Glycine cleavage system H protein

Overview
NameGlycine cleavage system H protein
Smed IDSMED30023887
Length (bp)553
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine cleavage system H protein (SMED30023887) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine cleavage system H protein (SMED30023887) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine cleavage system H protein (SMED30023887) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine cleavage system H protein (SMED30023887) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023887

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30023887SMESG000044612.1 SMESG000044611.1 dd_Smed_v4_1939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine cleavage system H protein vs. Ensembl Human
Match: GCSH (glycine cleavage system protein H [Source:HGNC Symbol;Acc:HGNC:4208])

HSP 1 Score: 147.517 bits (371), Expect = 8.259e-45
Identity = 66/132 (50.00%), Postives = 96/132 (72.73%), Query Frame = 3
Query:   51 LRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            +R +R     +    FT+KH+W+  EN IGTVGIS++AQE LGD+VY  LPEVG+++++ DE G +ESVKAASE++SP+SG + E+N+ L    GL+NK  Y+DGW+ K++L  P EL  LM E+AY K+++
Sbjct:   38 VRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIK 169          
BLAST of Glycine cleavage system H protein vs. Ensembl Human
Match: AC092718.3 (novel protein)

HSP 1 Score: 121.709 bits (304), Expect = 1.088e-34
Identity = 53/93 (56.99%), Postives = 74/93 (79.57%), Query Frame = 3
Query:   96 FTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVF 374
            FT+KH+W+  EN IGTVGIS++AQE LGD+VY  LPEVG+++++ DE G +ESVKAASE++SP+SG + E+N+ L    GL+NK  Y+DG+V 
Sbjct:   53 FTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGFVL 145          
BLAST of Glycine cleavage system H protein vs. Ensembl Human
Match: GCSH (glycine cleavage system protein H [Source:HGNC Symbol;Acc:HGNC:4208])

HSP 1 Score: 120.168 bits (300), Expect = 2.471e-34
Identity = 54/105 (51.43%), Postives = 77/105 (73.33%), Query Frame = 3
Query:   51 LRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDG 365
            +R +R     +    FT+KH+W+  EN IGTVGIS++AQE LGD+VY  LPEVG+++++ DE G +ESVKAASE++SP+SG + E+N+ L    GL+NK  Y+DG
Sbjct:   38 VRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDG 142          
BLAST of Glycine cleavage system H protein vs. Ensembl Human
Match: AC092718.3 (novel protein)

HSP 1 Score: 119.783 bits (299), Expect = 2.599e-34
Identity = 54/105 (51.43%), Postives = 77/105 (73.33%), Query Frame = 3
Query:   51 LRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDG 365
            +R +R     +    FT+KH+W+  EN IGTVGIS++AQE LGD+VY  LPEVG+++++ DE G +ESVKAASE++SP+SG + E+N+ L    GL+NK  Y+DG
Sbjct:   38 VRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDG 142          
BLAST of Glycine cleavage system H protein vs. Ensembl Human
Match: GCSH (glycine cleavage system protein H [Source:HGNC Symbol;Acc:HGNC:4208])

HSP 1 Score: 117.087 bits (292), Expect = 9.009e-34
Identity = 51/89 (57.30%), Postives = 71/89 (79.78%), Query Frame = 3
Query:   96 FTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKD 362
            FT+KH+W+  EN IGTVGIS++AQE LGD+VY  LPEVG+++++ DE G +ESVKAASE++SP+SG + E+N+ L    GL+NK  Y+D
Sbjct:   15 FTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYED 103          
BLAST of Glycine cleavage system H protein vs. Ensembl Celegans
Match: gcsh-2 (Glycine cleavage system H protein [Source:UniProtKB/TrEMBL;Acc:Q20634])

HSP 1 Score: 143.28 bits (360), Expect = 5.173e-44
Identity = 60/121 (49.59%), Postives = 97/121 (80.17%), Query Frame = 3
Query:   93 LFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLEEDQ 455
            L+T KH+W+ VEN +GTVGI+D+A E+LGD+V+++LP+ G+EIS+ D  G VESVKAAS+I++P+SG++ + N +LE E+GLINK P++ GW++K+ +    EL+ L++E+ Y KF ++++
Sbjct:   23 LYTKKHEWVLVENGVGTVGITDFATEQLGDVVFIELPDEGTEISKGDSTGAVESVKAASDIYAPISGTVTQKNVKLEEEAGLINKSPFEKGWLYKLKVKSADELEKLLNEEQYAKFKKDEE 143          
BLAST of Glycine cleavage system H protein vs. Ensembl Celegans
Match: gcsh-2 (Glycine cleavage system H protein [Source:UniProtKB/TrEMBL;Acc:Q20634])

