Rootletin-2

Overview
NameRootletin-2
Smed IDSMED30023882
Uniprot Best hitRootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=1 (E=0)
Length (bp)6811
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rootletin-2 (SMED30023882) t-SNE clustered cells

Violin plots show distribution of expression levels for Rootletin-2 (SMED30023882) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rootletin-2 (SMED30023882) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rootletin-2 (SMED30023882) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023882

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023882SMESG000081227.1 SmedASXL_015264SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30023882SMESG000081227.1 dd_Smed_v4_6573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023882SMESG000081227.1 dd_Smed_v4_6573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023882SMESG000081227.1 dd_Smed_v4_6573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023882SMESG000081227.1 dd_Smed_v4_6573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30023882SMESG000081227.1 dd_Smed_v4_6573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023882SMESG000081227.1 dd_Smed_v6_6573_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30023882SMESG000081227.1 dd_Smed_v6_6573_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023882SMESG000081227.1 dd_Smed_v6_6573_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023882SMESG000081227.1 dd_Smed_v6_6573_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30023882SMESG000081227.1 dd_Smed_v6_6573_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30023882SMESG000081227.1 dd_Smed_v6_6573_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023882SMESG000081227.1 dd_Smed_v4_6573_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30023882SMESG000081227.1 dd_Smed_v4_6573_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30023882SMESG000081227.1 dd_Smed_v4_6573_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rootletin-2 vs. Ensembl Human
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:HGNC Symbol;Acc:HGNC:21299])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 694/2093 (33.16%), Postives = 1157/2093 (55.28%), Query Frame = 1
Query:  271 GIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNC--SQLENSLSKMKEEFRKTETQYQKQIES------LNEQFVHVNRSNESLTKELADKEKV-------LTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVD---QVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSS--RNSVEFNFSEDRKRVGRFGDVNQYS--------------ESVIPGS-DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSAL--KSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMEL-TSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKK 6435
            G+G  DL+   +   +P ++++I+ R+                       +Q  S +      + S+  L+ EN  L+  L  VE+ L + + ERD LAIK+NA++E+L +          R+     E      L  Q+++LR+QL ++   Y+RKL A  + Q +QA+L++RLQ K+ Q + R                  S L+         L R  ++ +  L+  +T+ + DLES +  L+EEQ +S SL Q+ A+LR+QLD+A +ANQ L+ED+++++ + +  + ELE ++  W+ +E +F+ +   E +R+  LW  VV F+R  +++K   ERDL QL   + +++++++ A   L T    RL++ + +   EK     +QLE  L   +++  + +   Q+Q++S      L+ +   +  + + L K+  +K++V       L  L  LR      L+                D + + Q LRD+AQ V++D +   Q+  S    D       + G      S+  L   R+ SP R   RS    G   R    R  SP     ST A + SALHKR LQVQD+  +  ++++   +++KQL DSE+ERR LE+Q   LR + D   +  +D QRE +R+R    +L  +K  L  S   + ++ +  +Q+ EKL+    EL+R ++ L +  +D  ++  R  +E+ER  + +E  E K S L +E+  ++E+L+RA L++++L+ E + + ++L K E  + E E+   K + EEA L+D   +L ++N  L ++  +   ++ Q E EK  L G ++  EQE    REE  R+E  + E    + GL  S++  E++ E L+ +L  L +E+ QL+     L R+ +    EL QARR+A+R   A++++ ++KE LAKE   L  QL   E E R  ++    L+ EKE L+GSL+E Q+ ++QLEA+ E LE+  Q L   +  +  E   L+ +     +K S  KE +  KL ++E+E    LR ++ A EED++RL  E+E    E    + +++ Q Q E ++L  RL  +KEEL++EI  +Q+ERD+ LL AE  KQ A++L E EK ++ EK+      L T   ++ER + + + R +QD++T+     +L+  R Q E+    H +E++ LQ   ++L  Q+   +RE EEL++ L++ E+ RD LR++L E+  K+RE+++ RE  R+E  + +R+  E  KE E ++ SN+ELR  +K +E ++I ++   +D + KL++LEE +  + KE  + R  LQ+ E++R++ RREL+ELR Q+K LD+E  +L  E++ LQ R+A  E  E E+RRE  GL+Q++++ EA+ E + ++L  + RK +E E    ++E+      +E     K   +    LE +LE       EL   LS  E R   LE ++  ++ +R+ AE +L  + S LR+ +G                           GR  S     V  + + D    G    +N  S               +  P S DLDPEAVR ALR+  Q + S +RERD  E++ + SAL  +  E   + D A  R  QLQK   E EE ++ +D RLS  Q  L +QEE++ R+ERER++ +D+V  LER L   E+E +  QE++ KM+  E+  E ++R L + +D +E+R  +LEL RR LEGELQR ++G +D+E + Q L+DRVD+L +Q++D E KA +LQLT++RL+  LA+ EE E   +DKV  L  +L++   +L S +DK + LQ  L + EHDR+VLQERL++ +  LSEA+ Q+ +L ++++  + E+ + E ++ E EG++++L ++L QRQE E    + + +   E+ LL ERL SL  +LA LE+E+R++E+  ++ EK++ +L++TLDK+E+EK RS E   +   ++   D      E E     RQ+Q+L+ Q+   EQ H+   +E+   + + E+  E++RL+SA   TE+TL+ RER+HRQ+V+ LEEQ++ LK QL QEL++
Sbjct:   32 GLGARDLAQDAQITSLPALIREIVTRNL----------------------SQPESPVLLPATEMASLLSLQEENQLLQQELSRVEDLLAQSRAERDELAIKYNAVSERLEQAL--------RLEPGELETQEPRGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKR-----------------CSELEQQL------LERSGELEQQRLR--DTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGL--RLAESRAEAALEKQALLQAQLEEQL---RDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLRLQEQAALETE--------------DGEGLQQTLRDLAQAVLSDSESGVQLSGSERTAD------ASNG------SLRGLSGQRTPSPPR---RSSPGRGRSPR----RGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRHERSQLQEQLAQLSRQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGL--------------------------GRAPSPAPRPVPGSPARDAPAEGSGEGLNSPSTLECSPGSQPPSPGPATSPASPDLDPEAVRGALREFLQELRSAQRERD--ELRTQTSALNRQLAEMEAERDSATSRARQLQKAVAESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQATESELRASQEKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSASLNSTRDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVADLELQRVEAEGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVERLRSAQAQTERTLEARERAHRQRVRGLEEQVSTLKGQLQQELRR 2003          
BLAST of Rootletin-2 vs. Ensembl Human
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:HGNC Symbol;Acc:HGNC:21299])

HSP 1 Score: 482.641 bits (1241), Expect = 1.929e-142
Identity = 424/1317 (32.19%), Postives = 731/1317 (55.50%), Query Frame = 1
Query:  844 LNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNC--SQLENSLSKMKEEFRKTETQYQKQIES------LNEQFVHVNRSNESLTKELADKEKV-------LTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVD---QVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGF 4740
            L ++N  L+ E+SR+++    + ++ +  + I  N +   +T+ + DLES +  L+EEQ +S SL Q+ A+LR+QLD+A +ANQ L+ED+++++ + +  + ELE ++  W+ +E +F+ +   E +R+  LW  VV F+R  +++K   ERDL QL   + +++++++ A   L T    RL++ + +   EK     +QLE  L   +++  + +   Q+Q++S      L+ +   +  + + L K+  +K++V       L  L  LR      L+                D + + Q LRD+AQ V++D +   Q+  S    D       + G      S+  L   R+ SP R   RS    G   R    R  SP     ST A + SALHKR LQVQD+  +  ++++   +++KQL DSE+ERR LE+Q   LR + D   +  +D QRE +R+R    +L  +K  L  S   + ++ +  +Q+ EKL+    EL+R ++ L +  +D  ++  R  +E+ER  + +E  E K S L +E+  ++E+L+RA L++++L+ E + + ++L K E  + E E+   K + EEA L+D   +L ++N  L ++  +   ++ Q E EK  L G ++  EQE    REE  R+E  + E    + GL  S++  E++ E L+ +L  L +E+ QL+     L R+ +    EL QARR+A+R   A++++ ++KE LAKE   L  QL   E E R  ++    L+ EKE L+GSL+E Q+ ++QLEA+ E LE+  Q L   +  +  E   L+ +     +K S  KE +  KL ++E+E    LR ++ A EED++RL  E+E    E    + +++ Q Q E ++L  RL  +KEEL++EI  +Q+ERD+ LL AE  KQ A++L E EK ++ EK+      L T   ++ER + + + R +QD++T+     +L+  R Q E+    H +E++ LQ   ++L  Q+   +RE EEL++ L++ E+ RD LR++L E+  K+RE+++ RE  R+E  + +R+  E  KE E ++ SN+ELR  +K +E ++I ++   +D + KL++LEE +  + KE  + R  LQ+ E++R++ RREL+ELR Q+K LD+E  +L  E++ LQ R+A  E  E E+RRE  GL+Q++++ EA+ E + ++L  + RK +E E    ++E+      +E     K   +    LE +LE       EL   LS  E R   LE ++  ++ +R+ AE +L  + S LR+ +G 
Sbjct:   29 LQEENQLLQQELSRVEDLLAQSRAERDE-LAIKYNAVSERDTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGL--RLAESRAEAALEKQALLQAQLEEQL---RDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLRLQEQAALETE--------------DGEGLQQTLRDLAQAVLSDSESGVQLSGSERTAD------ASNG------SLRGLSGQRTPSPPR---RSSPGRGRSPR----RGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRHERSQLQEQLAQLSRQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGL 1306          
BLAST of Rootletin-2 vs. Ensembl Human
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:HGNC Symbol;Acc:HGNC:21299])

