVAIKKFKDSEENEEVKETTLRELKMLRTLKQDNIVELKEAFRRRGKLYLVFEYVEKNMLELLEELPNGALPDKVRSYIFQLIKAIHWCHKNEIVHRDIKPENLLISANDILKLCDFGFARNLSEGSDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPPEQMKLFYSNPRFAGLRFPSVSHPQTLDRRYLGI---INGLMLDLMKNLLCLNPTERFLTEQCLNHPVFQGLRGPEQPAVPSPTPPRSSKR 319          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Xenopus
Match: CDKL1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:100496578])

HSP 1 Score: 426.402 bits (1095), Expect = 4.013e-146
Identity = 202/321 (62.93%), Postives = 249/321 (77.57%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLV 1452
            M+KYEKIG+IGEG+YGVV+KCRNR+TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKR+LHLVF+Y DHT+L+EL++ P G+    +  IT Q L A+ FCH+H+CIHRDVKPENIL+T+   +KLCDFGFAR+L+ P D YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI K+ GDL+ R +++F  N FF G+S+P+ +  EPLE +F    P +SS+ +  M+ C  M+P  R  C QLL H YFDS  D  D    +ER +R  KQ R   K +
Sbjct:    1 MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRKLHLVFEYCDHTVLHELDKYPRGVPEHLVKSITWQTLQAVNFCHKHHCIHRDVKPENILITRHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGIPLWPGKSDVDQLYLIRKSQGDLIARHQQVFSTNQFFSGVSIPDPENMEPLELRF----PNISSQALGLMKGCLHMDPAKRLACQQLLDHPYFDSIRDEGDGVTDSERLSR--KQTRLHRKYI 315          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Xenopus
Match: CDKL1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:100496578])

HSP 1 Score: 409.838 bits (1052), Expect = 1.243e-139
Identity = 197/322 (61.18%), Postives = 243/322 (75.47%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFM-QKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLV 1452
            M+KYEKIG+IGEG+YGVV+KCRNR+TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKR+LHLVF+Y DHT+L+EL++ P G+    +  IT Q L A+ FCH+H+CIHRDVKPENIL+T+   +KLCDFGFAR+L+ P D YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI K+ GDL+ R +++F  N FF G+S+P+ +       K   +  L++   +S   Q C  M+P  R  C QLL H YFDS  D  D    +ER +R  KQ R   K +
Sbjct:    1 MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRKLHLVFEYCDHTVLHELDKYPRGVPEHLVKSITWQTLQAVNFCHKHHCIHRDVKPENILITRHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGIPLWPGKSDVDQLYLIRKSQGDLIARHQQVFSTNQFFSGVSIPDPENMLISIKKHPGLGILVTGFHLSLQSQGCLHMDPAKRLACQQLLDHPYFDSIRDEGDGVTDSERLSR--KQTRLHRKYI 320          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Xenopus
Match: vsx2 (visual system homeobox 2 [Source:Xenbase;Acc:XB-GENE-853775])

HSP 1 Score: 365.155 bits (936), Expect = 2.348e-119
Identity = 176/320 (55.00%), Postives = 230/320 (71.88%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF--DSFPDLEDDSQATERPNRADKQNRRRD 1443
            M+KYE +G +GEG+YG+V KCRN+E G +VA+KKF ESEDD ++ KIAMREI+ LKQL+HENLVNL+EV K+K+R +LVF+++D T+L++LEQ PNGLD  ++ K   Q++  I FCH HN IHRD+KPENILV+ SG VKLCDFGFAR L+ PG++YTDYVATRWYRAPELLVGD +YG  VDVWAIGC+  EML  QPL+PG SD+DQ++ I+K  G+L PR +E+F  N  F G SLP+ K  E LE ++  + P++    +   + C  ++P  R  C  LL HE F  DSF      S+   +  RA  QN  +D
Sbjct:    1 MEKYENLGLVGEGSYGMVMKCRNKENGRIVAVKKFLESEDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDRTVLDDLEQFPNGLDFSKVRKYLFQIIRGIGFCHSHNIIHRDIKPENILVSHSGIVKLCDFGFARTLAGPGEDYTDYVATRWYRAPELLVGDIKYGKAVDVWAIGCIVTEMLTAQPLFPGDSDIDQLHHIVKCQGNLTPRHQELFYRNPMFAGFSLPDMKEAESLEWRYPKLSPIM----LDLAKSCLHIDPDKRPACMTLLLHELFTKDSF------SERFSQEIRAKLQNLPKD 310          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Xenopus
Match: vldlr (very low density lipoprotein receptor [Source:Xenbase;Acc:XB-GENE-971958])

HSP 1 Score: 283.493 bits (724), Expect = 4.288e-84
Identity = 131/294 (44.56%), Postives = 200/294 (68.03%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGD--EYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDS 1368
            M+K+E +G +GEGAYGVV KCR++ET E+VAIKKF +SE++  + +  +RE++ L+ LK EN+V L E F+R+ +L+LVF+Y++  +L  LE+ PNG+  E++     QL+ AI +CH+++ +HRD+KPEN+L++ +  +KLCDFGFAR LS G    YT+YVATRWYR+PELL+G   YG  VD+W++GC+  E+  GQPL+PG S++DQ++ I K LG L     ++F +N  F G+  P     + LE ++  I   +SS  +  M+   ++ P DR+  +Q L H  F +
Sbjct:   10 MNKFEVLGVVGEGAYGVVLKCRHKETKEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVTNYIYQLIKAIHWCHKNDIVHRDIKPENLLISYNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYSNPRFHGMRFPAVNHPQSLERRYLGI---ISSVLLDLMKNLLKLNPSDRFLTEQSLNHPAFQT 299          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Xenopus
Match: vldlr (very low density lipoprotein receptor [Source:Xenbase;Acc:XB-GENE-971958])

HSP 1 Score: 256.914 bits (655), Expect = 1.112e-74
Identity = 124/294 (42.18%), Postives = 193/294 (65.65%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGD--EYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDS 1368
            M+K+E +G +GEG   +V+     ET E+VAIKKF +SE++  + +  +RE++ L+ LK EN+V L E F+R+ +L+LVF+Y++  +L  LE+ PNG+  E++     QL+ AI +CH+++ +HRD+KPEN+L++ +  +KLCDFGFAR LS G    YT+YVATRWYR+PELL+G   YG  VD+W++GC+  E+  GQPL+PG S++DQ++ I K LG L     ++F +N  F G+  P     + LE ++  I   +SS  +  M+   ++ P DR+  +Q L H  F +
Sbjct:   10 MNKFEVLGVVGEGK--LVFS----ETKEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVTNYIYQLIKAIHWCHKNDIVHRDIKPENLLISYNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYSNPRFHGMRFPAVNHPQSLERRYLGI---ISSVLLDLMKNLLKLNPSDRFLTEQSLNHPAFQT 293          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Mouse
Match: Cdkl4 (cyclin-dependent kinase-like 4 [Source:MGI Symbol;Acc:MGI:3587025])

HSP 1 Score: 439.113 bits (1128), Expect = 2.007e-151
Identity = 202/318 (63.52%), Postives = 255/318 (80.19%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDK 1446
            M+KYEK+ +IGEG+YGVV+KCRN+ +G++VAIKKF ESEDD V+ KIA+REIR LKQLKH NLVNLIEVF+RKR++HLVF+Y DHTLLNELE+ PNG+    I  +  Q L A+ FCH+HNCIHRDVKPENIL+TK G +K+CDFGFARIL PGD YTDYVATRWYRAPELLVGDT+YG  VDVWA+GCVFAE+L GQPLWPG SD+DQ+YLII+TLG L+PR + IF++N FFRGIS+PE +  E LE+KF++++P+     +SFM+ C +M P +R TC QLL   YF+SF +        +R  R++ ++RRR +
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIKSVLWQTLQALNFCHKHNCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKYGSSVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFRSNQFFRGISIPEPEDMETLEEKFSNVQPV----ALSFMKGCLKMNPDERLTCAQLLDSAYFESFQE-----DQMKRKARSEGRSRRRQQ 309          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Mouse
Match: Cdkl4 (cyclin-dependent kinase-like 4 [Source:MGI Symbol;Acc:MGI:3587025])

HSP 1 Score: 439.113 bits (1128), Expect = 2.007e-151
Identity = 202/318 (63.52%), Postives = 255/318 (80.19%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDK 1446
            M+KYEK+ +IGEG+YGVV+KCRN+ +G++VAIKKF ESEDD V+ KIA+REIR LKQLKH NLVNLIEVF+RKR++HLVF+Y DHTLLNELE+ PNG+    I  +  Q L A+ FCH+HNCIHRDVKPENIL+TK G +K+CDFGFARIL PGD YTDYVATRWYRAPELLVGDT+YG  VDVWA+GCVFAE+L GQPLWPG SD+DQ+YLII+TLG L+PR + IF++N FFRGIS+PE +  E LE+KF++++P+     +SFM+ C +M P +R TC QLL   YF+SF +        +R  R++ ++RRR +
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIKSVLWQTLQALNFCHKHNCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKYGSSVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFRSNQFFRGISIPEPEDMETLEEKFSNVQPV----ALSFMKGCLKMNPDERLTCAQLLDSAYFESFQE-----DQMKRKARSEGRSRRRQQ 309          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Mouse
Match: Cdkl4 (cyclin-dependent kinase-like 4 [Source:MGI Symbol;Acc:MGI:3587025])