HSP 1 Score: 143.28 bits (360), Expect = 5.173e-44
Identity = 60/121 (49.59%), Postives = 97/121 (80.17%), Query Frame = 3
Query:   93 LFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLEEDQ 455
            L+T KH+W+ VEN +GTVGI+D+A E+LGD+V+++LP+ G+EIS+ D  G VESVKAAS+I++P+SG++ + N +LE E+GLINK P++ GW++K+ +    EL+ L++E+ Y KF ++++
Sbjct:   23 LYTKKHEWVLVENGVGTVGITDFATEQLGDVVFIELPDEGTEISKGDSTGAVESVKAASDIYAPISGTVTQKNVKLEEEAGLINKSPFEKGWLYKLKVKSADELEKLLNEEQYAKFKKDEE 143          
BLAST of Glycine cleavage system H protein vs. Ensembl Celegans
Match: gcsh-2 (Glycine cleavage system H protein [Source:UniProtKB/TrEMBL;Acc:Q20634])

HSP 1 Score: 143.28 bits (360), Expect = 5.173e-44
Identity = 60/121 (49.59%), Postives = 97/121 (80.17%), Query Frame = 3
Query:   93 LFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLEEDQ 455
            L+T KH+W+ VEN +GTVGI+D+A E+LGD+V+++LP+ G+EIS+ D  G VESVKAAS+I++P+SG++ + N +LE E+GLINK P++ GW++K+ +    EL+ L++E+ Y KF ++++
Sbjct:   23 LYTKKHEWVLVENGVGTVGITDFATEQLGDVVFIELPDEGTEISKGDSTGAVESVKAASDIYAPISGTVTQKNVKLEEEAGLINKSPFEKGWLYKLKVKSADELEKLLNEEQYAKFKKDEE 143          
BLAST of Glycine cleavage system H protein vs. Ensembl Celegans
Match: gcsh-1 (Glycine cleavage system H protein [Source:UniProtKB/TrEMBL;Acc:O62122])

HSP 1 Score: 141.354 bits (355), Expect = 3.072e-43
Identity = 65/139 (46.76%), Postives = 96/139 (69.06%), Query Frame = 3
Query:   42 YIPLRNVRYFCCHMKN-ILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLEEDQ 455
            +IP    R       N  L+T KH+WI V  ++GTVGI+D+A E+LGD+V+++LPE G EI + D  G VESVKAAS+I++PVSG I+E N +LE+E G+INK P + GW++++ +    +L  L+ E+ YNKF  E++
Sbjct:    7 FIPTVTARTAIRFASNGRLYTKKHEWIVVNQSVGTVGITDFATEQLGDVVFIELPEAGVEIEKGDSTGAVESVKAASDIYAPVSGKILEKNTKLEDEPGIINKSPLEKGWLYRLEITSNEQLNELLTEEQYNKFKSEEE 145          
BLAST of Glycine cleavage system H protein vs. Ensembl Fly
Match: ppl (gene:FBgn0027945 transcript:FBtr0078412)

HSP 1 Score: 140.584 bits (353), Expect = 1.502e-42
Identity = 66/138 (47.83%), Postives = 94/138 (68.12%), Query Frame = 3
Query:   48 PLRNVRYFCCHMKNIL-----FTDKHDWIKV-ENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFL 443
            PL  V+    H+ ++L     +T+KH+W++V   +   VGIS YAQE LGD+V+ QLPE G+E+ Q+DECG +ESVKAASE++SPVSG ++E N  +E+   L+N   Y+ GW+FK+ L  P EL++LM E  Y  FL
Sbjct:   22 PLGAVQARAIHLTSLLAKERRYTNKHEWVEVVSGSNAIVGISSYAQEALGDVVFAQLPEPGTELKQDDECGALESVKAASEVYSPVSGKVIEKNAEVEDTPALVNSSCYEKGWLFKVDLKNPKELEALMTEDQYKAFL 159          
BLAST of Glycine cleavage system H protein vs. Ensembl Zebrafish
Match: gcsha (glycine cleavage system protein H (aminomethyl carrier), a [Source:ZFIN;Acc:ZDB-GENE-050320-18])