HSP 1 Score: 276.559 bits (706), Expect = 5.760e-77
Identity = 234/780 (30.00%), Postives = 407/780 (52.18%), Query Frame = 1
Query:  685 QTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNC--SQLENSLSKMKEEFRKTETQYQKQIES------LNEQFVHVNRSNESLTKELADKEKV-------LTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVD---QVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQL------ETANVTLQRERNALSTEL 2952
            Q+++LR+QL ++   Y+RKL A  + Q +QA+L++RLQ K+ Q + R                  S L+         L R  ++ +  L+  +T+ + DLES +  L+EEQ +S SL Q+ A+LR+QLD+A +ANQ L+ED+++++ + +  + ELE ++  W+ +E +F+ +   E +R+  LW  VV F+R  +++K   ERDL QL   + +++++++ A   L T    RL++ + +   EK     +QLE  L   +++  + +   Q+Q++S      L+ +   +  + + L K+  +K++V       L  L  LR      L+                D + + Q LRD+AQ V++D +   Q+  S    D       + G      S+  L   R+ SP R   RS    G   R    R  SP     ST A + SALHKR LQVQD+  +  ++++   +++KQL DSE+ERR LE+Q   LR + D   +  +D QRE +R+R    +L  +K  L  S   + ++ +  +Q+ EKL+    EL+R ++ L +  +D  ++  R  +E+ER  + +E  E K S L +E+  ++E+L+RA L++++L+ E + + ++L K E  + E E+   K + EEA L+D   +L ++N  L ++  +   ++ Q E EK  L G ++  EQE    REE  R+E  + E    + GL  S++  E++ E L+ +L  L +E+ QL      E A   L+ ER  L ++L
Sbjct:   34 QSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKR-----------------CSELEQQL------LERSGELEQQRLR--DTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGL--RLAESRAEAALEKQALLQAQLEEQL---RDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLRLQEQAALETE--------------DGEGLQQTLRDLAQAVLSDSESGVQLSGSERTAD------ASNG------SLRGLSGQRTPSPPR---RSSPGRGRSPR----RGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRHERSQLQEQLAQEAAWRELEAERAQLQSQL 750          
BLAST of Rootletin-2 vs. Ensembl Human
Match: CROCC2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:HGNC Symbol;Acc:HGNC:51677])

HSP 1 Score: 254.603 bits (649), Expect = 3.246e-67
Identity = 395/1526 (25.88%), Postives = 701/1526 (45.94%), Query Frame = 1
Query:  886 LKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLAC----SNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERM-----RHTISMLEEDKLKLDKSRMNSYE-ECKSYKQDMEK--LKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLE--TANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIE--ALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAE--MGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTE-----------RGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSD----LDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERR---GLIK 5355
            L +  +  +  L  R++  E  L+ +E + ++DLE  +  L+  + +S  L Q+ ALLR+QL+    AN  L  ++  ++     L+ ELE +   W   + T S  L G+   +  LW   V       +++ + ER L  L+ +  ++ + L  AC    SNL  +  +  S L  QL  +     QL+      + +  K   Q +     L+EQ + V    E LT++   K K +  L         DL N +   D                      +L  + + ++ +                   P   + S    R+ SP + +   H  S             P ++ D    A+R+A+ +R  + Q+L  ++ S++    S+++QL +S  E    +K   + R+   +  RE    Q E +R+     R +  +L  +K  L+   M   E + K+   D EK  L+    ELQR      +  ++L    ER  + +E     ++  E K S L+EE++S++E+L+ A L+++V+E E   L  +L + E   A+ E+   + K+E    RD    + ++   L ++ S    +  Q E E+ +L  ++K LEQE+    E+L + E +       + GL Q+   +E+  E L+ + + L  EK QL+     VT Q++  AL  +L Q+ +D E     +Q++++ K+ L++E+  L+++    E + R  A+    L+ E++ L+ SL E+QQ  ++L+ ++E  A  + L      R  +  E ++LQ +++V+  KL +    LQ ++ + E+E  + L S+  A  E + +L  E+E L     + KE  + Q ++E  +L  +   ++E L  EI ++++ERD+ LL+ E  M +  A++L E E+  + E++S+       +   LER + E + + +Q Q TI     +LK  + QFE     H RE   L+ + ++L  ++    RE E L++ L +A+E    LRQ+L       +  E+ RE L RE  + +R   +  +E + + L N ELR  +  +E +K   +R  ++ + KL ILEE +  LQ+E    R +L + E+A  D R+EL EL  QV+ L  E           + +   EV  L+ + A  E K   AR+E  GL++K+ E EA  E   ++L + LR++   E+ L +          E+    + L+E+           +   + L + L    +RI  LE ++   +  R+ AE +L  + S LR+ +G ++Q                +  SP KG   S +S      +      R     ++  S  PG      +D   V+  LRD  Q +   +RERDD  I+    + +  E   +  +A  R+ QLQK   E EE ++ ++  LSSA+ A  +Q+E + R E E  + +   G+          EK+ LQE+++ +R      EE RR   GL K
Sbjct:  117 LASRCRVVSEQLQARLETTEAQLRRSELEHSVDLEEALGRLEAAEERSTGLCQVNALLREQLEHMKKANDALGRELAGMTGSVQRLQGELELRR--WAQRQ-TRSGGL-GQPRDLLLLWRQAVVLGTDLAELRVATERGLADLQADTARTARRLHTACLNLDSNLRLSASSTASTLGQQLRDKAGEMLQLQG-----RWDAEKVALQAR-----LSEQTLLV----EKLTEQNEQKAKTIAALRT-------DLQNLVAQEDARCL------------------ELAGSSITELGE-------------------PRRPLRS--PQRATSPHQGASPPHICS-------------PATL-DPALQAMRAAIERRWRREQELCLQLKSSQALVASLQEQLSESRRELWAAQK-LQQERAREQAREREALRGQLEAQRLEVQQCRASCKLLGREKAALE---MVVEELKGKADAADAEKQGLEAEAAELQRSLLLQAERREELALRRERSCRALETSQGRLQQLEEKVSGLREELASVREALSTAQLQRDVVESEREGLRSALARAECSNADLELLVRRLKSEGVEQRDSLAAMAALMEGLAQDKSALNHLALQLEQERDQLREQRKTLEQERARAGEQLAQAEQQLALERAERRGLQQACGRLEQRQEQLEGQAALLGREKAQLQEQVGQVTCQKQ--ALEEQLAQSLQDQEAQMGTLQQALQGKDALSEERAQLLAKQEALERQGRLAAEEAADLRVERDSLESSLLEAQQLATKLQEQLEEEARSAGL-----ARQALQVEMEQLQSDWEVQEMKLRQDTVRLQRQVAQQEREAQRALESQALAHREALAQLQREKETLSLTLAEEKEVARCQLEQE-KELVTKSAAEREALKGEIQSLKQERDESLLQLEHKMQQVMALSLKETERSLLSEELSR-------ARRTLERVQQEAQSQQEQAQATISATTEELKALQAQFEDAITAHQRETTALRESLQDLAAERGDVEREAERLRAQLTVAQEGLAALRQEL-------QGVEESREGLHREAQEARRALSDEAREKDVLLLFNSELRATICRAEQEKASFKRSKEEKEQKLLILEEAQAALQQEASALRAHLWELEQAGGDARQELRELHRQVRTLKAENQRRSGEAHELQAQCSQEVLELRRQAAKAEAKHEGARKEVLGLQRKLAEVEAAGEAHGQRLQEHLRESRGAEQTLRA----------ELHSVTRKLQEA-----------SGVADALQARLDQACHRIHSLEQELAQAEGARQDAEAQLGRLCSTLRRGLGLQRQ---------SPWASPEQPGSPTKG---SDSSQALPGQQGTSPPARPHSPLRWP-SPTPGGRSSELMDVATVQDILRDFVQKLREAQRERDDSRIQMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLASVRAAGQ----------EKRRLQEQLETLR---QALEESRRHSQGLAK 1491          

HSP 2 Score: 63.5438 bits (153), Expect = 6.083e-9
Identity = 35/83 (42.17%), Postives = 57/83 (68.67%), Query Frame = 1
Query: 6193 RQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRE 6441
            RQ Q+LQ Q+ E EQ H QR+ +LT++ + ++ +E +RL  A     + L+ +E +H+Q+VK LEEQ+  LK+QL QE++ R+
Sbjct: 1557 RQNQQLQAQMTEMEQAHTQRLQDLTAQHQRDLATEAERLHGARPQATQALESQEWTHQQQVKVLEEQVASLKEQLDQEVQWRQ 1639          
BLAST of Rootletin-2 vs. Ensembl Human
Match: CEP250 (centrosomal protein 250 [Source:HGNC Symbol;Acc:HGNC:1859])

HSP 1 Score: 172.94 bits (437), Expect = 4.073e-42
Identity = 291/1208 (24.09%), Postives = 555/1208 (45.94%), Query Frame = 1
Query:  685 QTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNL-------DTNHVNRL-----SQLQF------QLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNE---SLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQ-------EIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELE------TIQLSNKELR----EKLKTSEMQKIDIQRQ-LQDLQNKLSILEEQKQVLQKEVKD 4191
            Q + L++Q+ ++     RKL    + Q +QA L+++LQ K+ Q                  RS    L+   + T   + +R +  E        + N+D   ++  L+EEQ +  SL ++   LR  +++A   N+ L EDV++L+ + S  + EL +K+  W+ ++  F  +L GE  R+ SLW  VV F+R F ++KS+ +RDL +L+    + + SL   C  L       + N   R+     +QL        +L+ E +  SQ    L ++K +    + + Q ++  L+       + NE    + K L +  ++L T H             +  ++ S +R    +  ++ Q ++DI Q+++ + D +             ++ +G        NSL  + S+        S F+         Y++      AD     VRS L +R   VQDL  ++   +   N +++Q D  E E + L ++  +L  E D+   +  D+Q E       +  L +++  L K+R    ++ +  +Q+  +L+ +N ELQ   ++     ++    L    +E ERL + +   E+K S    E+ +L+E+L  + LE E+L QE + +T +L + E   AE     N  KTE A LR    +L ++N  L  +       + Q E E   +    +A EQ +  ++ +L   E  +E L +    L   +Q  E++   LQ +L  +  EK +++      + ++ A +T+L Q  ++A+R    + +++++KE L +EK  L  +L   E + ++ A+ +  L   KE L+ SL+E+QQ  S +E     LE  +Q + + + +I  E + L+ E D E  +  + +++   +L ++E+E    L  +K A E+++ +L            K+++E +   Q+E+      L R+K EL         E+  IQ +R++   +AE          E+E++S+ E + Q    L  +   LER R + +++  ++Q T       L++ + + ++    H  ++  LQ     L   K    ++ E+LKS L   ++++  + Q++ E   K+RET++               Y  ++KELE      T+ L  KE R    ++  +   Q++   RQ +Q+ Q +   L  Q ++L++EVK+
Sbjct:   23 QVLALQQQMAENQAASWRKLKNSQEAQQRQATLVRKLQAKVLQY-----------------RSWCQELEKRLEATGGPIPQRWENVE--------EPNLD--ELLVRLEEEQQRCESLAEVNTQLRLHMEKADVVNKALREDVEKLTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDGREPAQLLLLLAKTQELEKEAHERSQ---ELIQLKSQGDLEKAELQDRVTELSALLTQSQKQNEDYEKMIKALRETVEILETNH-----------TELMEHEASLSRNAQEEKLSLQQVIKDITQVMVEEGDNI-------------AQGSGH------ENSLELDSSIF-------SQFD---------YQD------ADKALTLVRSVLTRRRQAVQDLRQQLAGCQEAVNLLQQQHDQWEEEGKALRQRLQKLTGERDTLAGQTVDLQGE-------VDSLSKERELLQKAREELRQQLEVLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAKQSESLSELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADLRAAAVKLSALNEALALDKVGLNQQLLQLEEENQSVCSRMEAAEQARNALQVDLAEAEKRREALWEKNTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQLHQEAKRQEEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSLFEAQQQNSVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEGKTALEQQKAAHEKEVNQLRE----------KWEKE-RSWHQQELAKALESLEREKMELEMRLKEQQTEMEAIQAQREEERTQAESALCQMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKLKEQETTGILQTQLQEAQRELKEAARQHRDDLAALQEESSSLLQDKMDLQKQVEDLKSQLVAQDDSQRLVEQEVQE---KLRETQE---------------YNRIQKELEREKASLTLSLMEKEQRLLVLQEADSIRQQELSALRQDMQEAQGEQKELSAQMELLRQEVKE 1112          
BLAST of Rootletin-2 vs. Ensembl Celegans
Match: lfi-1 (Lin-5 (Five) Interacting protein [Source:UniProtKB/TrEMBL;Acc:H2L0I3])