HSP 1 Score: 439.113 bits (1128), Expect = 2.007e-151
Identity = 202/318 (63.52%), Postives = 255/318 (80.19%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDK 1446
            M+KYEK+ +IGEG+YGVV+KCRN+ +G++VAIKKF ESEDD V+ KIA+REIR LKQLKH NLVNLIEVF+RKR++HLVF+Y DHTLLNELE+ PNG+    I  +  Q L A+ FCH+HNCIHRDVKPENIL+TK G +K+CDFGFARIL PGD YTDYVATRWYRAPELLVGDT+YG  VDVWA+GCVFAE+L GQPLWPG SD+DQ+YLII+TLG L+PR + IF++N FFRGIS+PE +  E LE+KF++++P+     +SFM+ C +M P +R TC QLL   YF+SF +        +R  R++ ++RRR +
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIKSVLWQTLQALNFCHKHNCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKYGSSVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFRSNQFFRGISIPEPEDMETLEEKFSNVQPV----ALSFMKGCLKMNPDERLTCAQLLDSAYFESFQE-----DQMKRKARSEGRSRRRQQ 309          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Mouse
Match: Cdkl1 (cyclin-dependent kinase-like 1 (CDC2-related kinase) [Source:MGI Symbol;Acc:MGI:1918341])

HSP 1 Score: 427.172 bits (1097), Expect = 1.329e-146
Identity = 197/317 (62.15%), Postives = 252/317 (79.50%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 1440
            M+KYEKIG+IGEG+YGVV+KCRNR+TG++VAIK+F E+EDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKRRLHLVF+Y DHT+L+EL++   G+    +  IT Q L A+ FCH+HNCIHRDVKPENIL+TK   +KLCDFGFAR+L+ PGD YTDYVATRWYR+PELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F  N +F G+ +P+ +  E LE KF    P +S   + F++ C  M+P +R TC+QLL+H YFDS  ++ + ++  ++P R   +  R+
Sbjct:    1 MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKRFLETEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEPLVKNITWQTLQAVNFCHKHNCIHRDVKPENILITKQSAIKLCDFGFARLLTGPGDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSMNQYFSGVKIPDPEDMETLELKF----PNISYSALGFLKGCLHMDPAERLTCEQLLQHPYFDSIREVGELTRQHDKPARKTLRQSRK 313          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Mouse
Match: Cdkl2 (cyclin-dependent kinase-like 2 (CDC2-related kinase) [Source:MGI Symbol;Acc:MGI:1858227])

HSP 1 Score: 370.933 bits (951), Expect = 1.159e-121
Identity = 180/353 (50.99%), Postives = 247/353 (69.97%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARIL-SPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESK--TQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF--DSFPD---------LEDDSQATERPNRADKQNRRRD-------KLVAPKDRRVDPSVK 1488
            M+KYE +G +GEG+YG+V KCRN+++G +VAIKKF ES+DD ++ KIAMREI+ LKQL+HENLVNL+EV K+K+R +LVF+++DHT+L++L+  PNGLD + + K   Q++  I FCH HN IHRD+KPENILV++SG VKLCDFGFAR L +PG+ YTDYVATRWYRAPELLVGD +YG  VD+WAIGC+  EML GQPL+PG SD+DQ++ I+  LG+L+PR +E+F  N  F G+ LPE K    EPLE ++    P L    IS  +KC  ++P  R  C  LL+H++F  D F +         +E D++    P ++  + + +D       K +  +D   DP +K
Sbjct:    1 MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDIWAIGCLVIEMLMGQPLFPGESDIDQLHHIMTCLGNLIPRHQELFYKNPVFAGVRLPEVKDAEAEPLESRY----PKLPEAVISLAKKCLHIDPDKRPFCADLLRHDFFQMDGFAERFSQELQLKIEKDARNNSLPKKSQNRKKEKDDALGEERKTLVVQDTNADPKIK 349          
BLAST of Cyclin-dependent kinase-like 1 vs. UniProt/SwissProt
Match: sp|Q5MAI5|CDKL4_HUMAN (Cyclin-dependent kinase-like 4 OS=Homo sapiens OX=9606 GN=CDKL4 PE=2 SV=2)

HSP 1 Score: 442.58 bits (1137), Expect = 2.142e-151
Identity = 207/335 (61.79%), Postives = 260/335 (77.61%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKI 1497
            M+KYEK+ + GEG+YGVV+KCRN+ +G++VA+KKF ESEDDPV+ KIA+REIR LKQLKH NLVNLIEVF+RKR++HLVF+Y DHTLLNELE+ PNG+    I  +  Q L A+ FCH HNCIHRD+KPENIL+TK G +K+CDFGFA+IL PGD YTDYVATRWYRAPELLVGDTQYG  VD+WAIGCVFAE+L GQPLWPG SD+DQ+YLII+TLG L+PR + IF++N FF GIS+PE +  E LE+KF+ + P+     ++FM+ C +M P DR TC QLL+  YFDSF + +      +R  R + +NRRR +  APK       +K+KI
Sbjct:    1 MEKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGIIKICDFGFAQILIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPV----ALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQ-----IKRKARNEGRNRRRQQQ-APKSAFPRLFLKTKI 325          
BLAST of Cyclin-dependent kinase-like 1 vs. UniProt/SwissProt
Match: sp|Q3TZA2|CDKL4_MOUSE (Cyclin-dependent kinase-like 4 OS=Mus musculus OX=10090 GN=Cdkl4 PE=2 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 1.404e-150
Identity = 202/318 (63.52%), Postives = 255/318 (80.19%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDK 1446
            M+KYEK+ +IGEG+YGVV+KCRN+ +G++VAIKKF ESEDD V+ KIA+REIR LKQLKH NLVNLIEVF+RKR++HLVF+Y DHTLLNELE+ PNG+    I  +  Q L A+ FCH+HNCIHRDVKPENIL+TK G +K+CDFGFARIL PGD YTDYVATRWYRAPELLVGDT+YG  VDVWA+GCVFAE+L GQPLWPG SD+DQ+YLII+TLG L+PR + IF++N FFRGIS+PE +  E LE+KF++++P+     +SFM+ C +M P +R TC QLL   YF+SF +        +R  R++ ++RRR +
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIKSVLWQTLQALNFCHKHNCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKYGSSVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFRSNQFFRGISIPEPEDMETLEEKFSNVQPV----ALSFMKGCLKMNPDERLTCAQLLDSAYFESFQE-----DQMKRKARSEGRSRRRQQ 309          
BLAST of Cyclin-dependent kinase-like 1 vs. UniProt/SwissProt
Match: sp|Q00532|CDKL1_HUMAN (Cyclin-dependent kinase-like 1 OS=Homo sapiens OX=9606 GN=CDKL1 PE=1 SV=6)

HSP 1 Score: 428.328 bits (1100), Expect = 3.282e-146
Identity = 198/317 (62.46%), Postives = 249/317 (78.55%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 1440
            M+KYEKIG+IGEG+YGVV+KCRNR+TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKRRLHLVF+Y DHT+L+EL++   G+    +  IT Q L A+ FCH+HNCIHRDVKPENIL+TK   +KLCDFGFAR+L+ P D YTDYVATRWYR+PELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F  N +F G+ +P+ +  EPLE KF    P +S   +  ++ C  M+P  R TC+QLL H YF++  ++ED ++   +P R   +  R+
Sbjct:    2 MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKF----PNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRK 314          
BLAST of Cyclin-dependent kinase-like 1 vs. UniProt/SwissProt
Match: sp|Q8CEQ0|CDKL1_MOUSE (Cyclin-dependent kinase-like 1 OS=Mus musculus OX=10090 GN=Cdkl1 PE=2 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 9.297e-146
Identity = 197/317 (62.15%), Postives = 252/317 (79.50%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 1440
            M+KYEKIG+IGEG+YGVV+KCRNR+TG++VAIK+F E+EDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKRRLHLVF+Y DHT+L+EL++   G+    +  IT Q L A+ FCH+HNCIHRDVKPENIL+TK   +KLCDFGFAR+L+ PGD YTDYVATRWYR+PELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F  N +F G+ +P+ +  E LE KF    P +S   + F++ C  M+P +R TC+QLL+H YFDS  ++ + ++  ++P R   +  R+
Sbjct:    1 MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKRFLETEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEPLVKNITWQTLQAVNFCHKHNCIHRDVKPENILITKQSAIKLCDFGFARLLTGPGDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSMNQYFSGVKIPDPEDMETLELKF----PNISYSALGFLKGCLHMDPAERLTCEQLLQHPYFDSIREVGELTRQHDKPARKTLRQSRK 313          
BLAST of Cyclin-dependent kinase-like 1 vs. UniProt/SwissProt
Match: sp|Q66HE7|CDKL1_RAT (Cyclin-dependent kinase-like 1 OS=Rattus norvegicus OX=10116 GN=Cdkl1 PE=2 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 1.264e-144
Identity = 196/317 (61.83%), Postives = 251/317 (79.18%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 1440
            M+KYEKIG+IGEG+YGVV+KCRNR+TG++VAIK+F E+EDDPVI KIA+REIR LKQLKH NLV+L+EVF+RKRRLHLVF+Y  HT+L+EL++   G+    +  IT Q L A+ FCH+HNCIHRDVKPENIL+TK   +KLCDFGFAR+L+ PGD YTDYVATRWYR+PELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F  N +F G+ +P+ +  E LE KF    P +S   + F++ C  M+P +R TC+QLL+H YFDS  D+ + ++  ++P R   +  R+
Sbjct:    1 MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKRFLETEDDPVIKKIALREIRMLKQLKHPNLVSLLEVFRRKRRLHLVFEYCHHTVLHELDRYQRGVPEPLVKNITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTGPGDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSMNQYFSGVKIPDPEDMETLELKF----PNISYSALGFLKGCLHMDPAERLTCEQLLQHPYFDSIRDVGELARPHDKPTRKTLRQSRK 313          
BLAST of Cyclin-dependent kinase-like 1 vs. TrEMBL
Match: A0A267DKM9 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000280g4 PE=3 SV=1)