HSP 1 Score: 148.288 bits (373), Expect = 2.420e-45
Identity = 64/126 (50.79%), Postives = 94/126 (74.60%), Query Frame = 3
Query:   69 FCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            FC  +K   FTDKH+W++V+  + TVGIS++AQE LGD+VY  LPE+G+++SQ DE G +ESVKAASE++SP++G + +VN  L +  GL+NK  Y DGW+ K+++  P EL  LMDE AY ++++
Sbjct:   48 FCAALK---FTDKHEWVRVDGGVATVGISNFAQEALGDVVYCGLPEIGAKLSQTDEFGALESVKAASELYSPLTGEVTDVNDALADNPGLVNKSCYNDGWLMKMTVSIPEELDGLMDEAAYERYIK 170          
BLAST of Glycine cleavage system H protein vs. Ensembl Zebrafish
Match: gcsha (glycine cleavage system protein H (aminomethyl carrier), a [Source:ZFIN;Acc:ZDB-GENE-050320-18])

HSP 1 Score: 148.288 bits (373), Expect = 2.420e-45
Identity = 64/126 (50.79%), Postives = 94/126 (74.60%), Query Frame = 3
Query:   69 FCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            FC  +K   FTDKH+W++V+  + TVGIS++AQE LGD+VY  LPE+G+++SQ DE G +ESVKAASE++SP++G + +VN  L +  GL+NK  Y DGW+ K+++  P EL  LMDE AY ++++
Sbjct:   48 FCAALK---FTDKHEWVRVDGGVATVGISNFAQEALGDVVYCGLPEIGAKLSQTDEFGALESVKAASELYSPLTGEVTDVNDALADNPGLVNKSCYNDGWLMKMTVSIPEELDGLMDEAAYERYIK 170          
BLAST of Glycine cleavage system H protein vs. Ensembl Zebrafish
Match: gcshb (glycine cleavage system protein H (aminomethyl carrier), b [Source:ZFIN;Acc:ZDB-GENE-040718-319])

HSP 1 Score: 144.436 bits (363), Expect = 8.959e-44
Identity = 62/117 (52.99%), Postives = 89/117 (76.07%), Query Frame = 3
Query:   96 FTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            FTDKH+W++VE ++GTVGIS++AQE LGD+VY  LPEVG+++ Q +E G +ESVKAASE++SP++G +  +N  L     L+NK  Y+ GW+ K+++ KP EL  LMDE AY KF++
Sbjct:   54 FTDKHEWVRVEGSVGTVGISNFAQEALGDVVYCGLPEVGTKLDQMEEFGALESVKAASELYSPLTGEVTAINTELTENPALVNKACYEGGWLIKMTIEKPAELDELMDEAAYEKFIK 170          
BLAST of Glycine cleavage system H protein vs. Ensembl Xenopus
Match: gcsh (glycine cleavage system protein H (aminomethyl carrier) [Source:NCBI gene;Acc:496433])

HSP 1 Score: 139.043 bits (349), Expect = 1.114e-41
Identity = 61/117 (52.14%), Postives = 89/117 (76.07%), Query Frame = 3
Query:   96 FTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            FTDKH+WI VEN IGTVGIS +AQ+ LG++VY  LPEVG ++++ DE GT+ESVKA SE++SP++G + E+N  L +  GL+N+  Y++GW+ K+++  P EL  LM E AY K+++
Sbjct:   50 FTDKHEWISVENGIGTVGISKFAQDSLGEVVYCSLPEVGKKLNKMDEFGTLESVKAVSELYSPLTGEVTEINGALTDNPGLVNQSCYEEGWLIKLTVDNPSELDDLMSEDAYEKYVK 166          
BLAST of Glycine cleavage system H protein vs. Ensembl Mouse
Match: Gcsh (glycine cleavage system protein H (aminomethyl carrier) [Source:MGI Symbol;Acc:MGI:1915383])