HSP 1 Score: 116.316 bits (290), Expect = 2.326e-25
Identity = 242/1075 (22.51%), Postives = 481/1075 (44.74%), Query Frame = 1
Query: 3730 IQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQL---------------SNK---ELREKLKTSEMQK---IDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQ-----VKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLR-KNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKR----------KGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXX------------------------EKGR-------VSSRNSVEF----NFSEDRKRVGRFGD--VNQY--SESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTG-ESYHEEERRGLIKAVDDAENRCTXXX----XXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPT 6711
            I +  G  +K + +++    D D+EI+  +     + ++       N  LK+ L+ A +  D+L + +++   K+R+   Q   L  EL D K N  + + +LE+ Q                +NK   EL   L+ +++ K    +++  L  L+N+L   E+  + L+  +   +     TEK R+      +  ++        + DT+  KL NE+     ++ T +                  E  A + EL K L Q L+  NE+++   +  + T     D++   ++  E+S+LN   +LE   +   +L S L + E R++ L+      D +R          + + NR+   H+ +    G+   +          P  +                              E GR       V+   SV F    +FS  R      G   +N    + +V      D   +   L+ +   I  +E ER+++         K+ ET   ++Q   R   ++ N  + EE+++ ++SRL SA+T L  QEE + + + ER+ +  K+   E Q    E + ++L E++  +RT  ++ H +     I+++ D E +            R  + +  + ++     E+E Q+L +++  L   +   +SK Q ++   D+L  +L + E  EN  +  +   + +  E+Q     ++D+L+  Q+ L  + + ++ L+  L +V+  + + K + H + +R+   Q++L ++ + K+ +E     + ++++  +  E +L+ ++  +  EK + T+ L  L   LA LE+ERR+  ++    +KEK +L K ++ LE EK R++ +I ++ L+R   ++    +E EN+ L++   +LQ Q+A+ E  +  RI+ELT++ + E   ++ R++      EK ++ RER+HR ++K LE+QI IL+DQL  E ++R   +++S   + NDI  + S +    N+    S D ++              +G S +            P S   SN L+   + S++PT
Sbjct: 1207 INSLYGQNQKIKDEWDDFRNDADKEIQKWKTDAYTVRSEAKALETTNTALKAQLQAANDRIDHLTKTVNDHTSKVRDLTSQVRHLEDELADTKGNLVQKEMDLESTQNRLRSLEDQHSTLQSDANKWRGELDAALRENDILKSNNTNMETDLTRLKNRLKSAEDALKELKNSLSHAK-----TEKERLQNAFREKTKQADHLNQLASQFDTKLTKLRNELQDTNDKLITSD-----------------TERNALRNELQK-LSQELKFGNEQIQRKSDEYQTTI----DDLAHSHRVSEDSRLNALQELEARKYEINDLTSRLDSTEQRLATLQQDYIKADSERDILSDALRRFQSSANRVINFHTFVDGGAGYVDGVPGGTSVIGGGPSAQRSGAYDPSSGGVIGSGISGGPGGSDFGREIEIGRGDSDQSDVAYPRSVPFPPSADFSSGRPGAASAGGRVINNLDGTTTVNMNGGFDIANLEGTLQSLLNKIEKLEMERNELRDTLARMKKKTTETHTTINQKETRYRNIEDNLQDAEEERRALESRLQSAKTLLRSQEEALKQRDEERRQMKSKMVAAELQARGKEAQLRHLNEQLKNLRTDLDNAHTD-----IRSLRDKEEQWDSSRFQLETKMRESDSDTNKYQLQIASFESERQILTEKIKELDGALRLSDSKVQDMKDDTDKLRRDLTKAESVENELRKTIDIQSKTSHEYQ----LLKDQLLNTQNELNGANNRKQQLENELLNVRSEVRDYKQRVHDVNNRVSELQRQLQDANTEKNRVEDRFLSVEKVVNTMRTTETDLRQQLETAKNEKRVATKELEDLKRRLAQLENERRNSSQLSDGWKKEKITLLKKIELLENEKRRTDAAIRETALQREAIEKSLNAMERENKELYKNCAQLQQQIAQLEMENGNRILELTNKQREEQERQLIRMRQEKGQIEKVIENRERTHRNRIKQLEDQIAILRDQLDGERRRRREYVDRS---MVNDIGRLGSNVLGIRNSYGDNSIDAII--------------NGGSRSVGFY--------PRSTFASNPLT-PPLGSSTPT 2219          
BLAST of Rootletin-2 vs. Ensembl Celegans
Match: lfi-1 (Lin-5 (Five) Interacting protein [Source:UniProtKB/TrEMBL;Acc:H2L0I3])

HSP 1 Score: 115.546 bits (288), Expect = 3.683e-25
Identity = 242/1075 (22.51%), Postives = 481/1075 (44.74%), Query Frame = 1
Query: 3730 IQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQL---------------SNK---ELREKLKTSEMQK---IDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQ-----VKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLR-KNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKR----------KGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXX------------------------EKGR-------VSSRNSVEF----NFSEDRKRVGRFGD--VNQY--SESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTG-ESYHEEERRGLIKAVDDAENRCTXXX----XXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPT 6711
            I +  G  +K + +++    D D+EI+  +     + ++       N  LK+ L+ A +  D+L + +++   K+R+   Q   L  EL D K N  + + +LE+ Q                +NK   EL   L+ +++ K    +++  L  L+N+L   E+  + L+  +   +     TEK R+      +  ++        + DT+  KL NE+     ++ T +                  E  A + EL K L Q L+  NE+++   +  + T     D++   ++  E+S+LN   +LE   +   +L S L + E R++ L+      D +R          + + NR+   H+ +    G+   +          P  +                              E GR       V+   SV F    +FS  R      G   +N    + +V      D   +   L+ +   I  +E ER+++         K+ ET   ++Q   R   ++ N  + EE+++ ++SRL SA+T L  QEE + + + ER+ +  K+   E Q    E + ++L E++  +RT  ++ H +     I+++ D E +            R  + +  + ++     E+E Q+L +++  L   +   +SK Q ++   D+L  +L + E  EN  +  +   + +  E+Q     ++D+L+  Q+ L  + + ++ L+  L +V+  + + K + H + +R+   Q++L ++ + K+ +E     + ++++  +  E +L+ ++  +  EK + T+ L  L   LA LE+ERR+  ++    +KEK +L K ++ LE EK R++ +I ++ L+R   ++    +E EN+ L++   +LQ Q+A+ E  +  RI+ELT++ + E   ++ R++      EK ++ RER+HR ++K LE+QI IL+DQL  E ++R   +++S   + NDI  + S +    N+    S D ++              +G S +            P S   SN L+   + S++PT
Sbjct: 1280 INSLYGQNQKIKDEWDDFRNDADKEIQKWKTDAYTVRSEAKALETTNTALKAQLQAANDRIDHLTKTVNDHTSKVRDLTSQVRHLEDELADTKGNLVQKEMDLESTQNRLRSLEDQHSTLQSDANKWRGELDAALRENDILKSNNTNMETDLTRLKNRLKSAEDALKELKNSLSHAK-----TEKERLQNAFREKTKQADHLNQLASQFDTKLTKLRNELQDTNDKLITSD-----------------TERNALRNELQK-LSQELKFGNEQIQRKSDEYQTTI----DDLAHSHRVSEDSRLNALQELEARKYEINDLTSRLDSTEQRLATLQQDYIKADSERDILSDALRRFQSSANRVINFHTFVDGGAGYVDGVPGGTSVIGGGPSAQRSGAYDPSSGGVIGSGISGGPGGSDFGREIEIGRGDSDQSDVAYPRSVPFPPSADFSSGRPGAASAGGRVINNLDGTTTVNMNGGFDIANLEGTLQSLLNKIEKLEMERNELRDTLARMKKKTTETHTTINQKETRYRNIEDNLQDAEEERRALESRLQSAKTLLRSQEEALKQRDEERRQMKSKMVAAELQARGKEAQLRHLNEQLKNLRTDLDNAHTD-----IRSLRDKEEQWDSSRFQLETKMRESDSDTNKYQLQIASFESERQILTEKIKELDGALRLSDSKVQDMKDDTDKLRRDLTKAESVENELRKTIDIQSKTSHEYQ----LLKDQLLNTQNELNGANNRKQQLENELLNVRSEVRDYKQRVHDVNNRVSELQRQLQDANTEKNRVEDRFLSVEKVVNTMRTTETDLRQQLETAKNEKRVATKELEDLKRRLAQLENERRNSSQLSDGWKKEKITLLKKIELLENEKRRTDAAIRETALQREAIEKSLNAMERENKELYKNCAQLQQQIAQLEMENGNRILELTNKQREEQERQLIRMRQEKGQIEKVIENRERTHRNRIKQLEDQIAILRDQLDGERRRRREYVDRS---MVNDIGRLGSNVLGIRNSYGDNSIDAII--------------NGGSRSVGFY--------PRSTFASNPLT-PPLGSSTPT 2292          
BLAST of Rootletin-2 vs. Ensembl Celegans
Match: lfi-1 (Lin-5 (Five) Interacting protein [Source:UniProtKB/TrEMBL;Acc:H2L0I3])