HSP 1 Score: 486.493 bits (1251), Expect = 1.269e-166
Identity = 238/343 (69.39%), Postives = 277/343 (80.76%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDS--FPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKIITGGV 1512
            MDKYEK+G+IGEGAYGVV+KCR R TGELVAIKKFTESE+DP+IHKIAMREIR LKQLKH+NLVNL+EVFKRK+RLHLVFQYIDHTLLNE+E KP G+DR +I KIT QLL AI FCH HNCIHRDVKPENILVT+  +VKLCDFGFAR+L+ PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEML+G PLWPG SDLDQ+YLIIKTLG+LLPR KEIFQ NSFFRG+ +PE + QE LE+KF  ++  LS+KE+ F+Q CF+M+P  R TC+ L + +YFD   + D+  D  A           RRR K +  K R   PS++   +T  +
Sbjct:    1 MDKYEKLGKIGEGAYGVVFKCRQRFTGELVAIKKFTESEEDPLIHKIAMREIRMLKQLKHDNLVNLLEVFKRKKRLHLVFQYIDHTLLNEMEAKPYGMDRGQIRKITYQLLDAISFCHSHNCIHRDVKPENILVTRDTKVKLCDFGFARLLTGPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLKGIPLWPGRSDLDQLYLIIKTLGELLPRHKEIFQENSFFRGLKIPEPENQESLEEKFQHMKEPLSTKELQFLQFCFKMDPVQRATCEDLKRFDYFDRSMYSDVYRDEDA----------GRRRMKALDMKQRAQWPSLQQNHMTNPI 333          
BLAST of Cyclin-dependent kinase-like 1 vs. TrEMBL
Match: A0A267E989 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000280g1 PE=3 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 2.166e-166
Identity = 237/343 (69.10%), Postives = 277/343 (80.76%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDS--FPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKIITGGV 1512
            MDKYEK+G+IGEGAYGVV+KCR R TGELVAIKKFTESE+DP+IHKIAMREIR LKQLKH+NLVNL+EVFKRK+RLHLVFQYIDHTLLNE+E KP G+DR +I KIT QLL AI FCH HNCIHRDVKPENIL+T+  +VKLCDFGFAR+L+ PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEML+G PLWPG SDLDQ+YLIIKTLG+LLPR KEIFQ NSFFRG+ +PE + QE LE+KF  ++  LS+KE+ F+Q CF+M+P  R TC+ L + +YFD   + D+  D  A           RRR K +  K R   PS++   +T  +
Sbjct:    1 MDKYEKLGKIGEGAYGVVFKCRQRFTGELVAIKKFTESEEDPLIHKIAMREIRMLKQLKHDNLVNLLEVFKRKKRLHLVFQYIDHTLLNEMEAKPYGMDRGQIRKITYQLLDAISFCHSHNCIHRDVKPENILITRDTKVKLCDFGFARLLTGPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLKGIPLWPGRSDLDQLYLIIKTLGELLPRHKEIFQENSFFRGLKIPEPENQESLEEKFQHMKEPLSTKELQFLQFCFKMDPVQRATCEDLKRFDYFDRSMYSDVYRDEDA----------GRRRMKALDMKQRAQWPSLQQNHMTNPI 333          
BLAST of Cyclin-dependent kinase-like 1 vs. TrEMBL
Match: A0A1I8J6Z4 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.267e-164
Identity = 228/330 (69.09%), Postives = 274/330 (83.03%), Query Frame = 1
Query:  463 QPNPSKSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKL 1449
            Q  PS+ S  M+KYEK+G+IGEGAYGVV+KCRNR+TG+LVAIKKFTESE+DP+IHKIAMREIR LKQLKH NLV L+EVFKRK+RLHLVF+YIDHTLLNE+E +PNG+DR +I +IT QLL A+ FCHQHNCIHRDVKPENIL+T++  VKLCDFGFAR+L+ PGDEYTDYVATRWYR+PELLVGDTQYGPPVDVWA+GCVFAEML+G PLWPG SDLDQ+YLIIK+LG LLPR +EIFQ NSFF+G+ +PE + QE LE+KF  +R  L+ KE+ FMQ CF+M+P  R TC+ L + +YFD  P  E+      R + A +  R R +L
Sbjct:   14 QRKPSRQSLLMNKYEKVGKIGEGAYGVVFKCRNRDTGDLVAIKKFTESEEDPLIHKIAMREIRMLKQLKHSNLVCLLEVFKRKKRLHLVFEYIDHTLLNEMEARPNGMDRHQIRRITHQLLDAVSFCHQHNCIHRDVKPENILITRNSTVKLCDFGFARLLTGPGDEYTDYVATRWYRSPELLVGDTQYGPPVDVWAVGCVFAEMLKGIPLWPGRSDLDQLYLIIKSLGQLLPRHREIFQQNSFFKGLKIPEPEHQESLEEKFAYMRHPLTPKELQFMQSCFKMDPVQRSTCEDLKRSDYFDR-PMFEETGG---RRSNAAQGGRHRAQL 339          
BLAST of Cyclin-dependent kinase-like 1 vs. TrEMBL
Match: A0A267DHU5 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023372g1 PE=3 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 7.565e-163
Identity = 218/297 (73.40%), Postives = 260/297 (87.54%), Query Frame = 1
Query:  478 KSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFD 1365
            + S  M+KYEK+G+IGEGAYGVV+KCRNR+TG+LVAIKKFTESE+DP+IHKIAMREIR LKQLKH NLV L+EVFKRK+RLHLVF+YIDHTLLNE+E +PNG+DR +I +IT QLL A+ FCHQHNCIHRDVKPENIL+T++  VKLCDFGFAR+L+ PGDEYTDYVATRWYR+PELLVGDTQYGPPVDVWA+GCVFAEML+G PLWPG SDLDQ+YLIIK+LG LLPR +EIFQ NSFF+G+ +PE + QE LE+KF  +R  L+ KE+ FMQ CF+M+P  R TC+ L + +YFD
Sbjct:    1 RQSLLMNKYEKVGKIGEGAYGVVFKCRNRDTGDLVAIKKFTESEEDPLIHKIAMREIRMLKQLKHSNLVCLLEVFKRKKRLHLVFEYIDHTLLNEMEARPNGMDRHQIRRITHQLLDAVSFCHQHNCIHRDVKPENILITRNSTVKLCDFGFARLLTGPGDEYTDYVATRWYRSPELLVGDTQYGPPVDVWAVGCVFAEMLKGIPLWPGRSDLDQLYLIIKSLGQLLPRHREIFQQNSFFKGLKIPEPEHQESLEEKFAYMRHPLTPKELQFMQSCFKMDPVQRSTCEDLKRSDYFD 297          
BLAST of Cyclin-dependent kinase-like 1 vs. TrEMBL
Match: A0A1I8J8C7 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 1.433e-162
Identity = 224/320 (70.00%), Postives = 269/320 (84.06%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKL 1449
            M+KYEK+G+IGEGAYGVV+KCRNR+TG+LVAIKKFTESE+DP+IHKIAMREIR LKQLKH NLV L+EVFKRK+RLHLVF+YIDHTLLNE+E +PNG+DR +I +IT QLL A+ FCHQHNCIHRDVKPENIL+T++  VKLCDFGFAR+L+ PGDEYTDYVATRWYR+PELLVGDTQYGPPVDVWA+GCVFAEML+G PLWPG SDLDQ+YLIIK+LG LLPR +EIFQ NSFF+G+ +PE + QE LE+KF  +R  L+ KE+ FMQ CF+M+P  R TC+ L + +YFD  P  E+      R + A +  R R +L
Sbjct:    1 MNKYEKVGKIGEGAYGVVFKCRNRDTGDLVAIKKFTESEEDPLIHKIAMREIRMLKQLKHSNLVCLLEVFKRKKRLHLVFEYIDHTLLNEMEARPNGMDRHQIRRITHQLLDAVSFCHQHNCIHRDVKPENILITRNSTVKLCDFGFARLLTGPGDEYTDYVATRWYRSPELLVGDTQYGPPVDVWAVGCVFAEMLKGIPLWPGRSDLDQLYLIIKSLGQLLPRHREIFQQNSFFKGLKIPEPEHQESLEEKFAYMRHPLTPKELQFMQSCFKMDPVQRSTCEDLKRSDYFDR-PMFEETGG---RRSNAAQGGRHRAQL 316          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Cavefish
Match: cdkl1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:103022052])

HSP 1 Score: 429.098 bits (1102), Expect = 1.490e-147
Identity = 200/293 (68.26%), Postives = 242/293 (82.59%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDS 1368
            M+KYEKIG+IGEG+YGVV+KCRN++TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNLIEVF+RKR+LHLVF+Y DHT+LNEL++ P G+    +  IT Q L A+ FCH+ NCIHRDVKPENIL+TK   +KLCDFGFARIL+ P D YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F NN FF G+ +PE +  EPLE K+    P +S + +S M+ C  M+P +R +C+QLL+H YFDS
Sbjct:    1 MEKYEKIGKIGEGSYGVVFKCRNKDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHCNLVNLIEVFRRKRKLHLVFEYCDHTVLNELDRYPRGVPEYLVKSITWQTLQAVNFCHKQNCIHRDVKPENILITKHQVIKLCDFGFARILTGPCDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGAPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSNNQFFSGVCVPEPQEMEPLEQKY----PNISYQALSLMKGCLCMDPAERLSCEQLLEHPYFDS 289          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Cavefish
Match: ENSAMXT00000057054.1 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:103024925])