HSP 1 Score: 144.821 bits (364), Expect = 5.864e-44
Identity = 65/131 (49.62%), Postives = 94/131 (71.76%), Query Frame = 3
Query:   51 LRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFL 443
            +R++R     +    FT+KH+WI  E  IGTVGIS++AQE LGD+VY  LPEVG+++ + +E G +ESVKAASE++SP+SG + EVN+ L    GL+NK  Y+DGW+ K++L  P E+  LM E+AY K++
Sbjct:   35 VRSLRTGSALLSVRKFTEKHEWITTEEGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSEMDELMSEEAYEKYV 165          
BLAST of Glycine cleavage system H protein vs. UniProt/SwissProt
Match: sp|A7HQX9|GCSH_PARL1 (Glycine cleavage system H protein OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) OX=402881 GN=gcvH PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 9.160e-46
Identity = 64/122 (52.46%), Postives = 92/122 (75.41%), Query Frame = 3
Query:   81 MKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            M +I FTD+H+W++V+ +I T+GI+DYAQE+LGD+V+V+LPEVG +I+  DE   VESVKAASE++SPVSG +++VN  +E     +N++   DGW  K+ L  P EL  LMDE AY++F+E
Sbjct:    1 MSDIRFTDQHEWVRVDGDIATIGITDYAQEQLGDVVFVELPEVGKDIAAGDEAAVVESVKAASEVYSPVSGEVIDVNSDIEKTPAGVNENAMGDGWFIKLRLADPSELDKLMDEAAYSEFVE 122          
BLAST of Glycine cleavage system H protein vs. UniProt/SwissProt
Match: sp|P11183|GCSH_CHICK (Glycine cleavage system H protein, mitochondrial OS=Gallus gallus OX=9031 GN=GCSH PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 7.265e-45
Identity = 64/117 (54.70%), Postives = 93/117 (79.49%), Query Frame = 3
Query:   96 FTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            FTDKH+WI VEN IGTVGIS++AQE LGD+VY  LPE+G++++++DE G +ESVKAASE++SP++G + ++N  L +  GL+NK  Y+DGW+ K+++ KP EL  LM E AY K+++
Sbjct:   44 FTDKHEWISVENGIGTVGISNFAQEALGDVVYCSLPEIGTKLNKDDEFGALESVKAASELYSPLTGEVTDINAALADNPGLVNKSCYQDGWLIKMTVEKPAELDELMSEDAYEKYIK 160          
BLAST of Glycine cleavage system H protein vs. UniProt/SwissProt
Match: sp|Q9N121|GCSH_RABIT (Glycine cleavage system H protein, mitochondrial OS=Oryctolagus cuniculus OX=9986 GN=GCSH PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.595e-44
Identity = 67/131 (51.15%), Postives = 94/131 (71.76%), Query Frame = 3
Query:   51 LRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFL 443
            +R +R     +    FT+KH+WI  EN IGTVGIS++AQE LGD+VY  LPEVG+++ + DE G +ESVKAASE++SP+SG + E+N+ L    GL+NK  Y+DGW+ K++L  P EL  LM E+AY K++
Sbjct:   38 VRTLRTGPALLSVRKFTEKHEWITTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYI 168          
BLAST of Glycine cleavage system H protein vs. UniProt/SwissProt
Match: sp|P23434|GCSH_HUMAN (Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 3.966e-44
Identity = 66/132 (50.00%), Postives = 96/132 (72.73%), Query Frame = 3
Query:   51 LRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            +R +R     +    FT+KH+W+  EN IGTVGIS++AQE LGD+VY  LPEVG+++++ DE G +ESVKAASE++SP+SG + E+N+ L    GL+NK  Y+DGW+ K++L  P EL  LM E+AY K+++
Sbjct:   38 VRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIK 169          
BLAST of Glycine cleavage system H protein vs. UniProt/SwissProt
Match: sp|P20821|GCSH_BOVIN (Glycine cleavage system H protein, mitochondrial OS=Bos taurus OX=9913 GN=GCSH PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.780e-43
Identity = 64/131 (48.85%), Postives = 94/131 (71.76%), Query Frame = 3
Query:   51 LRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFL 443
            +R +R     +    FT+KH+W+  EN +GTVGIS++AQE LGD+VY  LPEVG+++++ +E G +ESVKAASE++SP+SG + E+NK L    GL+NK  Y+DGW+ K++   P EL  LM E+AY K++