HSP 1 Score: 115.546 bits (288), Expect = 3.683e-25
Identity = 242/1075 (22.51%), Postives = 481/1075 (44.74%), Query Frame = 1
Query: 3730 IQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQL---------------SNK---ELREKLKTSEMQK---IDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQ-----VKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLR-KNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKR----------KGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXX------------------------EKGR-------VSSRNSVEF----NFSEDRKRVGRFGD--VNQY--SESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTG-ESYHEEERRGLIKAVDDAENRCTXXX----XXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPT 6711
            I +  G  +K + +++    D D+EI+  +     + ++       N  LK+ L+ A +  D+L + +++   K+R+   Q   L  EL D K N  + + +LE+ Q                +NK   EL   L+ +++ K    +++  L  L+N+L   E+  + L+  +   +     TEK R+      +  ++        + DT+  KL NE+     ++ T +                  E  A + EL K L Q L+  NE+++   +  + T     D++   ++  E+S+LN   +LE   +   +L S L + E R++ L+      D +R          + + NR+   H+ +    G+   +          P  +                              E GR       V+   SV F    +FS  R      G   +N    + +V      D   +   L+ +   I  +E ER+++         K+ ET   ++Q   R   ++ N  + EE+++ ++SRL SA+T L  QEE + + + ER+ +  K+   E Q    E + ++L E++  +RT  ++ H +     I+++ D E +            R  + +  + ++     E+E Q+L +++  L   +   +SK Q ++   D+L  +L + E  EN  +  +   + +  E+Q     ++D+L+  Q+ L  + + ++ L+  L +V+  + + K + H + +R+   Q++L ++ + K+ +E     + ++++  +  E +L+ ++  +  EK + T+ L  L   LA LE+ERR+  ++    +KEK +L K ++ LE EK R++ +I ++ L+R   ++    +E EN+ L++   +LQ Q+A+ E  +  RI+ELT++ + E   ++ R++      EK ++ RER+HR ++K LE+QI IL+DQL  E ++R   +++S   + NDI  + S +    N+    S D ++              +G S +            P S   SN L+   + S++PT
Sbjct: 1280 INSLYGQNQKIKDEWDDFRNDADKEIQKWKTDAYTVRSEAKALETTNTALKAQLQAANDRIDHLTKTVNDHTSKVRDLTSQVRHLEDELADTKGNLVQKEMDLESTQNRLRSLEDQHSTLQSDANKWRGELDAALRENDILKSNNTNMETDLTRLKNRLKSAEDALKELKNSLSHAK-----TEKERLQNAFREKTKQADHLNQLASQFDTKLTKLRNELQDTNDKLITSD-----------------TERNALRNELQK-LSQELKFGNEQIQRKSDEYQTTI----DDLAHSHRVSEDSRLNALQELEARKYEINDLTSRLDSTEQRLATLQQDYIKADSERDILSDALRRFQSSANRVINFHTFVDGGAGYVDGVPGGTSVIGGGPSAQRSGAYDPSSGGVIGSGISGGPGGSDFGREIEIGRGDSDQSDVAYPRSVPFPPSADFSSGRPGAASAGGRVINNLDGTTTVNMNGGFDIANLEGTLQSLLNKIEKLEMERNELRDTLARMKKKTTETHTTINQKETRYRNIEDNLQDAEEERRALESRLQSAKTLLRSQEEALKQRDEERRQMKSKMVAAELQARGKEAQLRHLNEQLKNLRTDLDNAHTD-----IRSLRDKEEQWDSSRFQLETKMRESDSDTNKYQLQIASFESERQILTEKIKELDGALRLSDSKVQDMKDDTDKLRRDLTKAESVENELRKTIDIQSKTSHEYQ----LLKDQLLNTQNELNGANNRKQQLENELLNVRSEVRDYKQRVHDVNNRVSELQRQLQDANTEKNRVEDRFLSVEKVVNTMRTTETDLRQQLETAKNEKRVATKELEDLKRRLAQLENERRNSSQLSDGWKKEKITLLKKIELLENEKRRTDAAIRETALQREAIEKSLNAMERENKELYKNCAQLQQQIAQLEMENGNRILELTNKQREEQERQLIRMRQEKGQIEKVIENRERTHRNRIKQLEDQIAILRDQLDGERRRRREYVDRS---MVNDIGRLGSNVLGIRNSYGDNSIDAII--------------NGGSRSVGFY--------PRSTFASNPLT-PPLGSSTPT 2292          
BLAST of Rootletin-2 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 75.8702 bits (185), Expect = 5.024e-13
Identity = 107/506 (21.15%), Postives = 217/506 (42.89%), Query Frame = 1
Query: 1945 SIADSTCAAVRSALHKRALQ-VQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDS----------NHRE-LDDIQRECERMRHTISMLEEDKLKL---------DKSRMNSYEE------CKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRN---LERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRA-LLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIR--EELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDA----------ERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIY--VLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNE 3327
            +I+ +T    R A +K+    + ++T  +N  +N+  +V     D       ++ + +  ++   +          N  E L ++ +  +R R ++  L E  L +         D   +   EE        S  Q  EK +T+  +L+  ++ + +  + LD+     E Q K  E L   + +++     LKE  S   +S N A +L+   +E   + +TD L + E  K E++            L+DK    E M H +   N     + +  E+ K R+  ++K+++ +    +  E  ++    ++  +  KD   Q+++    ++ NL D L      K Q++ A   L  E      E +Q  RD           + LS  V + +K+ E L K+    + QLT    +LR+  +A+   + +  K  LD S+ E  Q + +L+A+I+A   N+++   K S I  + + +  + +  ++ +  A+ +  ++LN+
Sbjct: 2159 NISSATIVGARLARNKKEFNDINEITKMLNDEENSFGNVFGDAQDILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQ---QLLKESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDK---REEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVE-AANAFSNLTDTLKN---AKAQIDNAYEALSAE--PAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQ----LEQLTELSEKLRKRKEAVKAGIPKYSKNTLD-SIDEKVQEVEKLKAEIDA---NIEETRAKISEIAGKAEEITEKANSAMEGIRLARRN-SVQLNK 2643          
BLAST of Rootletin-2 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 75.8702 bits (185), Expect = 5.029e-13
Identity = 107/506 (21.15%), Postives = 217/506 (42.89%), Query Frame = 1
Query: 1945 SIADSTCAAVRSALHKRALQ-VQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDS----------NHRE-LDDIQRECERMRHTISMLEEDKLKL---------DKSRMNSYEE------CKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRN---LERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRA-LLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIR--EELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDA----------ERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIY--VLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNE 3327
            +I+ +T    R A +K+    + ++T  +N  +N+  +V     D       ++ + +  ++   +          N  E L ++ +  +R R ++  L E  L +         D   +   EE        S  Q  EK +T+  +L+  ++ + +  + LD+     E Q K  E L   + +++     LKE  S   +S N A +L+   +E   + +TD L + E  K E++            L+DK    E M H +   N     + +  E+ K R+  ++K+++ +    +  E  ++    ++  +  KD   Q+++    ++ NL D L      K Q++ A   L  E      E +Q  RD           + LS  V + +K+ E L K+    + QLT    +LR+  +A+   + +  K  LD S+ E  Q + +L+A+I+A   N+++   K S I  + + +  + +  ++ +  A+ +  ++LN+
Sbjct: 2159 NISSATIVGARLARNKKEFNDINEITKMLNDEENSFGNVFGDAQDILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQ---QLLKESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDK---REEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVE-AANAFSNLTDTLKN---AKAQIDNAYEALSAE--PAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQ----LEQLTELSEKLRKRKEAVKAGIPKYSKNTLD-SIDEKVQEVEKLKAEIDA---NIEETRAKISEIAGKAEEITEKANSAMEGIRLARRN-SVQLNK 2643          
BLAST of Rootletin-2 vs. Ensembl Fly
Match: Root (gene:FBgn0039152 transcript:FBtr0339245)