HSP 1 Score: 415.616 bits (1067), Expect = 3.316e-142
Identity = 190/291 (65.29%), Postives = 239/291 (82.13%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            M+KYEK+ +IGEG+YGVV+KCRNR+TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKRRLHLVF++ + T+LNEL++ P G+   ++  I  Q L A+ FCH++NCIHRDVKPENIL+TK+G +KLCDFGFARIL+ PGD+YTDYVATRWYRAPELLVGDTQYGP VDVWA+GCVFAE+L G PLWPG SD+DQ+YLI +TLGDL+PR +++F++N FF G+S+PE  T EPLE +F    P      I+ M+ C  M+P  R +C++LL+  YF
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHVNLVNLLEVFRRKRRLHLVFEFCEQTVLNELDKHPKGVPEAQLKSIIWQTLQAVNFCHKNNCIHRDVKPENILLTKTGIIKLCDFGFARILTGPGDDYTDYVATRWYRAPELLVGDTQYGPAVDVWALGCVFAELLNGNPLWPGRSDVDQLYLIRRTLGDLIPRHQQVFRSNVFFSGVSIPEPDTMEPLEKRFHGASP----HAIAVMKSCLVMDPAGRLSCEELLELTYF 287          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Cavefish
Match: ENSAMXT00000052448.1 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:103024925])

HSP 1 Score: 415.616 bits (1067), Expect = 3.316e-142
Identity = 190/291 (65.29%), Postives = 239/291 (82.13%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            M+KYEK+ +IGEG+YGVV+KCRNR+TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKRRLHLVF++ + T+LNEL++ P G+   ++  I  Q L A+ FCH++NCIHRDVKPENIL+TK+G +KLCDFGFARIL+ PGD+YTDYVATRWYRAPELLVGDTQYGP VDVWA+GCVFAE+L G PLWPG SD+DQ+YLI +TLGDL+PR +++F++N FF G+S+PE  T EPLE +F    P      I+ M+ C  M+P  R +C++LL+  YF
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHVNLVNLLEVFRRKRRLHLVFEFCEQTVLNELDKHPKGVPEAQLKSIIWQTLQAVNFCHKNNCIHRDVKPENILLTKTGIIKLCDFGFARILTGPGDDYTDYVATRWYRAPELLVGDTQYGPAVDVWALGCVFAELLNGNPLWPGRSDVDQLYLIRRTLGDLIPRHQQVFRSNVFFSGVSIPEPDTMEPLEKRFHGASP----HAIAVMKSCLVMDPAGRLSCEELLELTYF 287          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Cavefish
Match: cdkl1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:103022052])

HSP 1 Score: 410.994 bits (1055), Expect = 1.346e-140
Identity = 192/293 (65.53%), Postives = 235/293 (80.20%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDS 1368
            M+KYEKIG+IGEG+YGVV+KCRN++TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNLIEVF+RKR+LHLVF+Y DHT+LNEL++ P G+    +  IT Q L A+ FCH+ NCIHRDVKPENIL+TK   +KLCDFGFARIL+ P D YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F NN FF G+ +PE +           +  L++  +   ++ C  M+P +R +C+QLL+H YFDS
Sbjct:    1 MEKYEKIGKIGEGSYGVVFKCRNKDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHCNLVNLIEVFRRKRKLHLVFEYCDHTVLNELDRYPRGVPEYLVKSITWQTLQAVNFCHKQNCIHRDVKPENILITKHQVIKLCDFGFARILTGPCDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGAPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSNNQFFSGVCVPEPQEM---------VSVLVALDKSGLLRGCLCMDPAERLSCEQLLEHPYFDS 284          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Cavefish
Match: ENSAMXT00000033332.1 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:103024925])

HSP 1 Score: 392.889 bits (1008), Expect = 1.445e-133
Identity = 184/291 (63.23%), Postives = 230/291 (79.04%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            M+KYEK+ +IGEG+YGVV+KCRNR+TG++VAIKKF ESEDDPVI KIA+REIR LKQLKH NLVNL+EVF+RKRRLHLVF++ + T+LNEL++ P G+   ++  I  Q L A+ FCH++NCIHRDVKPENIL+TK+G +KLCDFGFARIL+ PGD+YTDYVATRWYRAPELLVGDTQYGP VDVWA+GCVFAE+L G PLWPG SD+DQ+YLI +TLGDL+PR +++F++N FF G+S+PE  T E       S               C  M+P  R +C++LL+  YF
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHVNLVNLLEVFRRKRRLHLVFEFCEQTVLNELDKHPKGVPEAQLKSIIWQTLQAVNFCHKNNCIHRDVKPENILLTKTGIIKLCDFGFARILTGPGDDYTDYVATRWYRAPELLVGDTQYGPAVDVWALGCVFAELLNGNPLWPGRSDVDQLYLIRRTLGDLIPRHQQVFRSNVFFSGVSIPEPDTMETFMYCVCS---------------CLVMDPAGRLSCEELLELTYF 276          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003004.1 (pep scaffold:Pmarinus_7.0:GL476686:67050:81358:1 gene:ENSPMAG00000002741.1 transcript:ENSPMAT00000003004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 252.292 bits (643), Expect = 8.761e-80
Identity = 130/300 (43.33%), Postives = 190/300 (63.33%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELL--VGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF--DSFPD 1377
            M+KYE +G +GEG+YG+V KCR+R+TG++VAIKKF +SED   + KIA REI+ LKQL+HENLVNL+EVF+RKRRL+LVF+++DHT+L+ELE+ P GL   R+     Q+L A+ FC+ +N +HR   P N+ +        C F F      P   ++D     + ++P +   V   +    VDVWA+GCV  E+  G+P++PG SD+DQ+Y I+K  G+L+PR +E+F  N  F G+ +PE    EPLE +       L    +  +++C  M+   R  C +LL+H+YF  D F D
Sbjct:    1 MEKYENLGLVGEGSYGIVLKCRHRDTGQIVAIKKFLDSEDHKSVRKIAAREIKMLKQLRHENLVNLLEVFRRKRRLYLVFEFVDHTVLDELERYPRGLPTARVRPCLLQVLRAVGFCNSNNVVHRWTTPVNVFLRIVDPCYFCIFLFQEASQHPFKCHSDIRLNEYKQSPLMFACVCVCERYRAVDVWAVGCVAVEIQTGEPVFPGDSDIDQLYQIVKCFGNLMPRHRELFYKNPVFTGLKVPEVHAVEPLEKRLPR----LPPLLLDLIKQCLYMDADTRPPCSRLLQHDYFTADGFAD 296          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 218.779 bits (556), Expect = 3.673e-67
Identity = 119/298 (39.93%), Postives = 173/298 (58.05%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKF---TESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELE-QKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGIS-LPESKTQEP--LEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            MD ++K+ +IGEG YGVVYK RN+ TGE VA+KK    TE+E  P     A+REI  L++L H N+V L+ +   +++L+LVF+ +D  L   ++   P+G+    +     QLL  I FCH H  +HRD+KP+N+L+   G +KL DFG AR    P   YT  V T WYRAPE+L+G   Y   VDVW+IGC+FAEML  + L+PG S++DQ++ I +TLG           +   + G+S LP+ K+  P     + T + P L+ +    +    Q +P  R T +  L H +F
Sbjct:    1 MDNFQKVEKIGEGTYGVVYKARNKLTGEAVALKKIRLDTETEGVP---STAIREISLLRELNHPNIVRLLTIIHSEKKLYLVFELLDQDLKKFMDNATPSGIPLPLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLINAEGAIKLADFGLARAFGVPQRTYTHEVVTLWYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGT---------PDEVVWPGVSQLPDYKSTFPRWANQELTKVVPTLNFEGRDLLALMLQYDPNQRVTANMALSHCFF 286          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 214.927 bits (546), Expect = 9.956e-66
Identity = 116/301 (38.54%), Postives = 173/301 (57.48%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKF---TESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPN-GLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGIS-LPESKTQEP--LEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSF 1371
            MD ++K+ +IGEG YGVVYK R++ TG+ VA+KK    TE+E  P     A+REI  L++L H N+V L++V   + +L+LVF+++D  L   ++  P  G+    +     QLL  I FCH    +HRD+KP+N+L+   G +KL DFG AR    P   YT  V T WYRAPE+L+G   Y   VDVW++GC+FAEML  + L+PG S++DQ++ I +TLG           + + ++GI+ LP+ K   P       T + PLL +     + +  Q +P  R +    L H +F + 
Sbjct:    1 MDLFQKVEKIGEGTYGVVYKARHKMTGDTVALKKIRLDTETEGVP---STAIREIALLRELNHPNIVRLLDVIHSETKLYLVFEFLDQDLKKYMDNAPPLGISLPLVKSYMHQLLQGIAFCHAQRTLHRDLKPQNLLINADGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGT---------PDETVWQGITQLPDYKPSFPRWCAQDLTKVVPLLDAAGHDLLMQMLQYDPTRRVSAKAALNHHFFHNL 289          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Sea Lamprey
Match: mak (male germ cell-associated kinase [Source:ZFIN;Acc:ZDB-GENE-030131-7279])

HSP 1 Score: 199.519 bits (506), Expect = 1.221e-56
Identity = 106/293 (36.18%), Postives = 164/293 (55.97%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTE---SEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            M++Y  I Q+G+G YG V   R+ ETGELVAIKK      S D+     + +RE++SLK+L H N++ L EV +    L+ VF+Y+   L   ++ +        I  I  Q+L  + F H+H   HRD+KPEN+L      VK+ DFG AR +     YTDYV+TRWYR PE+L+  T Y  P+D+WA+GC+ AE+   +PL+PG S++DQI+ I + LG   P+  +  + +     ++    +  + +     ++ P  S++ I  M+     EP+ R    Q L++ YF
Sbjct:    1 MNRYTTIKQLGDGTYGSVLMGRSNETGELVAIKKMKRKFYSWDE----CMNLREVKSLKKLNHANVIKLKEVIRENDCLYFVFEYMKENLYQLMKDRNKLFPESMIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRGPEVLLRSTSYSSPIDIWALGCIMAELYTLRPLFPGSSEVDQIFKICQVLGT--PKKNDWPEGHQLAAAMNF---RWPQCVPTNLKTLIPNASNEAIHLMRDMLHWEPKKRPNAVQSLRYPYF 284          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Sea Lamprey
Match: cdk1 (cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GENE-010320-1])