Sbjct:   38 VRELRTGPALLSVRKFTEKHEWVTTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEVTEINKALAENPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYI 168          
BLAST of Glycine cleavage system H protein vs. TrEMBL
Match: A0A2H1VKC6 (Glycine cleavage system H protein OS=Spodoptera frugiperda OX=7108 GN=SFRICE_007026 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 5.680e-49
Identity = 72/122 (59.02%), Postives = 97/122 (79.51%), Query Frame = 3
Query:   84 KNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLEE 449
            K   +T KH+W+ V +NIGTVGIS YAQ+ LG++VYVQLPEVG EI+  DECG +ESVKAASE++SPVSG+I E NK +E++  LINK  Y++GW+F++ L +P EL+ LMD+  Y+K+LEE
Sbjct:   33 KARFYTKKHEWVSVSDNIGTVGISSYAQDALGEVVYVQLPEVGKEIAAGDECGALESVKAASEVYSPVSGTITEANKEVESKPALINKSCYEEGWLFRVKLARPEELQQLMDQATYDKYLEE 154          
BLAST of Glycine cleavage system H protein vs. TrEMBL
Match: A0A3Q3W8S4 (Glycine cleavage system H protein OS=Mola mola OX=94237 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.255e-48
Identity = 74/126 (58.73%), Postives = 99/126 (78.57%), Query Frame = 3
Query:   69 FCCHMKNILFTDKHDWIKVENN-IGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFL 443
            FC     + FTDKH+WI+VE   IGTVGIS +AQE LGD+VY  LPEVG++++Q DE G +ESVKAASE++SP++G +VEVN+RL +E GL+NK  YKDGW+ K+++ KP EL SLMDE AY +++
Sbjct:   35 FCSSRLTLKFTDKHEWIRVEGGGIGTVGISHFAQEALGDVVYCGLPEVGTQLAQQDEFGALESVKAASELYSPLTGEVVEVNERLADEPGLVNKSCYKDGWLMKMTIAKPAELDSLMDEAAYERYI 160          
BLAST of Glycine cleavage system H protein vs. TrEMBL
Match: A0A3Q0TBT7 (Glycine cleavage system H protein OS=Amphilophus citrinellus OX=61819 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.805e-48
Identity = 71/124 (57.26%), Postives = 99/124 (79.84%), Query Frame = 3
Query:   75 CHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            C++  + FTDKH+WI+VE+ IGTVGIS++AQE LGD+VY  LPEVG++++Q DE G +ESVKAASE++SP++G +VEVN  L +  GL+NK  YKDGW+ K+++ KP EL SLMDE AY +++ 
Sbjct:   33 CYLAALKFTDKHEWIRVEDGIGTVGISNFAQEALGDVVYCGLPEVGTQLAQQDEFGALESVKAASELYSPLTGEVVEVNTLLADNPGLVNKSCYKDGWLVKMTVSKPAELDSLMDEAAYERYIR 156          
BLAST of Glycine cleavage system H protein vs. TrEMBL
Match: A0A5N5T4H2 (Glycine cleavage system H protein, mitochondrial OS=Armadillidium nasatum OX=96803 GN=GCSH_1 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 5.800e-48
Identity = 77/135 (57.04%), Postives = 96/135 (71.11%), Query Frame = 3
Query:   45 IPLRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLEE 449
            +PL         + +  ++DKH+W++V  NIGTVGI++YAQE LGDIVY QLP VG E  Q DECG +ESVKAASE++SPVSG IVE N  LE+E  LIN+  Y+ GW+FK+ L  P EL  LMDE AY KFL+E
Sbjct:   34 LPLNRTFATSSFLLDRKYSDKHEWVEVSGNIGTVGITNYAQEALGDIVYAQLPNVGEEFQQMDECGALESVKAASELYSPVSGKIVEANGALESEPNLINQSCYEKGWLFKLELTAPDELSGLMDEAAYEKFLKE 168          
BLAST of Glycine cleavage system H protein vs. TrEMBL
Match: A0A444TTT6 (Glycine cleavage system H protein OS=Armadillidium vulgare OX=13347 GN=Avbf_01784 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.000e-47
Identity = 77/135 (57.04%), Postives = 96/135 (71.11%), Query Frame = 3
Query:   45 IPLRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLEE 449
            +PL         + +  ++DKH+W++V  NIGTVGI++YAQE LGDIVY QLP VG E  Q DECG +ESVKAASE++SPVSG IVE N  LE+E  LIN+  Y+ GW+FK+ L  P EL  LMDE AY KFL+E
Sbjct:   34 LPLNRTFATSSLLLDRKYSDKHEWVEVSGNIGTVGITNYAQEALGDIVYAQLPNVGEEFQQMDECGALESVKAASELYSPVSGKIVEANGALESEPNLINQSCYEKGWLFKLELTAPDELSGLMDEAAYEKFLKE 168          
BLAST of Glycine cleavage system H protein vs. Ensembl Cavefish
Match: gcsha (glycine cleavage system H protein, mitochondrial-like [Source:NCBI gene;Acc:103039075])