HSP 1 Score: 277.33 bits (708), Expect = 2.327e-74
Identity = 476/2059 (23.12%), Postives = 961/2059 (46.67%), Query Frame = 1
Query:  685 QTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAE-------------------TDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIID-TDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVS--IADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAE-------RLSAAVQKSMKD---KEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQ-------RERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEA----TKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRN---SVEFNFSEDRKRVGRFGDVNQYSESVIPGS--DLDPEAVRIALRDITQHIVSIERERDDMEIK---AKNSALKSDETSVQLDQALQRINQLQKNFGE----VEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQE---------------IEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERR---DIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRR--LEDENEVLHRQVQKLQNQLAEAE----QCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRE---LNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNC 6615
            Q  +LR++L D+   Y+R+L      Q  QA L+ RLQ K++Q   R   +E+   +  K  + +        T     +  + + ++ L  +                    T        +  +L+EE  +   ++   + LR QL+E+   N+ LT D+Q+L+ + + L+ EL  K+ ++K++E  F  +   E NR+  +W  VV  KR F +++++ + ++ ++   I          C   D N  N       Q         Q + +     ++ +++  + Q Q+ +L  Q+       ES   E+ ++++ L    +L N +    D        +A      D  + ++ ++R+IAQ V+ D +  D           +++ TG +     +  +H  R  +          ++         RN +  S   A+ T +AV++ALHK  L + D+  K  +      + K QL+ SE  ++ L  +  +L  + DS++ +L ++ +E E ++  +  +   K + +  R +     ++   D EK++    +LQ+  +++ ++ + ++  ++R  K+      ++ + E +SSRL+EE  SL+E LNR  L +++LEQ+     + +N  E  K++ E   +K   E+  L++K  +L + +     E    +  + + + E+ +L  +      E   +++EL  ++  + EL        + ++ ++   E +  +L+ +  ++G +      + R++ AL+ EL++ R+  E       RL+  +++ +KD   K+V+    IDL  + T   H L E    +  L+ EKE L+  L+++  ++   E +   LE +LQ+   +   + +   RLQ E +   +K  + K  L      +E ++N+ +                  +    E ++ +  ++ + Q+ +  L+   + + E+L + + T+Q       ++ ++ L+ AE  KQ A+ +  ++K ++ E++  ++  L+T +  L+R+R E   R ++ +  I     ++ + R + E+  I  +  I+  +     L  ++    R +EELK  +++ E+  ++   +L +++ K +E E   + LR+EL D +R   +   E +    SNKELR+ +K  E  K +  R +++   K+S LE+ K  L+ E       L++TE       ++L   ++Q++K   E  +       LQ ++  +   +  A++E   +K+++ + EA    T++EL +   Q    N + E   +++E+   Q  +E     K LE+ K NLE  L       +EL + L   E RI  L+ Q++ ++  ++  E +L+++   LR++ G   Q+                      G V+  +   S    FS  R      GD +  S S  P    D+DP+ VR  +R++   +  +ERE+DD + +   AK     + +  ++ D  L ++  + +N  E    +E D+K    ++S+ Q    ++E+  HRN+ E + L +++ + E QLA    E    +ER++K R   S  + E+R L + +   E R ++LEL R  +EG+L RL+M   +K+   + + +R++   + ++ LE +  +L+ T+D+L   L ++   E   + ++  L   LSE     Q+ +DKL  +Q +L ++E+++R+L ERL+S + NL+E +      +D  +  Q+++ + E ++  +E +++    I    QE                E+EL  ++  S  EK+ L  +L +L   +  LE +R+        + + EK  +      +  E + NR +  +         F+       +E E   L  +V++L+  LAE E    +C A+  M  +++  + +  + DR +SA    EK L  RE+SHRQ+V  LE QI++L++QL+QE K+R+   L  +K+NR +++    ++S L  +  N+S+   D  L E E RR+   +S S   ++C
Sbjct:   94 QNQELRQRLADESHSYRRRLDTYKQAQHNQANLVSRLQSKIQQYRQRCSDLEERMHETIKPTAGVGPKLTTGPTNQVLCSTSLTLGQSSLPCSSSLDSPPPSCSRDYVDDVLVTGGGAGAAELCRKLEEEHQRCEQIVAQNSALRQQLEESNRTNEALTNDLQKLTNDWASLRDELLIKEDEFKEEEQAFKDYYNSEHNRLLKMWREVVAVKRSFKEMQTAMKAEVAKMGQEIN---------CVGKDINGSNATVAFAVQ---------QAKRAADDELKQSQRSNDELQNQLATLKVQY-------ESARHEIMERDQRLL---ELMNQLKKLEDRCAQAESQAALASRYSDEIERLNNSMREIAQAVVQDAENADREA--------DAEVTGGV-----MQHMHLTRDAASVVGGAGGAGSTAGGGGKSPRRNSTRASQAFAEGTISAVQAALHKYQLALHDMQVKFQNTSETLRTTKAQLETSEGTKQLLTTKMQQLTEKLDSSNSKLSELLQERESLQRGLDDIRVQKQQSEMGRADINSAFENLSSDYEKMQLNCGKLQKRIDSMEEDKKAVELEIQRILKDKNITELNLRSEEDRSSRLREETISLREELNRVSLNRDLLEQQRIESDNLINLLEKQKSDLEYDLDKLLLEKCDLQEKHEKLSNNSCSTSDELKSVQNCLQEAQEERKKLRIQSVDQCNEIGELKKELAILDKARLELETDNLSAGEKLKCLQLEKEKILQDLACVTRDRGDIHNQLTAMCRKKEALNEELMRTRQRLEQTTETNSRLNRNLEEMVKDVEEKQVV----IDLHEKDT---HRLNE---LLAALRSEKESLESVLFDTNTSLEATEERRSQLERDLQEALVREESLKNHVARLQKELEQCQRKAQETKTQLLNAARAAESDFNQKI-------ANLQACAEEAAKRHGEEILQLRNALEKRMQQALQALQTAKDDEIEKLQERLATLQAHLESLVQQHEEALIRAESEKQQALLIAHRDKQAVAERLEAVSRDLKTEQESLDRSRREANARDEKQRAAIAQLKDEMVQMRTKEEEHKIKLEECIRKQELQLSSLREERESLCRVSEELKMEIRLKEDRMESTNNELQDALRKSKEGEGFIDSLRKELTDCRRQLADSNIERDKYSGSNKELRDHVKRVESAKREQARAIEEALQKISNLEDTKNSLENERTRLSTILKETENHFTKTTQDLNATKAQLQKAQVEFAQKDEGGKELQCKLVAEVELKERAQQELCQIKKQLSDLEANLCATRQELGRARCQ----NNQEEHRFHAREQELAQRLEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGAEGRIRALDEQLSCVELHKRDTEQKLSSVVHTLRRIAGI--QV---------------------DGSVNLSHRLLSPSRRFSPSRS----CGDYDNRSTSQCPDGPIDVDPDLVRKGVRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAMLRNLQEEKSNLETDRK---MKISAIQA---LEEKLKHRND-ECQMLRERLAQTEMQLAATSEENGQNEERLEKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEGDLTRLQMALQEKDCSIRQMAERLENQNRALTQLEDRCTALKSTVDQLKERLQKSAVSETQLRGEIKTLQKELSEQGHCSQANEDKLKLVQKSLQTAENEKRILTERLDSAQTNLNELRRSQQAQLDGNQRLQEQVTDLEVQRSALESQLR----IAKWNQESGGDKDLTNGNGGGNGEEELSRQLKSSQREKSELRSKLQTLQDKVKQLECDRKSKFSGGNAYDRAEKSNSFYGGAAESGEFDSNRYD--VGGGNAGGGSFNCGLDHSVIEQETRDLRLKVRRLETLLAEKESELARCKAR--MNDSAKCHDGL--DGDRYRSAQMHAEKLLDAREQSHRQQVLRLENQISMLREQLAQEAKRRQQYILRSSKANREMQH----LRSTLGDSLRNVSQHPVDPHLLESESRRLDSAVSMSLPPSSC 2042          
BLAST of Rootletin-2 vs. Ensembl Fly
Match: Root (gene:FBgn0039152 transcript:FBtr0339244)

HSP 1 Score: 277.33 bits (708), Expect = 2.327e-74
Identity = 476/2059 (23.12%), Postives = 961/2059 (46.67%), Query Frame = 1
Query:  685 QTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAE-------------------TDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIID-TDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVS--IADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAE-------RLSAAVQKSMKD---KEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQ-------RERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEA----TKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRN---SVEFNFSEDRKRVGRFGDVNQYSESVIPGS--DLDPEAVRIALRDITQHIVSIERERDDMEIK---AKNSALKSDETSVQLDQALQRINQLQKNFGE----VEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQE---------------IEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERR---DIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRR--LEDENEVLHRQVQKLQNQLAEAE----QCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRE---LNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNC 6615
            Q  +LR++L D+   Y+R+L      Q  QA L+ RLQ K++Q   R   +E+   +  K  + +        T     +  + + ++ L  +                    T        +  +L+EE  +   ++   + LR QL+E+   N+ LT D+Q+L+ + + L+ EL  K+ ++K++E  F  +   E NR+  +W  VV  KR F +++++ + ++ ++   I          C   D N  N       Q         Q + +     ++ +++  + Q Q+ +L  Q+       ES   E+ ++++ L    +L N +    D        +A      D  + ++ ++R+IAQ V+ D +  D           +++ TG +     +  +H  R  +          ++         RN +  S   A+ T +AV++ALHK  L + D+  K  +      + K QL+ SE  ++ L  +  +L  + DS++ +L ++ +E E ++  +  +   K + +  R +     ++   D EK++    +LQ+  +++ ++ + ++  ++R  K+      ++ + E +SSRL+EE  SL+E LNR  L +++LEQ+     + +N  E  K++ E   +K   E+  L++K  +L + +     E    +  + + + E+ +L  +      E   +++EL  ++  + EL        + ++ ++   E +  +L+ +  ++G +      + R++ AL+ EL++ R+  E       RL+  +++ +KD   K+V+    IDL  + T   H L E    +  L+ EKE L+  L+++  ++   E +   LE +LQ+   +   + +   RLQ E +   +K  + K  L      +E ++N+ +                  +    E ++ +  ++ + Q+ +  L+   + + E+L + + T+Q       ++ ++ L+ AE  KQ A+ +  ++K ++ E++  ++  L+T +  L+R+R E   R ++ +  I     ++ + R + E+  I  +  I+  +     L  ++    R +EELK  +++ E+  ++   +L +++ K +E E   + LR+EL D +R   +   E +    SNKELR+ +K  E  K +  R +++   K+S LE+ K  L+ E       L++TE       ++L   ++Q++K   E  +       LQ ++  +   +  A++E   +K+++ + EA    T++EL +   Q    N + E   +++E+   Q  +E     K LE+ K NLE  L       +EL + L   E RI  L+ Q++ ++  ++  E +L+++   LR++ G   Q+                      G V+  +   S    FS  R      GD +  S S  P    D+DP+ VR  +R++   +  +ERE+DD + +   AK     + +  ++ D  L ++  + +N  E    +E D+K    ++S+ Q    ++E+  HRN+ E + L +++ + E QLA    E    +ER++K R   S  + E+R L + +   E R ++LEL R  +EG+L RL+M   +K+   + + +R++   + ++ LE +  +L+ T+D+L   L ++   E   + ++  L   LSE     Q+ +DKL  +Q +L ++E+++R+L ERL+S + NL+E +      +D  +  Q+++ + E ++  +E +++    I    QE                E+EL  ++  S  EK+ L  +L +L   +  LE +R+        + + EK  +      +  E + NR +  +         F+       +E E   L  +V++L+  LAE E    +C A+  M  +++  + +  + DR +SA    EK L  RE+SHRQ+V  LE QI++L++QL+QE K+R+   L  +K+NR +++    ++S L  +  N+S+   D  L E E RR+   +S S   ++C
Sbjct:   94 QNQELRQRLADESHSYRRRLDTYKQAQHNQANLVSRLQSKIQQYRQRCSDLEERMHETIKPTAGVGPKLTTGPTNQVLCSTSLTLGQSSLPCSSSLDSPPPSCSRDYVDDVLVTGGGAGAAELCRKLEEEHQRCEQIVAQNSALRQQLEESNRTNEALTNDLQKLTNDWASLRDELLIKEDEFKEEEQAFKDYYNSEHNRLLKMWREVVAVKRSFKEMQTAMKAEVAKMGQEIN---------CVGKDINGSNATVAFAVQ---------QAKRAADDELKQSQRSNDELQNQLATLKVQY-------ESARHEIMERDQRLL---ELMNQLKKLEDRCAQAESQAALASRYSDEIERLNNSMREIAQAVVQDAENADREA--------DAEVTGGV-----MQHMHLTRDAASVVGGAGGAGSTAGGGGKSPRRNSTRASQAFAEGTISAVQAALHKYQLALHDMQVKFQNTSETLRTTKAQLETSEGTKQLLTTKMQQLTEKLDSSNSKLSELLQERESLQRGLDDIRVQKQQSEMGRADINSAFENLSSDYEKMQLNCGKLQKRIDSMEEDKKAVELEIQRILKDKNITELNLRSEEDRSSRLREETISLREELNRVSLNRDLLEQQRIESDNLINLLEKQKSDLEYDLDKLLLEKCDLQEKHEKLSNNSCSTSDELKSVQNCLQEAQEERKKLRIQSVDQCNEIGELKKELAILDKARLELETDNLSAGEKLKCLQLEKEKILQDLACVTRDRGDIHNQLTAMCRKKEALNEELMRTRQRLEQTTETNSRLNRNLEEMVKDVEEKQVV----IDLHEKDT---HRLNE---LLAALRSEKESLESVLFDTNTSLEATEERRSQLERDLQEALVREESLKNHVARLQKELEQCQRKAQETKTQLLNAARAAESDFNQKI-------ANLQACAEEAAKRHGEEILQLRNALEKRMQQALQALQTAKDDEIEKLQERLATLQAHLESLVQQHEEALIRAESEKQQALLIAHRDKQAVAERLEAVSRDLKTEQESLDRSRREANARDEKQRAAIAQLKDEMVQMRTKEEEHKIKLEECIRKQELQLSSLREERESLCRVSEELKMEIRLKEDRMESTNNELQDALRKSKEGEGFIDSLRKELTDCRRQLADSNIERDKYSGSNKELRDHVKRVESAKREQARAIEEALQKISNLEDTKNSLENERTRLSTILKETENHFTKTTQDLNATKAQLQKAQVEFAQKDEGGKELQCKLVAEVELKERAQQELCQIKKQLSDLEANLCATRQELGRARCQ----NNQEEHRFHAREQELAQRLEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGAEGRIRALDEQLSCVELHKRDTEQKLSSVVHTLRRIAGI--QV---------------------DGSVNLSHRLLSPSRRFSPSRS----CGDYDNRSTSQCPDGPIDVDPDLVRKGVRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAMLRNLQEEKSNLETDRK---MKISAIQA---LEEKLKHRND-ECQMLRERLAQTEMQLAATSEENGQNEERLEKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEGDLTRLQMALQEKDCSIRQMAERLENQNRALTQLEDRCTALKSTVDQLKERLQKSAVSETQLRGEIKTLQKELSEQGHCSQANEDKLKLVQKSLQTAENEKRILTERLDSAQTNLNELRRSQQAQLDGNQRLQEQVTDLEVQRSALESQLR----IAKWNQESGGDKDLTNGNGGGNGEEELSRQLKSSQREKSELRSKLQTLQDKVKQLECDRKSKFSGGNAYDRAEKSNSFYGGAAESGEFDSNRYD--VGGGNAGGGSFNCGLDHSVIEQETRDLRLKVRRLETLLAEKESELARCKAR--MNDSAKCHDGL--DGDRYRSAQMHAEKLLDAREQSHRQQVLRLENQISMLREQLAQEAKRRQQYILRSSKANREMQH----LRSTLGDSLRNVSQHPVDPHLLESESRRLDSAVSMSLPPSSC 2042          
BLAST of Rootletin-2 vs. Ensembl Fly
Match: Root (gene:FBgn0039152 transcript:FBtr0304161)