HSP 1 Score: 189.119 bits (479), Expect = 4.301e-56
Identity = 104/285 (36.49%), Postives = 161/285 (56.49%), Query Frame = 1
Query:  529 GAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERIC----KITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEP--LEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            G+YGVVYK RN+ TG+LVA+KK     ++  +   A+REI  L++L+H N+V L +V  +  RL+L+F+Y+   L   L+  P G   E           Q+L A+ FCH    +HRD+KP+N+L+ + G +KL DFG AR    P   YT  V T WYRAPE+L+G  +Y  PVD+W++G + AEM+  +PL+ G S++DQ++ I + LG       E++ +      ++LP+ K   P  +     +  P L+   I  ++K    +P  R +  + L H YF
Sbjct:    1 GSYGVVYKGRNKGTGDLVALKKIRLEHEEEGVPATAIREIALLRELRHPNIVRLQDVLLQSARLYLIFEYLPMDLKRYLDAIPAGHCMEPPLIQGQSYLHQILQAVVFCHSRRVLHRDLKPQNLLIDRHGHIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEVLLGTPRYSTPVDMWSVGTILAEMVNKRPLFHGDSEIDQLFRIFRILGT---PTTEVWPDV-----VTLPDYKPSFPKWVPSGLVAHVPGLNQDGIDLLEKMLTYDPARRISAKRALTHPYF 277          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 190.66 bits (483), Expect = 1.343e-56
Identity = 106/310 (34.19%), Postives = 169/310 (54.52%), Query Frame = 1
Query:  490 SMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIK--KFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQK-----PNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGIS-LPESK---TQEPLEDKFTSIRPL----LSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSF 1371
            S  +++++ ++G G Y  VYK  N+ TG  VA+K  K    E  P     A+REI  +K+LKHEN+V L +V   + +L LVF+++D+ L   ++ +     P GL+   +     QLL  + FCH++  +HRD+KP+N+L+ K GQ+KL DFG AR    P + ++  V T WYRAP++L+G   Y   +D+W+ GC+ AEM+ G+PL+PG +D +Q+ LI   +G           N S +  ++ LP+      Q P  D    ++P     L    + F+    Q+ P  R +  Q L H +F  +
Sbjct:    3 SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTP---STAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGT---------PNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEY 300          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Yeast
Match: CDC28 (Cyclin-dependent kinase (CDK) catalytic subunit; master regulator of mitotic and meiotic cell cycles; alternately associates with G1, S, G2/M phase cyclins, which provide substrate specificity; regulates metabolism, basal transcription, chromosome dynamics, growth and morphogenesis; transcript induction in osmostress involves antisense RNA; human homologs CDK1, CDK2, CDK3 can complement yeast conditional cdc28 mutants; human CDK1, CDK2 can complement yeast cdc28 null mutant [Source:SGD;Acc:S000000364])

HSP 1 Score: 185.652 bits (470), Expect = 7.329e-55
Identity = 108/303 (35.64%), Postives = 165/303 (54.46%), Query Frame = 1
Query:  484 SYSMDKYEKIGQIGEGAYGVVYKCRNRETGE---LVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKR-KRRLHLVFQYIDHTLLNELEQKPNG--LDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGIS-LPESKTQEPLEDK--FTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            S  +  Y+++ ++GEG YGVVYK  +   G+   +VA+KK     +D  +   A+REI  LK+LK +N+V L ++      +L+LVF+++D  L   +E  P    L  + + K   QL   I +CH H  +HRD+KP+N+L+ K G +KL DFG AR    P   YT  + T WYRAPE+L+G  QY   VD W+IGC+FAEM   +P++ G S++DQI+ I + LG           N + +  I  LP+ K   P   +   + + P L  + I  + K    +P +R +  +   H YF
Sbjct:    2 SGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGT---------PNEAIWPDIVYLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYF 295          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Yeast
Match: KIN28 (Serine/threonine protein kinase, subunit of transcription factor TFIIH; involved in transcription initiation at RNA polymerase II promoters; phosphorylates Ser5 residue of the PolII C-terminal domain (CTD) at gene promoters; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002266])

HSP 1 Score: 175.252 bits (443), Expect = 8.732e-51
Identity = 100/306 (32.68%), Postives = 162/306 (52.94%), Query Frame = 1
Query:  499 KYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFAR-ILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSF--FRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATER 1407
            +Y K  ++GEG Y VVY      TG  +AIK+   SE    +   A+RE++ L++++H N++ LI++F     L+LV +++   L   ++ K        I       L  +  CH++  +HRD+KP N+L +  GQ+K+ DFG AR I +P +  T  V TRWYRAPELL G   Y   +D+W++G +FAE++   P  PG +D+DQ+ +  + LG   P  ++  + +SF  +  + +    +++ L  +F +     S   + FM     M PQ R+T  Q L+ +YF   P   D S    R
Sbjct:    6 EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGT--PTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAA----SEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPSSIKIR 305          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Yeast
Match: CTK1 (Catalytic (alpha) subunit of C-terminal domain kinase I (CTDK-I); phosphorylates both RNA pol II subunit Rpo21p to affect transcription and pre-mRNA 3' end processing, and ribosomal protein Rps2p to increase translational fidelity; required for H3K36 trimethylation but not dimethylation by Set2p; suggested stimulatory role in 80S formation during translation initiation; similar to the Drosophila dCDK12 and human CDK12 and probably CDK13 [Source:SGD;Acc:S000001622])

HSP 1 Score: 174.096 bits (440), Expect = 3.107e-48
Identity = 99/303 (32.67%), Postives = 160/303 (52.81%), Query Frame = 1
Query:  490 SMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFT---ESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVF-KRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGD-LLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLE 1383
            S   Y +I Q+GEG YG VYK +N  T +LVA+KK     E E  P+    ++REI+ L+   H N+  + E+  + ++ ++++F+Y D+ L   L  K   +   +   +  QLLL + + H +  +HRDVK  NIL+   G +K+ DFG AR ++   +YT+ V T WYR PELL+G T YG  VD+W  GC+  E+     ++ G ++L+QI  I K +G   +  +  ++    FF  +    +K      +KF S+ P  SSK +         +   R++  + L+ +YF   P  E
Sbjct:  179 STSVYLRIMQVGEGTYGKVYKAKNTNTEKLVALKKLRLQGEREGFPIT---SIREIKLLQSFDHPNVSTIKEIMVESQKTVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQLLLGMEYLHDNKILHRDVKGSNILIDNQGNLKITDFGLARKMNSRADYTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCLLVELFNKTAIFQGSNELEQIESIFKIMGTPTINSWPTLYDMPWFFMIMPQQTTKYVNNFSEKFKSVLP--SSKCLQLAINLLCYDQTKRFSATEALQSDYFKEEPKPE 476          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 171.014 bits (432), Expect = 5.878e-48
Identity = 99/307 (32.25%), Postives = 164/307 (53.42%), Query Frame = 1
Query:  496 DKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRR-LHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPR--FKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATER 1407
            ++Y  +  +G GA+G+V    +  T + VAIKK  +     V+ K   RE++ LK L+HENL+ L ++F      ++ V +     L   L+ +P  L+++ +     Q+L  +++ H    IHRD+KP NIL+ ++  +K+CDFG ARI  P  + T YV+TR+YRAPE+++   +Y   VD+W+ GC+FAEM+ G+PL+PG   + Q  +I   LG   P+     I   N+     SLP  +   P  ++F ++ P      +  ++K    +P+ R T    L H Y   + D  D+  A  +
Sbjct:   21 NRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRP--LEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDP--QMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGS-PPKDVINTICSENTLKFVTSLPH-RDPIPFSERFKTVEP----DAVDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDEPVADAK 317          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Nematostella
Match: EDO49500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB2])

HSP 1 Score: 432.18 bits (1110), Expect = 1.385e-149
Identity = 201/320 (62.81%), Postives = 253/320 (79.06%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS--PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDK 1446
            M+++EK+G+IGEG+YGVV+KCR++ETG++VAIKKF ESEDDP+I KIAMRE++ LKQLKH NLVNL+EVFKRKR+LHLVF+Y D T+LN L++ PNG++ + +  I  Q L A+ FCH HNCIHRDVKPENIL+TK+  +KLCDFGFAR++S  PG++YTDYVATRWYRAPELLVGDT YGPPVDVWAIGCVFAE+L GQPLWPG SD+DQ+YLI KTLG+L+PR  +IF  N FFRG+ +PE  T+EPLE K++ I    S+  +SFM+ C  MEP DR TC++LL H+YF    DL +     + P     QN +  K
Sbjct:    1 MERFEKLGKIGEGSYGVVFKCRHKETGQIVAIKKFVESEDDPLIKKIAMREVKMLKQLKHPNLVNLLEVFKRKRKLHLVFEYCDQTVLNVLDKHPNGVNEDTVKNIIYQTLKAVDFCHSHNCIHRDVKPENILITKNYIIKLCDFGFARLISRYPGEDYTDYVATRWYRAPELLVGDTAYGPPVDVWAIGCVFAELLVGQPLWPGRSDVDQLYLIKKTLGNLIPRHIQIFSQNHFFRGLQIPEPTTREPLEMKYSHI----STDALSFMKGCLVMEPNDRLTCEELLDHKYFKDSRDLFESELQEKIPKNQQSQNLKSKK 316          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Nematostella
Match: EDO35402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ0])