HSP 1 Score: 151.754 bits (382), Expect = 8.724e-47
Identity = 64/117 (54.70%), Postives = 93/117 (79.49%), Query Frame = 3
Query:   96 FTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            +TDKH+W++VE+ +GTVGIS +AQE LGD+VY  LP+VG+++SQ+DE G +ESVKAASE++SP++G + EVN  L +  GL+NK  YKDGW+ K+++  P EL +LMDE AY +++ 
Sbjct:   50 YTDKHEWVRVEDGVGTVGISKFAQEALGDVVYCGLPDVGTKLSQSDEFGALESVKAASELYSPLTGEVTEVNNALSDNPGLVNKSCYKDGWLIKMTISVPEELDALMDEAAYERYIR 166          
BLAST of Glycine cleavage system H protein vs. Ensembl Cavefish
Match: gcshb (glycine cleavage system H protein, mitochondrial-like [Source:NCBI gene;Acc:103043137])

HSP 1 Score: 143.665 bits (361), Expect = 1.038e-43
Identity = 61/116 (52.59%), Postives = 88/116 (75.86%), Query Frame = 3
Query:   96 FTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFL 443
            FT+KH+W++VE  IGTVGIS +AQE LGD+VY  LPE G+++   +E G +ESVKAASE++SP++G + E+N  L +  GL+N   Y+ GW+ K+++  PGEL++LMDE AY KF+
Sbjct:   52 FTEKHEWVRVEGGIGTVGISSFAQEALGDVVYCGLPEAGTKLQPMEEFGALESVKAASELYSPLTGEVTEINTELTDSPGLVNSSCYERGWLIKMTIENPGELEALMDEAAYEKFV 167          
BLAST of Glycine cleavage system H protein vs. Ensembl Sea Lamprey
Match: gcshb (glycine cleavage system protein H (aminomethyl carrier), b [Source:ZFIN;Acc:ZDB-GENE-040718-319])

HSP 1 Score: 146.747 bits (369), Expect = 2.007e-45
Identity = 67/134 (50.00%), Postives = 94/134 (70.15%), Query Frame = 3
Query:   45 IPLRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            +P R +           ++DKH+WI VE  +GTVGIS+YAQE LGD+VY  LPEVG++++Q +E G++ESVKAASE++SP++G + EVN  L    GL+NK  Y DGW+ K+++ +P EL  LMDEK Y  FL+
Sbjct:   46 LPARGLHSTGLVAAARKYSDKHEWILVEGGVGTVGISNYAQEALGDVVYCGLPEVGTKLAQLEEFGSLESVKAASELYSPITGCVTEVNAALAENPGLVNKSCYDDGWLIKLTVEQPAELDGLMDEKGYEAFLK 179          
BLAST of Glycine cleavage system H protein vs. Ensembl Yeast
Match: GCV3 (H subunit of the mitochondrial glycine decarboxylase complex; glycine decarboxylase is required for the catabolism of glycine to 5,10-methylene-THF; also required for all protein lipoylation; expression is regulated by levels of 5,10-methylene-THF [Source:SGD;Acc:S000000042])

HSP 1 Score: 108.227 bits (269), Expect = 1.253e-30
Identity = 53/133 (39.85%), Postives = 83/133 (62.41%), Query Frame = 3
Query:   66 YFCCHMKNILFTDKHDWIKV-ENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISL---LKPGELKSLMDEKAYNKFLEED 452
            Y     + + +T +H+WI V ++    VGI+ YA + LGD  YV+LPEVG+EI+Q +  G++ESVK+ASEI+ P  G++ E+N  LE   G++N+ P  DGW+ K+ L   +   +++ LM  + Y K L  D
Sbjct:   37 YSSQGPQAVRYTSQHEWIAVHQDKTAFVGITKYATDALGDATYVELPEVGTEIAQGESLGSIESVKSASEIYQPADGTVEEINTNLEENPGVVNEDPMGDGWLVKMKLGEGVNVEQVEGLMSLEQYEKTLVHD 169          
BLAST of Glycine cleavage system H protein vs. Ensembl Nematostella
Match: EDO49338 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHF2])

HSP 1 Score: 148.673 bits (374), Expect = 1.068e-46
Identity = 66/120 (55.00%), Postives = 90/120 (75.00%), Query Frame = 3
Query:   96 FTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLEEDQ 455
            +T KH+W+ VEN IGT+G++DYAQ  LGDIVYVQLPEVG + S  +E G +ESVKAAS+++SP SG I E+N +LE +  LINK PY DGW+ K+ L  P EL  L+DE+AY + + +++
Sbjct:    5 YTPKHEWVVVENGIGTIGVTDYAQSNLGDIVYVQLPEVGDKFSMEEEFGALESVKAASDLYSPTSGKITEINSQLEEDPSLINKSPYGDGWIVKMELSNPSELDDLLDEEAYKELVAQEE 124          
BLAST of Glycine cleavage system H protein vs. Ensembl Medaka
Match: ENSORLT00000011712.2 (glycine cleavage system H protein, mitochondrial [Source:NCBI gene;Acc:101155190])