HSP 1 Score: 277.33 bits (708), Expect = 2.327e-74
Identity = 476/2059 (23.12%), Postives = 961/2059 (46.67%), Query Frame = 1
Query:  685 QTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAE-------------------TDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIID-TDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVS--IADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAE-------RLSAAVQKSMKD---KEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQ-------RERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEA----TKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRN---SVEFNFSEDRKRVGRFGDVNQYSESVIPGS--DLDPEAVRIALRDITQHIVSIERERDDMEIK---AKNSALKSDETSVQLDQALQRINQLQKNFGE----VEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQE---------------IEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERR---DIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRR--LEDENEVLHRQVQKLQNQLAEAE----QCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRE---LNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNC 6615
            Q  +LR++L D+   Y+R+L      Q  QA L+ RLQ K++Q   R   +E+   +  K  + +        T     +  + + ++ L  +                    T        +  +L+EE  +   ++   + LR QL+E+   N+ LT D+Q+L+ + + L+ EL  K+ ++K++E  F  +   E NR+  +W  VV  KR F +++++ + ++ ++   I          C   D N  N       Q         Q + +     ++ +++  + Q Q+ +L  Q+       ES   E+ ++++ L    +L N +    D        +A      D  + ++ ++R+IAQ V+ D +  D           +++ TG +     +  +H  R  +          ++         RN +  S   A+ T +AV++ALHK  L + D+  K  +      + K QL+ SE  ++ L  +  +L  + DS++ +L ++ +E E ++  +  +   K + +  R +     ++   D EK++    +LQ+  +++ ++ + ++  ++R  K+      ++ + E +SSRL+EE  SL+E LNR  L +++LEQ+     + +N  E  K++ E   +K   E+  L++K  +L + +     E    +  + + + E+ +L  +      E   +++EL  ++  + EL        + ++ ++   E +  +L+ +  ++G +      + R++ AL+ EL++ R+  E       RL+  +++ +KD   K+V+    IDL  + T   H L E    +  L+ EKE L+  L+++  ++   E +   LE +LQ+   +   + +   RLQ E +   +K  + K  L      +E ++N+ +                  +    E ++ +  ++ + Q+ +  L+   + + E+L + + T+Q       ++ ++ L+ AE  KQ A+ +  ++K ++ E++  ++  L+T +  L+R+R E   R ++ +  I     ++ + R + E+  I  +  I+  +     L  ++    R +EELK  +++ E+  ++   +L +++ K +E E   + LR+EL D +R   +   E +    SNKELR+ +K  E  K +  R +++   K+S LE+ K  L+ E       L++TE       ++L   ++Q++K   E  +       LQ ++  +   +  A++E   +K+++ + EA    T++EL +   Q    N + E   +++E+   Q  +E     K LE+ K NLE  L       +EL + L   E RI  L+ Q++ ++  ++  E +L+++   LR++ G   Q+                      G V+  +   S    FS  R      GD +  S S  P    D+DP+ VR  +R++   +  +ERE+DD + +   AK     + +  ++ D  L ++  + +N  E    +E D+K    ++S+ Q    ++E+  HRN+ E + L +++ + E QLA    E    +ER++K R   S  + E+R L + +   E R ++LEL R  +EG+L RL+M   +K+   + + +R++   + ++ LE +  +L+ T+D+L   L ++   E   + ++  L   LSE     Q+ +DKL  +Q +L ++E+++R+L ERL+S + NL+E +      +D  +  Q+++ + E ++  +E +++    I    QE                E+EL  ++  S  EK+ L  +L +L   +  LE +R+        + + EK  +      +  E + NR +  +         F+       +E E   L  +V++L+  LAE E    +C A+  M  +++  + +  + DR +SA    EK L  RE+SHRQ+V  LE QI++L++QL+QE K+R+   L  +K+NR +++    ++S L  +  N+S+   D  L E E RR+   +S S   ++C
Sbjct:   94 QNQELRQRLADESHSYRRRLDTYKQAQHNQANLVSRLQSKIQQYRQRCSDLEERMHETIKPTAGVGPKLTTGPTNQVLCSTSLTLGQSSLPCSSSLDSPPPSCSRDYVDDVLVTGGGAGAAELCRKLEEEHQRCEQIVAQNSALRQQLEESNRTNEALTNDLQKLTNDWASLRDELLIKEDEFKEEEQAFKDYYNSEHNRLLKMWREVVAVKRSFKEMQTAMKAEVAKMGQEIN---------CVGKDINGSNATVAFAVQ---------QAKRAADDELKQSQRSNDELQNQLATLKVQY-------ESARHEIMERDQRLL---ELMNQLKKLEDRCAQAESQAALASRYSDEIERLNNSMREIAQAVVQDAENADREA--------DAEVTGGV-----MQHMHLTRDAASVVGGAGGAGSTAGGGGKSPRRNSTRASQAFAEGTISAVQAALHKYQLALHDMQVKFQNTSETLRTTKAQLETSEGTKQLLTTKMQQLTEKLDSSNSKLSELLQERESLQRGLDDIRVQKQQSEMGRADINSAFENLSSDYEKMQLNCGKLQKRIDSMEEDKKAVELEIQRILKDKNITELNLRSEEDRSSRLREETISLREELNRVSLNRDLLEQQRIESDNLINLLEKQKSDLEYDLDKLLLEKCDLQEKHEKLSNNSCSTSDELKSVQNCLQEAQEERKKLRIQSVDQCNEIGELKKELAILDKARLELETDNLSAGEKLKCLQLEKEKILQDLACVTRDRGDIHNQLTAMCRKKEALNEELMRTRQRLEQTTETNSRLNRNLEEMVKDVEEKQVV----IDLHEKDT---HRLNE---LLAALRSEKESLESVLFDTNTSLEATEERRSQLERDLQEALVREESLKNHVARLQKELEQCQRKAQETKTQLLNAARAAESDFNQKI-------ANLQACAEEAAKRHGEEILQLRNALEKRMQQALQALQTAKDDEIEKLQERLATLQAHLESLVQQHEEALIRAESEKQQALLIAHRDKQAVAERLEAVSRDLKTEQESLDRSRREANARDEKQRAAIAQLKDEMVQMRTKEEEHKIKLEECIRKQELQLSSLREERESLCRVSEELKMEIRLKEDRMESTNNELQDALRKSKEGEGFIDSLRKELTDCRRQLADSNIERDKYSGSNKELRDHVKRVESAKREQARAIEEALQKISNLEDTKNSLENERTRLSTILKETENHFTKTTQDLNATKAQLQKAQVEFAQKDEGGKELQCKLVAEVELKERAQQELCQIKKQLSDLEANLCATRQELGRARCQ----NNQEEHRFHAREQELAQRLEEGRGREKRLEDQKHNLEVCLADATQQIQELKARLGGAEGRIRALDEQLSCVELHKRDTEQKLSSVVHTLRRIAGI--QV---------------------DGSVNLSHRLLSPSRRFSPSRS----CGDYDNRSTSQCPDGPIDVDPDLVRKGVRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAMLRNLQEEKSNLETDRK---MKISAIQA---LEEKLKHRND-ECQMLRERLAQTEMQLAATSEENGQNEERLEKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEGDLTRLQMALQEKDCSIRQMAERLENQNRALTQLEDRCTALKSTVDQLKERLQKSAVSETQLRGEIKTLQKELSEQGHCSQANEDKLKLVQKSLQTAENEKRILTERLDSAQTNLNELRRSQQAQLDGNQRLQEQVTDLEVQRSALESQLR----IAKWNQESGGDKDLTNGNGGGNGEEELSRQLKSSQREKSELRSKLQTLQDKVKQLECDRKSKFSGGNAYDRAEKSNSFYGGAAESGEFDSNRYD--VGGGNAGGGSFNCGLDHSVIEQETRDLRLKVRRLETLLAEKESELARCKAR--MNDSAKCHDGL--DGDRYRSAQMHAEKLLDAREQSHRQQVLRLENQISMLREQLAQEAKRRQQYILRSSKANREMQH----LRSTLGDSLRNVSQHPVDPHLLESESRRLDSAVSMSLPPSSC 2042          
BLAST of Rootletin-2 vs. Ensembl Zebrafish
Match: crocc2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:ZFIN;Acc:ZDB-GENE-131121-625])