HSP 1 Score: 381.719 bits (979), Expect = 1.678e-129
Identity = 182/339 (53.69%), Postives = 251/339 (74.04%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSP--GDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF------DSFPD---LEDDSQATERP----------NRADKQNRRRDK 1446
            M+KYE +G +GEG+YG+V KCR++++ ++VAIKKF ESEDD ++ KIAMRE+R L+QL+HENLVNLIEVF+RK+RL LVF+++DHT+L++LE+ PNGLD   + K+  Q+L AI F H+HN IHRDVKPENILV++SG VKLCDFGFAR L+   G+ YTDYVATRWYRAPELLVGDT+YG  VDVWA+GC+ AEML G+PL+PG SD+DQ+Y I++  G+L+ R +EIFQ N  F G+ LP+ K  EP+E +F  I P+     +  ++ C +M+P +R TC QLL H++F      + FP+   L+   +A + P          + A+++ RR++K
Sbjct:    1 MEKYENLGLVGEGSYGMVMKCRHKDSNQIVAIKKFIESEDDKMVKKIAMREVRMLRQLRHENLVNLIEVFRRKKRLFLVFEFVDHTVLDDLERYPNGLDENTVRKVMWQVLRAIEFIHRHNIIHRDVKPENILVSRSGIVKLCDFGFARTLASGQGEAYTDYVATRWYRAPELLVGDTKYGRAVDVWAVGCLLAEMLTGEPLFPGDSDIDQLYHIMRCFGNLISRHREIFQKNPLFVGMRLPDIKEVEPMERRFPRISPM----AVDMLKLCLKMDPSERPTCAQLLNHDFFKKDNFIEKFPNELKLKITKEAADNPLLKSLSGSKHDDAEEKARRKEK 335          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Nematostella
Match: EDO41403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F0])

HSP 1 Score: 228.794 bits (582), Expect = 9.377e-71
Identity = 124/299 (41.47%), Postives = 179/299 (59.87%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKF---TESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELE-QKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGIS-LPESKTQEPLEDKFTSIR---PLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            M+ +EK+ +IGEG YGVVYK R++ TG +VA+KK    TESE  P     A+REI  LK+L H N+V+L++V   ++ L+LVF+++   L   ++   P+G+    I     QLL  + +CH H  +HRD+KP+N+L+ K+G +KL DFG AR    P   YT  V T WYRAPE+L+G   Y  PVDVW+IGC+FAEM   + L+PG S++DQ++ I +TLG           ++  + G+S LP+ KT  P +    SIR   P L +  I  +QK    +P  R +    L HE+F
Sbjct:    1 MENFEKVEKIGEGTYGVVYKARDKTTGRMVALKKIRLDTESEGVP---STAIREISLLKELNHPNVVSLLDVVHNQKSLYLVFEFLSQDLKKYMDCLPPSGISTSLIKSYVYQLLSGVAYCHSHRVLHRDLKPQNLLIDKNGAIKLADFGLARAFGVPVRSYTHEVVTLWYRAPEILLGSRYYATPVDVWSIGCIFAEMKTRRALFPGDSEIDQLFRIFRTLGT---------PDDKVWPGVSELPDYKTSFP-KWPVQSIRHVLPTLDNTAIDLLQKMLTYQPNARISAKAALSHEFF 286          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Nematostella
Match: EDO43671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXS1])

HSP 1 Score: 201.83 bits (512), Expect = 2.025e-60
Identity = 115/305 (37.70%), Postives = 168/305 (55.08%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHE-NLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGI-SLPESKTQEP--LEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDS 1392
            MD + KI +IGEG YGVVYK +N +TG   A+KK     +D  I   A+REI  LK+L+H  N+V L  +  ++ +L+LVF+Y+   L   L+     LD+  +     Q+  AI FCH    +HRD+KP+N+L+   G +KL DFG  R    P   YT  V T WYRAPE+L+G  +Y  P+DVW+IG +FAEM+  +PL+ G S++DQ++ I + LG               ++G+ SLP+ K   P    D      P L S  +  ++K    +P  R +    LKH YF + P  + +S
Sbjct:    1 MDDFSKIEKIGEGTYGVVYKAKNLKTGGFAALKKIRLEVEDEGIPSTAVREISLLKELRHHPNVVELQHILHQEPKLYLVFEYLTCDLKKHLDTTRGMLDKTLVKSYLYQITNAIYFCHARRILHRDLKPQNLLIDSKGLIKLADFGLGRAFGIPVRAYTHEVVTLWYRAPEVLLGGQRYSCPIDVWSIGTIFAEMVTKRPLFHGDSEIDQLFRIFRILGT---------PTEETWKGVTSLPDYKPTFPKWAGDGLKKAVPQLDSDGLDLLKKMLIYDPALRISAKTSLKHPYFLNDPKFDINS 296          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Nematostella
Match: EDO41147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S560])

HSP 1 Score: 201.06 bits (510), Expect = 3.440e-60
Identity = 109/293 (37.20%), Postives = 164/293 (55.97%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTE---SEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            M +Y+ I Q+G+G YG V   +N +TGE VAIKK  +   S D+     I +RE++SL++L H N+V L EV +    L+ VF+Y+   L   ++ +   L    I  +  Q+L  + F H+H   HRD+KPEN+L T    VK+ DFG AR       YTDYV+TRWYRAPE+L+  T Y  P+D+WA+GC+ AE+   +PL+PG S++D+I+ +   LG   P+  E  + +     ++    +T+        S+ P  S++ I  MQ+     P+ R T  Q L   YF
Sbjct:    1 MKRYQSIKQLGDGTYGSVELAKNIQTGETVAIKKMKKKYFSWDE----CINLREVKSLRKLSHTNIVKLKEVIRENDHLYFVFEYMKENLYQMMKNRDKLLPESVIRNVIYQILQGLAFIHKHGYFHRDMKPENLLCTGHELVKIADFGLARETRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAELYTLRPLFPGSSEVDEIFKVCSVLGP--PKPDEWPEGHKLASAMNFKFPQTK---ATSLHSLIPNASAEAIQLMQEMLFWNPKKRPTAAQALHFPYF 284          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Medaka
Match: cdkl1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:101159782])

HSP 1 Score: 426.402 bits (1095), Expect = 9.079e-146
Identity = 197/316 (62.34%), Postives = 247/316 (78.16%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRR 1437
            M+KYEKI +IGEG+YGVV+KCR+RETG++VAIKKF ES++DP+I KIA+REIR LKQLKH NLVNL+EVF+RKR+LHLVF+Y DHT+LNEL++ P G+    +  IT Q L A+ FCH+ NCIHRDVKPENIL+TK   +KLCDFGFARIL+ PGD YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F  N +F G+ +PE + +EPLE K+    P LS + +S ++ C +M+P +R +C QLL+H YF      E    +   P+R   +  R
Sbjct:   59 MEKYEKIAKIGEGSYGVVFKCRSRETGQIVAIKKFVESDEDPIIRKIALREIRMLKQLKHANLVNLMEVFRRKRKLHLVFEYCDHTVLNELDRHPRGVPEHLVKSITWQTLQAVNFCHKQNCIHRDVKPENILITKQQVIKLCDFGFARILTGPGDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGIPLWPGKSDMDQLYLIRKTLGDLIPRHQQVFSTNQYFCGLPVPEPQEREPLEQKY----PNLSQQTLSLLKSCLKMDPSERLSCQQLLQHPYFSCM--RERSQSSAPEPDRPGNKRAR 368          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Medaka
Match: cdkl1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:101159782])

HSP 1 Score: 426.017 bits (1094), Expect = 2.325e-145
Identity = 197/316 (62.34%), Postives = 247/316 (78.16%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRR 1437
            M+KYEKI +IGEG+YGVV+KCR+RETG++VAIKKF ES++DP+I KIA+REIR LKQLKH NLVNL+EVF+RKR+LHLVF+Y DHT+LNEL++ P G+    +  IT Q L A+ FCH+ NCIHRDVKPENIL+TK   +KLCDFGFARIL+ PGD YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+PR +++F  N +F G+ +PE + +EPLE K+    P LS + +S ++ C +M+P +R +C QLL+H YF      E    +   P+R   +  R
Sbjct:   59 MEKYEKIAKIGEGSYGVVFKCRSRETGQIVAIKKFVESDEDPIIRKIALREIRMLKQLKHANLVNLMEVFRRKRKLHLVFEYCDHTVLNELDRHPRGVPEHLVKSITWQTLQAVNFCHKQNCIHRDVKPENILITKQQVIKLCDFGFARILTGPGDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGIPLWPGKSDMDQLYLIRKTLGDLIPRHQQVFSTNQYFCGLPVPEPQEREPLEQKY----PNLSQQTLSLLKSCLKMDPSERLSCQQLLQHPYFSCM--RERSQSSAPEPDRPGNKRAR 368          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Medaka
Match: ENSORLT00000001547.2 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:101157382])

HSP 1 Score: 409.838 bits (1052), Expect = 5.228e-140
Identity = 188/291 (64.60%), Postives = 236/291 (81.10%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILS-PGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF 1362
            M+KYEK+ +IGEG+YGVV+KCRNR+TG++VAIKKF ESE+DPVI KIA+REIR LKQLKH NLVNL+EVF+RKRRLHLVF++ + T+LNEL++ P G+   ++  I  Q L A+ FCH+HNCIHRDVKPENIL+TK+G +KLCDFGFARIL+ P D+YTDYVATRWYRAPELLVGDTQYGPPVDVWA+GCVFAE+L G PLWPG SD+DQ+YLI KTLGDL+P  ++IF++N FF G+S+P+    EPLE +F    P    + +  M+ C  M+P  R +C +LL+  YF
Sbjct:    4 MEKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEEDPVIKKIALREIRMLKQLKHVNLVNLLEVFRRKRRLHLVFEFCEQTVLNELDRHPRGVPEAQLKSIVWQTLQAVNFCHKHNCIHRDVKPENILLTKTGVIKLCDFGFARILTGPEDDYTDYVATRWYRAPELLVGDTQYGPPVDVWALGCVFAELLDGNPLWPGKSDVDQLYLIRKTLGDLIPHHQQIFRSNVFFSGVSIPDPDATEPLEKRFQGASP----QALQVMKSCLVMDPSLRLSCQELLELPYF 290          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Medaka
Match: ENSORLT00000032275.1 (probable serine/threonine-protein kinase fhkE [Source:NCBI gene;Acc:101170219])