HSP 1 Score: 157.918 bits (398), Expect = 3.008e-49
Identity = 69/118 (58.47%), Postives = 97/118 (82.20%), Query Frame = 3
Query:   96 FTDKHDWIKVENN-IGTVGISDYAQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            FTDKH+W++VE++ IGTVGIS++AQE LGD+VY  LPEVG++++Q DE G +ESVKAASE++SP++G +VEVN  L ++ GL+NK  YKDGW+ K+++ KP EL SLMDE AY +++ 
Sbjct:   54 FTDKHEWVRVEDDGIGTVGISNFAQEALGDVVYCGLPEVGTQLAQQDEFGALESVKAASELYSPLTGEVVEVNSLLADKPGLVNKSCYKDGWLMKMTIAKPAELDSLMDEAAYERYIR 171          
BLAST of Glycine cleavage system H protein vs. Ensembl Medaka
Match: gcshb (glycine cleavage system H protein, mitochondrial [Source:NCBI gene;Acc:101156637])

HSP 1 Score: 129.798 bits (325), Expect = 9.058e-38
Identity = 62/145 (42.76%), Postives = 89/145 (61.38%), Query Frame = 3
Query:   96 FTDKHDWIKVENNIGTVGISDYAQEKLGDIVYVQLPEVGSEISQN----------------------------DECGTVESVKAASEIFSPVSGSIVEVNKRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLE 446
            FT+KH+W++VE  IGTVGIS YAQ+ LGD+VY  LPEVG  + Q                             DE G +ESVKAASE++SP++G +  +N +L    GL+NK  Y +GW+ K+++ KP E+ +LMD+ AY+KF++
Sbjct:   55 FTEKHEWVQVEGGIGTVGISSYAQDALGDVVYCGLPEVGQRLEQMGTTLTFTCKAYYYFVLNCLSFCIPAALVDEFGALESVKAASELYSPLTGEVTAINTQLAENPGLVNKDCYAEGWLIKMTIEKPEEVDALMDQAAYDKFIK 199          
The following BLAST results are available for this feature:
BLAST of Glycine cleavage system H protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCSH8.259e-4550.00glycine cleavage system protein H [Source:HGNC Sym... [more]
AC092718.31.088e-3456.99novel protein[more]
GCSH2.471e-3451.43glycine cleavage system protein H [Source:HGNC Sym... [more]
AC092718.32.599e-3451.43novel protein[more]
GCSH9.009e-3457.30glycine cleavage system protein H [Source:HGNC Sym... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gcsh-25.173e-4449.59Glycine cleavage system H protein [Source:UniProt... [more]
gcsh-25.173e-4449.59Glycine cleavage system H protein [Source:UniProt... [more]
gcsh-25.173e-4449.59Glycine cleavage system H protein [Source:UniProt... [more]
gcsh-13.072e-4346.76Glycine cleavage system H protein [Source:UniProt... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppl1.502e-4247.83gene:FBgn0027945 transcript:FBtr0078412[more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gcsha2.420e-4550.79glycine cleavage system protein H (aminomethyl car... [more]
gcsha2.420e-4550.79glycine cleavage system protein H (aminomethyl car... [more]
gcshb8.959e-4452.99glycine cleavage system protein H (aminomethyl car... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gcsh1.114e-4152.14glycine cleavage system protein H (aminomethyl car... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gcsh5.864e-4449.62glycine cleavage system protein H (aminomethyl car... [more]
back to top
BLAST of Glycine cleavage system H protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7HQX9|GCSH_PARL19.160e-4652.46Glycine cleavage system H protein OS=Parvibaculum ... [more]
sp|P11183|GCSH_CHICK7.265e-4554.70Glycine cleavage system H protein, mitochondrial O... [more]
sp|Q9N121|GCSH_RABIT2.595e-4451.15Glycine cleavage system H protein, mitochondrial O... [more]
sp|P23434|GCSH_HUMAN3.966e-4450.00Glycine cleavage system H protein, mitochondrial O... [more]
sp|P20821|GCSH_BOVIN2.780e-4348.85Glycine cleavage system H protein, mitochondrial O... [more]
back to top
BLAST of Glycine cleavage system H protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1VKC65.680e-4959.02Glycine cleavage system H protein OS=Spodoptera fr... [more]
A0A3Q3W8S41.255e-4858.73Glycine cleavage system H protein OS=Mola mola OX=... [more]
A0A3Q0TBT73.805e-4857.26Glycine cleavage system H protein OS=Amphilophus c... [more]
A0A5N5T4H25.800e-4857.04Glycine cleavage system H protein, mitochondrial O... [more]
A0A444TTT61.000e-4757.04Glycine cleavage system H protein OS=Armadillidium... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gcsha8.724e-4754.70glycine cleavage system H protein, mitochondrial-l... [more]
gcshb1.038e-4352.59glycine cleavage system H protein, mitochondrial-l... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gcshb2.007e-4550.00glycine cleavage system protein H (aminomethyl car... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GCV31.253e-3039.85H subunit of the mitochondrial glycine decarboxyla... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO493381.068e-4655.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000011712.23.008e-4958.47glycine cleavage system H protein, mitochondrial [... [more]
gcshb9.058e-3842.76glycine cleavage system H protein, mitochondrial [... [more]
back to top
BLAST of Glycine cleavage system H protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023887 ID=SMED30023887|Name=Glycine cleavage system H protein|organism=Schmidtea mediterranea sexual|type=transcript|length=553bp
AATTTATTTAAATGTTACTAAATTTAAAACTAAATTTGAAATATATTCCG
TTGCGTAATGTGCGTTATTTTTGTTGCCATATGAAAAATATACTCTTTAC
CGACAAGCATGATTGGATTAAGGTAGAAAATAATATTGGAACAGTTGGAA
TCTCAGATTACGCGCAAGAAAAACTAGGTGATATAGTTTATGTCCAACTA
CCAGAAGTTGGTTCTGAAATTTCTCAAAATGATGAATGTGGAACAGTAGA
ATCTGTCAAAGCAGCAAGTGAAATTTTTAGCCCAGTCTCAGGAAGTATTG
TGGAAGTTAATAAACGATTAGAAAATGAAAGTGGGCTAATTAACAAGCAT
CCTTACAAGGATGGATGGGTATTTAAGATTTCATTATTAAAACCTGGTGA
ATTGAAATCTCTCATGGATGAAAAGGCTTATAATAAGTTCTTGGAAGAAG
ATCAATAACAAACTAGAATTTATTTTATAGAGAATACAATTTTGCAATTA
TATTTCTTGAATTAATTTATATAATAAATCAATTTGTTCTTTGTATAAAA
AAA
back to top