HSP 1 Score: 496.123 bits (1276), Expect = 4.201e-143
Identity = 552/1919 (28.76%), Postives = 1014/1919 (52.84%), Query Frame = 1
Query:  715 DDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDD-EATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATR-QLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDK--SRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKD--YKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSS----RNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRE 6441
            ++ R Y+ KL A  + Q +QA+L+++LQ KL Q + R G    L QQ  +  SE  +L+   Q+        +D + + L+  E + ++D+++ +  L +EQ +   L Q+ ALLR+QL++A   NQ LTE +Q+        + E EQ+D   + + E   SR    EQ R++SLW  V   +  F  +++  +R L  L+     ++  LR+AC NL+ +     +       T  N  S LE  L     E  + + ++  +   L+ + + +    + L  + ++KE  L  L    N M  +       ++D A R  L  +  ++HQ L +I Q+V  +V +                           +S H +           S  ++GS+  ++    + P+        AV+ AL +R  Q +DL + + +++    +++KQL   E++ R LEK+  EL+ E     R  +D  R+ ER R+++ ++  +K +L++  S M    EC   +Q  E L++ + ++QR ++ L    +DL+R L R+  E ER   ++E  E++ S +++E+ +LKE+L++  L+KEVLE EN  L  +L+K E   AE E+   K ++E+A L+D   ++ +++  L K+  E   ++ Q E+EK  L   ++  E E+   REEL R++ E  +L   K  L  S   ++++   L  E + L  EK  ++  +    +++ A+  +L    R+ E  +A +QK+ K+++ LA++K +L  QLT+ + + +  A  +  L+ E+E L+ SL + Q+  S LEA  + L+     L++    +  E   +Q E + ++ +  + K++L++KL ++E+   ++L + +++ +E +      +E +  E    +E+ + Q + E  +LR +  R  ++L +++  +Q+   + LL+AE  KQ  ++  E EK ++ E+I  L   +  +  + +R R +   + +QD++T      +L   R +FE+     +   ++L    +EL  Q     +E E LK  L   EE+RD  R++L E+  ++RE    ++  RRE +D KR   +  +E E I  SN ELR  LK  E +   ++R  ++   +L++LEE K  LQ+EV   R N+++ EK+R+  RREL+ELR QVK L+ +  +   E+S +Q R+  +E +E E R+E F L+QKV+ESEA KE   K+     R   ELEE  + +EK  +Q  D  L+D   K  EE    LE  L+ +     E   +++  E R   LE Q+   D KR+  E+RL  ++S LR+ +G R+               R      E+GR  S    R+ V+     D   VG    V   S S     +LD +AV++ L    Q +   ++ERD+   +  + + + +      +++   I  L+++  E+EE K+ +   L   Q +L++++E + R E + + + +++ K+++    +ETE K LQ+++++ +  E   E ERR L +  +  + R  +L+L RRGLEGELQR ++   + E E   L++R++ L +++ D E +A  L++  +RL+  LA  E +E+  KDK+  L  SL++   +  + +D+ VQLQ  L++SEH+++++QE+L+  +  L+ ++ QNH L +R+++ Q+   E E +  E++ + + L + + QRQ+ EQE Q        + + L E++ +L  +   L+ E+ D+E+  ++  K+++SLK+TL+K+E  + + E  I     +R + ++  R LE+E      ++  LQ+Q++  E  H+QR++E+++R K E+  E +R++ +   TE+ L+ RE++HRQ+V  LEEQ++ LK+QL QE+K+R+
Sbjct:  126 EEGRSYRLKLQAYQESQHRQAQLVQKLQAKLLQYKKRCG---NLEQQVLEKTSESEKLRLSLQS-------HLDSSAHRLQRFEQEHSLDVQNKLALLDDEQKRCSGLSQVNALLREQLEQANETNQALTESLQKA-------RDEAEQRDTRLRRELEMNTSRN-SREQVRVRSLWRQVAFLRSSFTQLRAFADRSLSDLQAEYAATSHRLRVACLNLEASKSQSCT-------TASNGVSALETQLRDKLREAMQLQARFDAEKVELSSRILELGEMVKQLRAQNSEKESNLIALRSNLNKMETN------RSEDRAERDALRSEISSLHQILHNINQVVSGEVSR-------------------------DCSSKHEH-----------SFISAGSISSSQ---REGPL-------IAVQKALLQRQTQTEDLQACLEASQEQVVTLQKQLHVEEDKTRTLEKRLQELQQENQLLERAEEDSTRDAERYRNSLGIITSEKGELERQLSAMQQQLECTQTEQ--EGLRSSSLDVQRQRDLLRQQREDLERQLARERSESERGRHTLEQLEARYSDVRKELVTLKEALSQLSLQKEVLEDENRSLAQALSKAEAQNAEQELALTKLRSEDAGLQDSLAKMGALSEGLAKDKVELNRLLLQAEAEKAELGERRREAELERMAAREELARLQQELLDLTAEKRALEASHNYLQEAKMTLDAEYNLLQREKSSVQEQHAQASKQKQAVQEQLNACHREMELSAALLQKTYKERDELARDKANLTVQLTSEQRKSKALAQDLAALRAERESLESSLLDRQELASSLEAIRDRLDGENASLQQANKSLTRELSSVQSELEQQMSRALQEKQALELKLAQAERNAQEMLITTQQSHQEQLHTERKHKERMHAELCAQREQAESQLRAECKELRIQSRRVLQQLQEDLAKLQQHCTESLLQAESHKQQVLSEKEAEKATLIERIITLERDMEAAALEKDRMRRDFLSKQEQDKDTASGLQAELHNLRSRFEESLSSREVSERSLNEQIRELSTQWQGAHQEAERLKRELSEVEESRDTGRKELIEAHRELRECLQDKDEQRREGLDLKRALGDAVREKEAINTSNHELRTALKRVEFENNSLKRVGEEKDQRLTVLEECKSSLQQEVLKLRTNMRELEKSRLQARRELQELRRQVKTLEGQCTQQGQELSDMQARLTQEEQREEEMRKETFTLRQKVLESEAGKEAALKEAAGLQRHIAELEEA-HQQEKELQQQRDASLQDSQLKQREEVA-RLEGALQESQAQLREFGLSVNLAEARAQGLEEQLAQNDAKRRDLEHRLNVLNSTLRRTLGSRR--------------GRQSPTPGERGRSPSPWRTRSPVKGEIISDETGVGGL-PVCSLSPSRREDGELDLDAVQMLLHSFQQELRDTQKERDESHAQVHSLSKQVENLQANQERSNTCIQMLRQSIRELEEGKRELAKHLEGMQASLVLRDEAVQRGETQNRIMNEELAKMKKSQLIIETEAKALQDKLERSQASEESLEAERRRLKETCEAVDARAARLDLKRRGLEGELQRAQLRTTEMEAEASSLQERLNNLRRELGDSEERAALLKVECERLATALAHKELQESQLKDKLQALTASLTDSNASAGTARDQAVQLQRALSASEHNQKMVQEKLDKTREALTHSRKQNHDLSERLQSLQRSQEECELKVSELDKQTRVLQETVRQRQQAEQEAQESCLLLQEQNSQLQEQVATLQTTAHRLQGEKSDLERTLLRLGKDRSSLKRTLEKVEHNRQKKEVEILHGEREREQQEQKIRNLEEELNETQAEIHTLQSQISILEHTHSQRLLEVSARHKQELDLESERMRDSQQQTERALEAREKAHRQRVHCLEEQVSTLKEQLEQEMKRRQ 1948          
BLAST of Rootletin-2 vs. Ensembl Zebrafish
Match: crocc2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:ZFIN;Acc:ZDB-GENE-131121-625])

HSP 1 Score: 225.328 bits (573), Expect = 1.910e-59
Identity = 282/984 (28.66%), Postives = 514/984 (52.24%), Query Frame = 1
Query: 2629 SMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKD--YKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSS----RNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLS 5562
            +++  L K+  E   ++ Q E+EK  L   ++  E E+   REEL R++ E  +L   K  L  S   ++++   L  E + L  EK  ++  +    +++ A+  +L    R+ E  +A +QK+ K+++ LA++K +L  QLT+ + + +  A  +  L+ E+E L+ SL + Q+  S LEA  + L+     L++    +  E   +Q E + ++ +  + K++L++KL ++E+   ++L + +++ +E +      +E +  E    +E+ + Q + E  +LR +  R  ++L +++  +Q+   + LL+AE  KQ  ++  E EK ++ E+I  L   +  +  + +R R +   + +QD++T      +L   R +FE+     +   ++L    +EL  Q     +E E LK  L   EE+RD  R++L E+  ++RE    ++  RRE +D KR   +  +E E I  SN ELR  LK  E +   ++R  ++   +L++LEE K  LQ+EV   R N+++ EK+R+  RREL+ELR QVK L+ +  +   E+S +Q R+  +E +E E R+E F L+QKV+ESEA KE   K+     R   ELEE  + +EK  +Q  D  L+D   K  EE    LE  L+ +     E   +++  E R   LE Q+   D KR+  E+RL  ++S LR+ +G R+               R      E+GR  S    R+ V+     D   VG    V   S S     +LD +AV++ L    Q +   ++ERD+   +  + + + +      +++   I  L+++  E+EE K+ +   L   Q +L++++E + R E + + + +++ K+++    +ETE K LQ+++++ +  E   E ERR L +  +  + R  +L+L RRGLEGELQR ++   + E E   L++R++ L +++ D E +A  L++ +  LS
Sbjct:    3 ALSEGLAKDKVELNRLLLQAEAEKAELGERRREAELERMAAREELARLQQELLDLTAEKRALEASHNYLQEAKMTLDAEYNLLQREKSSVQEQHAQASKQKQAVQEQLNACHREMELSAALLQKTYKERDELARDKANLTVQLTSEQRKSKALAQDLAALRAERESLESSLLDRQELASSLEAIRDRLDGENASLQQANKSLTRELSSVQSELEQQMSRALQEKQALELKLAQAERNAQEMLITTQQSHQEQLHTERKHKERMHAELCAQREQAESQLRAECKELRIQSRRVLQQLQEDLAKLQQHCTESLLQAESHKQQVLSEKEAEKATLIERIITLERDMEAAALEKDRMRRDFLSKQEQDKDTASGLQAELHNLRSRFEESLSSREVSERSLNEQIRELSTQWQGAHQEAERLKRELSEVEESRDTGRKELIEAHRELRECLQDKDEQRREGLDLKRALGDAVREKEAINTSNHELRTALKRVEFENNSLKRVGEEKDQRLTVLEECKSSLQQEVLKLRTNMRELEKSRLQARRELQELRRQVKTLEGQCTQQGQELSDMQARLTQEEQREEEMRKETFTLRQKVLESEAGKEAALKEAAGLQRHIAELEEA-HQQEKELQQQRDASLQDSQLKQREEVA-RLEGALQESQAQLREFGLSVNLAEARAQGLEEQLAQNDAKRRDLEHRLNVLNSTLRRTLGSRR--------------GRQSPTPGERGRSPSPWRTRSPVKGEIISDETGVGGL-PVCSLSPSRREDGELDLDAVQMLLHSFQQELRDTQKERDESHAQVHSLSKQVENLQANQERSNTCIQMLRQSIRELEEGKRELAKHLEGMQASLVLRDEAVQRGETQNRIMNEELAKMKKSQLIIETEAKALQDKLERSQASEESLEAERRRLKETCEAVDARAARLDLKRRGLEGELQRAQLRTTEMEAEASSLQERLNNLRRELGDSEERAALLKVCVCVLS 969          
BLAST of Rootletin-2 vs. Ensembl Zebrafish
Match: si:dkey-230p4.1 (si:dkey-230p4.1 [Source:ZFIN;Acc:ZDB-GENE-081104-380])