HSP 1 Score: 353.599 bits (906), Expect = 6.885e-111
Identity = 162/298 (54.36%), Postives = 218/298 (73.15%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDE---YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYF--DSF 1371
            M+++E +G +GEG+YG V KCR+RE+G LVAIKKF +S+DD  + KIA+REI+ L+QL+HENLVNL+EV+KR+RR +LVF+++D TLLN+LEQ P GL+ +   +   Q+L A  FCHQ N IHRD+KPENIL++  G VKLCDFGFAR ++   E   YTDYVATRWYRAPELLVGD +YG PVDVWA+GC+  EML  QPL+PG SDLDQI+ I++  G+L+ + +E+F  N  F G+ LPE      L+ +F    P + +  I+  QKC +M+P+ R  C +LL++  F  DSF
Sbjct:    1 MERFESLGPVGEGSYGTVLKCRHRESGRLVAIKKFIDSDDDKTVRKIALREIKLLRQLRHENLVNLLEVWKRRRRWYLVFEFVDRTLLNDLEQNPGGLNLDTARQYLYQILRATDFCHQQNVIHRDIKPENILISHMGVVKLCDFGFARTMTSPPESAVYTDYVATRWYRAPELLVGDFKYGKPVDVWAVGCLIIEMLTSQPLFPGESDLDQIHHIVRCFGNLMTQHQELFYRNPVFSGVKLPECSGSVSLQQRF----PTIPAAGINLAQKCLEMDPERRAQCSELLQNPLFTEDSF 294          
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Medaka
Match: CDKL5 (cyclin dependent kinase like 5 [Source:NCBI gene;Acc:101173854])

HSP 1 Score: 281.952 bits (720), Expect = 4.961e-84
Identity = 134/314 (42.68%), Postives = 206/314 (65.61%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDE--YTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQ 1428
            M+K+E +G +GEGAYGVV KCR+++T E+VAIKKF +SE++  + +  +RE++ L+ LK EN+V L E F+R+ +L+LVF+Y++  +L  LE+ P G+  E++     QL+ AI +CH+H+ +HRD+KPEN+L++ +  +KLCDFGFAR LS G +  YT+YVATRWYR+PELL+G   YG  VD+W++GC+  E+  GQPL+PG S+LDQ++ I K LG L P   ++F NN  F G+  P     + LE ++  I   +    +  ++    + P +R+  +Q L H  F +   +E     T  P R+ K+
Sbjct:   10 MNKFEVLGIVGEGAYGVVLKCRHKDTNEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEELPTGVPTEKVRSYIFQLIKAIHWCHKHDIVHRDIKPENLLISSADVLKLCDFGFARNLSEGTDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESELDQLFTIQKVLGPLPPEQMKLFYNNPRFHGLRFPAVNHPQTLERRYLGI---IGVGLLDLLKNLLLLNPTERFLTEQCLNHHTFQTLRLVERAGPPTPTPARSSKR 319          
BLAST of Cyclin-dependent kinase-like 1 vs. Planmine SMEST
Match: SMESG000041875.1 (SMESG000041875.1)

HSP 1 Score: 923.309 bits (2385), Expect = 0.000e+0
Identity = 472/473 (99.79%), Postives = 472/473 (99.79%), Query Frame = 1
Query:  229 MPQPWKYFFGSNNPHMVNKANNGNVGAMSSEPIQNNPISGVTGMGYMSQIQTQNYNSNQVKNSNDNQINSKDSFRFGNQPNPSKSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKIITGGVFGXXXXXXXXXXXXXXXXXXXXXXXXXYSKMGVYKPHKSTHFPNI 1647
            MPQPWKYFFGSNNPHMVNKANNGNVGAMSSEPIQNNPISGVTGMGYMSQIQTQNYNSNQVKNSNDNQINSKDSFRFGNQ NPSKSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKIITGGVFGHGLYPPYYLPLLNHNHNINPPSPAPYSKMGVYKPHKSTHFPNI
Sbjct:    1 MPQPWKYFFGSNNPHMVNKANNGNVGAMSSEPIQNNPISGVTGMGYMSQIQTQNYNSNQVKNSNDNQINSKDSFRFGNQTNPSKSSYSMDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKIITGGVFGHGLYPPYYLPLLNHNHNINPPSPAPYSKMGVYKPHKSTHFPNI 473          
BLAST of Cyclin-dependent kinase-like 1 vs. Planmine SMEST
Match: SMESG000041875.1 (SMESG000041875.1)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 385/385 (100.00%), Postives = 385/385 (100.00%), Query Frame = 1
Query:  493 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKIITGGVFGXXXXXXXXXXXXXXXXXXXXXXXXXYSKMGVYKPHKSTHFPNI 1647
            MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKIITGGVFGHGLYPPYYLPLLNHNHNINPPSPAPYSKMGVYKPHKSTHFPNI
Sbjct:    1 MDKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRRDKLVAPKDRRVDPSVKSKIITGGVFGHGLYPPYYLPLLNHNHNINPPSPAPYSKMGVYKPHKSTHFPNI 385          
BLAST of Cyclin-dependent kinase-like 1 vs. Planmine SMEST
Match: SMESG000038932.1 (SMESG000038932.1)

HSP 1 Score: 369.777 bits (948), Expect = 6.859e-124
Identity = 174/315 (55.24%), Postives = 227/315 (72.06%), Query Frame = 1
Query:  496 DKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 1440
            DKYE++ ++GEGAYG V+KCR ++TGELVAIK+F+E +    IH +A+REIR L+ L+H NLV+LIE+FKRK  +HLVFQYIDHTLL ELE KP  L++  +  I  Q++  I +CH+ N IHRD+KPENIL+T++ QVK+CDFGFAR L   + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAEM+R  PLWPG SDLDQ++LII TLG L    K+ F+ N +F G  +PE    +PLE+ F     ++S +EI  +  CF+M+P+ R TCD LLK  YF +    E   + +  P    + NR++
Sbjct:   10 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNSSESVLRYSNNPRWHCEANRKQ 324          
BLAST of Cyclin-dependent kinase-like 1 vs. Planmine SMEST
Match: SMESG000038932.1 (SMESG000038932.1)

HSP 1 Score: 370.163 bits (949), Expect = 9.009e-124
Identity = 174/315 (55.24%), Postives = 227/315 (72.06%), Query Frame = 1
Query:  496 DKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 1440
            DKYE++ ++GEGAYG V+KCR ++TGELVAIK+F+E +    IH +A+REIR L+ L+H NLV+LIE+FKRK  +HLVFQYIDHTLL ELE KP  L++  +  I  Q++  I +CH+ N IHRD+KPENIL+T++ QVK+CDFGFAR L   + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAEM+R  PLWPG SDLDQ++LII TLG L    K+ F+ N +F G  +PE    +PLE+ F     ++S +EI  +  CF+M+P+ R TCD LLK  YF +    E   + +  P    + NR++
Sbjct:   32 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNSSESVLRYSNNPRWHCEANRKQ 346          
BLAST of Cyclin-dependent kinase-like 1 vs. Planmine SMEST
Match: SMESG000038932.1 (SMESG000038932.1)