protein sequence of SMED30023887-orf-1

>SMED30023887-orf-1 ID=SMED30023887-orf-1|Name=SMED30023887-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=149bp
MLLNLKLNLKYIPLRNVRYFCCHMKNILFTDKHDWIKVENNIGTVGISDY
AQEKLGDIVYVQLPEVGSEISQNDECGTVESVKAASEIFSPVSGSIVEVN
KRLENESGLINKHPYKDGWVFKISLLKPGELKSLMDEKAYNKFLEEDQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005960glycine cleavage complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017453GCV_H_sub
IPR033753GCV_H/Fam206
IPR002930GCV_H
IPR0030162-oxoA_DH_lipoyl-BS
IPR000089Biotin_lipoyl
IPR011053Single_hybrid_motif
Vocabulary: biological process
TermDefinition
GO:0019464glycine decarboxylation via glycine cleavage system
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.40.50.100coord: 23..148
e-value: 1.9E-50
score: 171.9
NoneNo IPR availablePANTHERPTHR11715:SF3GLYCINE CLEAVAGE SYSTEM H PROTEIN, MITOCHONDRIALcoord: 24..147
IPR017453Glycine cleavage system H-protein, subgroupTIGRFAMTIGR00527TIGR00527coord: 25..147
e-value: 3.5E-45
score: 151.2
IPR033753Glycine cleavage system H-protein/SimiatePFAMPF01597GCV_Hcoord: 28..146
e-value: 1.0E-45
score: 154.6
IPR033753Glycine cleavage system H-protein/SimiateCDDcd06848GCS_Hcoord: 29..123
e-value: 8.86807E-47
score: 144.984
IPR002930Glycine cleavage system H-proteinPANTHERPTHR11715GLYCINE CLEAVAGE SYSTEM H PROTEINcoord: 24..147
IPR0030162-oxo acid dehydrogenase, lipoyl-binding sitePROSITEPS00189LIPOYLcoord: 67..96
IPR000089Biotin/lipoyl attachmentPROSITEPS50968BIOTINYL_LIPOYLcoord: 42..124
score: 26.305
IPR011053Single hybrid motifSUPERFAMILYSSF51230Single hybrid motifcoord: 24..146