HSP 1 Score: 372.474 bits (955), Expect = 6.873e-121
Identity = 174/315 (55.24%), Postives = 227/315 (72.06%), Query Frame = 1
Query:  496 DKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 1440
            DKYE++ ++GEGAYG V+KCR ++TGELVAIK+F+E +    IH +A+REIR L+ L+H NLV+LIE+FKRK  +HLVFQYIDHTLL ELE KP  L++  +  I  Q++  I +CH+ N IHRD+KPENIL+T++ QVK+CDFGFAR L   + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAEM+R  PLWPG SDLDQ++LII TLG L    K+ F+ N +F G  +PE    +PLE+ F     ++S +EI  +  CF+M+P+ R TCD LLK  YF +    E   + +  P    + NR++
Sbjct:  312 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNSSESVLRYSNNPRWHCEANRKQ 626          
The following BLAST results are available for this feature:
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDKL44.459e-15261.79cyclin dependent kinase like 4 [Source:HGNC Symbol... [more]
CDKL46.240e-15262.54cyclin dependent kinase like 4 [Source:HGNC Symbol... [more]
CDKL16.761e-14762.46cyclin dependent kinase like 1 [Source:HGNC Symbol... [more]
CDKL11.068e-13370.31cyclin dependent kinase like 1 [Source:HGNC Symbol... [more]
CDKL21.648e-12252.41cyclin dependent kinase like 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkl-15.265e-13561.56Cyclin-dependent kinase-like 1 [Source:UniProtKB/... [more]
cdkl-16.774e-13561.56Cyclin-dependent kinase-like 1 [Source:UniProtKB/... [more]
cdkl-18.193e-13561.77Cyclin-dependent kinase-like 1 [Source:UniProtKB/... [more]
cdk-15.854e-6338.51Cyclin-dependent kinase 1 [Source:UniProtKB/Swiss... [more]
cdk-15.854e-6338.51Cyclin-dependent kinase 1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG72369.027e-14156.73gene:FBgn0031730 transcript:FBtr0343389[more]
CG72361.991e-13958.90gene:FBgn0031730 transcript:FBtr0343388[more]
CG72363.661e-13958.90gene:FBgn0031730 transcript:FBtr0302950[more]
CG72364.413e-13958.90gene:FBgn0031730 transcript:FBtr0343387[more]
Cdk13.252e-6438.46gene:FBgn0004106 transcript:FBtr0080051[more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkl11.631e-14561.92cyclin-dependent kinase-like 1 (CDC2-related kinas... [more]
cdkl56.879e-8241.72cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZD... [more]
cdkl56.879e-8241.72cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZD... [more]
cdkl56.879e-8241.72cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZD... [more]
cdkl57.872e-8241.72cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDKL14.013e-14662.93cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
CDKL11.243e-13961.18cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
vsx22.348e-11955.00visual system homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
vldlr4.288e-8444.56very low density lipoprotein receptor [Source:Xenb... [more]
vldlr1.112e-7442.18very low density lipoprotein receptor [Source:Xenb... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdkl42.007e-15163.52cyclin-dependent kinase-like 4 [Source:MGI Symbol;... [more]
Cdkl42.007e-15163.52cyclin-dependent kinase-like 4 [Source:MGI Symbol;... [more]
Cdkl42.007e-15163.52cyclin-dependent kinase-like 4 [Source:MGI Symbol;... [more]
Cdkl11.329e-14662.15cyclin-dependent kinase-like 1 (CDC2-related kinas... [more]
Cdkl21.159e-12150.99cyclin-dependent kinase-like 2 (CDC2-related kinas... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5MAI5|CDKL4_HUMAN2.142e-15161.79Cyclin-dependent kinase-like 4 OS=Homo sapiens OX=... [more]
sp|Q3TZA2|CDKL4_MOUSE1.404e-15063.52Cyclin-dependent kinase-like 4 OS=Mus musculus OX=... [more]
sp|Q00532|CDKL1_HUMAN3.282e-14662.46Cyclin-dependent kinase-like 1 OS=Homo sapiens OX=... [more]
sp|Q8CEQ0|CDKL1_MOUSE9.297e-14662.15Cyclin-dependent kinase-like 1 OS=Mus musculus OX=... [more]
sp|Q66HE7|CDKL1_RAT1.264e-14461.83Cyclin-dependent kinase-like 1 OS=Rattus norvegicu... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DKM91.269e-16669.39Protein kinase domain-containing protein OS=Macros... [more]
A0A267E9892.166e-16669.10Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8J6Z41.267e-16469.09Protein kinase domain-containing protein OS=Macros... [more]
A0A267DHU57.565e-16373.40Protein kinase domain-containing protein (Fragment... [more]
A0A1I8J8C71.433e-16270.00Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkl11.490e-14768.26cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
ENSAMXT00000057054.13.316e-14265.29cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
ENSAMXT00000052448.13.316e-14265.29cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
cdkl11.346e-14065.53cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
ENSAMXT00000033332.11.445e-13363.23cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003004.18.761e-8043.33pep scaffold:Pmarinus_7.0:GL476686:67050:81358:1 g... [more]
cdk23.673e-6739.93cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk29.956e-6638.54cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
mak1.221e-5636.18male germ cell-associated kinase [Source:ZFIN;Acc:... [more]
cdk14.301e-5636.49cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PHO851.343e-5634.19Cyclin-dependent kinase; has ten cyclin partners; ... [more]
CDC287.329e-5535.64Cyclin-dependent kinase (CDK) catalytic subunit; m... [more]
KIN288.732e-5132.68Serine/threonine protein kinase, subunit of transc... [more]
CTK13.107e-4832.67Catalytic (alpha) subunit of C-terminal domain kin... [more]
HOG15.878e-4832.25Mitogen-activated protein kinase involved in osmor... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495001.385e-14962.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354021.678e-12953.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414039.377e-7141.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436712.025e-6037.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411473.440e-6037.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkl19.079e-14662.34cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
cdkl12.325e-14562.34cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
ENSORLT00000001547.25.228e-14064.60cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
ENSORLT00000032275.16.885e-11154.36probable serine/threonine-protein kinase fhkE [Sou... [more]
CDKL54.961e-8442.68cyclin dependent kinase like 5 [Source:NCBI gene;A... [more]
back to top
BLAST of Cyclin-dependent kinase-like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041875.10.000e+099.79SMESG000041875.1[more]
SMESG000041875.10.000e+0100.00SMESG000041875.1[more]
SMESG000038932.16.859e-12455.24SMESG000038932.1[more]
SMESG000038932.19.009e-12455.24SMESG000038932.1[more]
SMESG000038932.16.873e-12155.24SMESG000038932.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023903 ID=SMED30023903|Name=Cyclin-dependent kinase-like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1685bp
TCAATAAATACTGTTCAGCTATTCGAATGCACTATGACTCAATATTTACT
TTTTATTTCACTGTCAAAATAGTCTGATAGTTTTTTGCCGTGTAATTATT
TGTTCTTGGTTGCTTGGAAACTTAGCAATACAATTTAATATCAATTGCTC
AGTATTTTTTTCATCTAATTTCTGTGGAATGTTTTATCGATAATTAGTTG
AGTACGAATCCTCCGTGTCTCACTCAACATGCCTCAACCATGGAAATACT
TTTTCGGTTCAAATAATCCTCATATGGTTAATAAAGCCAACAATGGAAAT
GTTGGTGCTATGTCCAGTGAACCGATTCAAAACAATCCTATTTCCGGCGT
CACGGGTATGGGTTACATGAGCCAAATTCAAACCCAAAATTACAATAGTA
ATCAAGTGAAAAATTCGAATGACAATCAAATTAACTCCAAAGACTCTTTT
CGATTTGGTAATCAGCCTAATCCTAGTAAGAGCTCATATTCCATGGATAA
ATATGAGAAAATTGGCCAAATCGGAGAAGGAGCTTATGGAGTCGTGTACA
AGTGCCGCAATAGAGAAACCGGAGAATTGGTTGCAATTAAAAAGTTCACA
GAATCTGAAGACGACCCAGTTATTCATAAAATTGCAATGCGTGAAATTCG
TTCTTTAAAACAACTGAAACATGAAAATTTGGTCAATCTAATAGAAGTGT
TCAAAAGGAAACGGCGACTTCATCTTGTATTTCAATACATTGATCATACA
TTGTTAAATGAACTTGAACAAAAGCCAAACGGATTAGATCGAGAGCGGAT
TTGCAAGATCACGAGTCAGTTACTGCTAGCCATCAGATTTTGTCATCAGC
ACAATTGCATTCATCGAGATGTAAAGCCAGAAAATATTTTGGTTACTAAA
TCGGGGCAAGTTAAGCTTTGTGATTTCGGATTCGCTCGAATATTGAGTCC
AGGCGATGAATACACTGATTATGTAGCTACAAGATGGTACAGGGCTCCAG
AACTTTTGGTAGGTGATACTCAATACGGTCCCCCAGTAGACGTTTGGGCT
ATTGGTTGCGTTTTTGCTGAAATGCTTAGAGGTCAGCCACTTTGGCCAGG
AATGTCAGATTTAGATCAGATATACCTAATTATCAAAACCCTTGGTGATT
TGTTACCGAGATTTAAAGAAATATTTCAAAACAATTCTTTTTTCCGGGGT
ATCAGTTTACCGGAATCAAAAACTCAGGAGCCCCTCGAAGATAAATTTAC
ATCAATTCGACCTCTTTTGTCTTCAAAAGAAATCAGTTTCATGCAGAAAT
GCTTTCAAATGGAACCACAGGATCGATACACGTGCGATCAGCTGTTAAAA
CATGAATACTTTGATTCTTTTCCGGATTTGGAAGATGACTCACAGGCTAC
GGAGCGACCGAATAGAGCCGATAAACAAAATCGTCGGAGAGATAAATTAG
TAGCTCCAAAAGACAGACGAGTTGATCCGTCAGTCAAATCAAAAATAATT
ACAGGAGGTGTCTTTGGGCACGGTCTTTACCCGCCGTATTATTTGCCACT
ACTGAATCATAATCACAACATTAATCCTCCATCTCCAGCTCCCTATTCAA
AAATGGGGGTTTATAAACCTCATAAATCTACACATTTTCCTAATATTTAA
TTTGTAACAATTTATTTTTATTATTATTATTATTA
back to top

protein sequence of SMED30023903-orf-1

>SMED30023903-orf-1 ID=SMED30023903-orf-1|Name=SMED30023903-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MPQPWKYFFGSNNPHMVNKANNGNVGAMSSEPIQNNPISGVTGMGYMSQI
QTQNYNSNQVKNSNDNQINSKDSFRFGNQPNPSKSSYSMDKYEKIGQIGE
GAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHEN
LVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLL
AIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVA
TRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYL
IIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSK
EISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQ
NRRRDKLVAPKDRRVDPSVKSKIITGGVFGHGLYPPYYLPLLNHNHNINP
PSPAPYSKMGVYKPHKSTHFPNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 92..378
e-value: 1.5E-99
score: 346.7
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 92..378
e-value: 5.2E-78
score: 262.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 92..378
score: 46.576
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 335..424
e-value: 7.5
score: 2.1
coord: 107..306
e-value: 2.6E-13
score: 46.6
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 173..381
e-value: 5.7E-67
score: 227.3
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 88..172
e-value: 7.0E-34
score: 117.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 384..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 68..88
NoneNo IPR availablePANTHERPTHR24056CELL DIVISION PROTEIN KINASEcoord: 91..407
NoneNo IPR availablePANTHERPTHR24056:SF120CYCLIN-DEPENDENT KINASE-LIKE 4coord: 91..407
NoneNo IPR availableCDDcd07847STKc_CDKL1_4coord: 90..378
e-value: 0.0
score: 578.557
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 210..222
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 98..122
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 87..383