HSP 1 Score: 85.1149 bits (209), Expect = 1.410e-17
Identity = 68/269 (25.28%), Postives = 127/269 (47.21%), Query Frame = 1
Query:  487 ENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSN 1293
            E A L+  L  +++EL   + ER+ L  +  A+ ++L++T         R                        LD++ RE+++KL    + + +QA LI +LQ K+     R    + L QQ       +   +          + R D                LES +  L+EEQ +S+ L +++ALLR QL ++T AN+ L +D+++L+ + S    E+ QK++DW+ ++   + ++  E +R+ +LW  VV  +RQ + +K++ 
Sbjct:   12 ERAELRAELSRLQDELAESRAEREELDSRAQALTDRLSQTLDPSLSSSVR------------------------LDEEQREWRKKLREGREREARQALLIHKLQHKVLDYRAR---CQALEQQA------VGEERELRIRERILRDERSDT---------------LESTLIRLEEEQQRSLGLSEVSALLRSQLSQSTEANEALRDDLRKLTADWSKAVEEVVQKEIDWQKEKEVLTGYIGKEHSRLMTLWGRVVTLRRQCHSLKTAT 232          
BLAST of Rootletin-2 vs. Ensembl Zebrafish
Match: si:dkey-230p4.1 (si:dkey-230p4.1 [Source:ZFIN;Acc:ZDB-GENE-081104-380])

HSP 1 Score: 90.5077 bits (223), Expect = 2.721e-17
Identity = 71/280 (25.36%), Postives = 135/280 (48.21%), Query Frame = 1
Query:  487 ENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNI 1326
            E A L+  L  +++EL   + ER+ L  +  A+ ++L++T         R                        LD++ RE+++KL    + + +QA LI +LQ K+     R    + L QQ       +   +          + R D                LES +  L+EEQ +S+ L +++ALLR QL ++T AN+ L +D+++L+ + S    E+ QK++DW+ ++   + ++  E +R+ +LW  VV  +RQ + +K++ ++DL +L+ + 
Sbjct:   12 ERAELRAELSRLQDELAESRAEREELDSRAQALTDRLSQTLDPSLSSSVR------------------------LDEEQREWRKKLREGREREARQALLIHKLQHKVLDYRAR---CQALEQQA------VGEERELRIRERILRDERSDT---------------LESTLIRLEEEQQRSLGLSEVSALLRSQLSQSTEANEALRDDLRKLTADWSKAVEEVVQKEIDWQKEKEVLTGYIGKEHSRLMTLWGRVVTLRRQCHSLKTATDKDLWELKADF 243          
BLAST of Rootletin-2 vs. Ensembl Xenopus
Match: pgm2 (phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1006723])

HSP 1 Score: 535.798 bits (1379), Expect = 3.753e-156
Identity = 597/2072 (28.81%), Postives = 1095/2072 (52.85%), Query Frame = 1
Query:  307 PQKMPEVVK---DIILRDFGDTDEDE-------DSIKDLRMPKPN------SQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGR-NGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLII----DTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKG----QLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRM--KATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRE 6441
            P K+  V++   D++L + G + ED        +  +D   P P       +QN +  S   +  + L+    L+ EN +L+D L  +E+ L   ++ER++L+I+  A+NEKL + + + + G+                    + LR++  ++   YKRKL+A  + Q +QA+L++RLQ K+ Q + R   L ++L ++ S+  SE  RL          L  R+D AE  L   + + +++L + +  L EEQ +S SL Q+   LR+Q+++    N+ LTE+++RL+ +      +L+Q++ +W+ +   ++ +L  E + I +LW      + QF D++   ER L +++ +I +S++ +  AC NLD+N   RLSQ          + ++LE  L     +  + ++Q+  +   LN +   ++   E L +E + KEK                +  I  N    T Q +     + D++ Q L  I Q+   DV     SP   D    ES  TG      + N +   +SVSP        F+S  + R    R +SP   ++    AV++ L +   + ++L S++ +A+++    KKQ    E  +   E    EL+ E    +  L+ +++E +R +++I +L  +K  +++S     ++ +    + E+LK +N EL R +E L +  ++L+R  +R  KE+ER  +  E  E K S LK+++ +++ESL++  LE++VL+ E   +  +L+K E  +AE E+  N+  +E A L D   ++ ++N  L ++      +I Q E E+  L  +++A E     ++E+   +E+E  +L   + GL +  +  E+ ++  +++L  ++ E+G    QL  AN  +Q     L  +L ++RR+ +   +A+Q++ +  E L  +  +L  QL   E E +E+ +    L+ +KE L+ +LYE+Q+  +QLE + E LE  +  L   +  +  E QR   E +  L  L + K +++++L ++E+     L ++ +  ++ ++RL  E+E LR   +  K++   + ++E +DL       K++L+ EI+ +Q ER++ LL+ E  KQ A+ L E EK S+ EK+      L  ++ ++ER R E +I+ +QD+ ++     +LK  +  FE     H +E KNL+   K+L  ++    +E EEL++ L++AE++RD+LR+D+ E    +RE E+  E  R+E ++ +R+  ++ +E ET+Q SN ELR  +K  E ++  +Q  +++ Q ++S+L+E K   ++E    R  L+D E++ ++ RR+L+ELR QVK L  E  +   EV+ LQ R+  +E KE ++RRE+  L+Q++ ESE+ +E   +++    +    LE     +EK  +Q   E     + L+E+  +L+ QL+       +    L   E R+  LE +++     R+ AE+ +  ++S LR+ IG R +     R  S + G  S   SP +GRV+  +      S DR R               P  +L+PE V+ ALRD  Q +   +RERD+  I+  +   + +++    ++   +  +LQ+   +++E ++G + RL +A T + + ++ +  +E ER++  +++ +LE  L   E E +  Q+R+ + R  E+  E E +GL + ++ +ENR T+LEL +R LEGEL+R +M   ++E E Q L++R   L +Q+ D E +  SLQ  + RL++ L+R ++ E   ++K   L  +L E      ++Q+ + +LQ  L ++E DRRVLQERL+SV+  LS++K  N  L   +  +  Q E M    R+ + + +  + + I  Q++E EQ        + +E   + E+L  L    A +E ++++I+   +  EK  N+L+ TLDK+++E+ R E    +  +++ +       L  +     RQ Q LQ Q+ E E+ H QR+ME++ R + E+ SE +R  S     E TL+ RERSHRQ+V+ LEEQIN L++QL QE+++R+
Sbjct:    8 PMKLETVIQHLEDVVL-NPGSSVEDRALSVRSGEGERDALTPVPARIREIVTQNLREDSAYMSPESHLN--LSLQEENRSLQDELLRMEDLLSLTRSEREDLSIRNQALNEKLEQ-YQSHRSGE----------------TEAVLDLRQRFHEEEMAYKRKLSAYQEGQQRQAQLVQRLQDKVLQYKRRCRELEQQLLEKTSE--SEQQRLA---------LQARLDSAETKLNRMDQNHSLELNNALTRLDEEQQRSSSLAQVNNTLREQMEQLKTTNEKLTEEIKRLTSDLHKSHEDLDQREAEWRKERQNYTFYLSNEHSGILTLWRKAAALRSQFLDMRGITERGLAEIKTDISRSSRRMHTACLNLDSNL--RLSQSAAGASL---HTARLEQQLRDKVRQMMQLQSQWDAEKVELNSRVSELSLQTEKLVRENSKKEK----------------EKQILENSGCDTLQELEGVREECDSLQQVLSSITQMCQTDV-----SP---DPTCVES--TG----VSATNEM--RQSVSPLFV-----FSSSPIRRRSPTRMRSPQR-SELALKAVQNVLQRHQDREKELHSELAAARDSLEQTKKQ---QEKNQHVSEAHTEELKKENKEINTILESVKQELQRCQNSIELLTREKEDMEESLQTIKQKAEGSLLETERLKAVNAELLRQREALEEQKEELNRERDRSQKELERGQRIQEQLEEKVSILKKDLVTVRESLSQTALERDVLQGEKEAVASALSKAESSRAELELALNQMHSERATLTDSLAKMGALNEGLAQDKVALNRVILQLEGERAALHEDRRAGEANCAALKEQQEALEHEVSQLQADRVGLERRCREAEEKHKRQEEQLLGVHKERGKLQDQLAQANTLVQ----TLQDQLKESRREMDLQGSALQRAAQRMEELTSQNAELGVQLAALEDERQEHEEEFAQLRAQKESLESTLYETQRRAAQLEDRREQLEGEIHTLTLVKQSLQVETQRQALEAEEALAGLRQQKVTVELQLAQTEQAAQLSLSNQSQQHQDTVDRLKREKESLRLTMIADKQDSVQRLEKEKEDLLFDRENVKQKLSAEILRLQEEREESLLKVESEKQKALLLKETEKNSLSEKLMNTQRELSDTKMEMERCRREAQIKQEQDKTSLDNVLSELKALQSDFEDAVSAHSKENKNLRDRMKQLSQERESLNKEVEELRTQLRLAEDSRDSLRRDIIEVQRLLREKEEICESQRKETLELRRDVGDLTRERETLQKSNTELRACIKKIESERSSLQVAMEEKQQRISVLQEGKSCAEREAAHLRATLRDVERSHIEARRQLQELRRQVKTLGGESSQKEQEVAELQARIQQEEQKEQQSRRESLELRQRITESESEREAARREILTLQQHLSALESSSRQREKELEQRLSESRAGEQRLQEACKSLQEQLQRCTSESGDSRLQLGAFEARVRALEAELSKSQASRREAESHVNGLYSALRRTIGVRGRSPSPRRALSSTKGLDSSHGSPMEGRVTPSSR---GVSPDRSRS--------------PYPELEPELVKQALRDFMQELRDTQRERDEAGIQVLSLRRQLEDSINSCERLQSQQQKLQRQLADLQEGQRGTEERLGTAHTEMRLLQDNLRHSEAERQASGERIMELEHSLRICEDENRDFQDRLSRARNAENRQELECKGLREVLEASENRGTELELRKRSLEGELERTRMSLAEREAEVQTLQERAHHLQEQLKDSEDREASLQTEVQRLNLALSRAQDGERQLQEKSQGLTQALGEATAGRGNLQEDVSRLQGALTAAEQDRRVLQERLDSVRQALSDSKRHNLRLSQTIQEQQQQLEEMHLNCRELQAQLQDLQQTLIKQQQREEEQ------GAALLE---VQEKLKMLQGDKAQVELDKQEIQHSAVLLEKGNNTLRATLDKVKREQLRIEGEAQRLSVEKEQLSHSVISLRKDLAEAQRQNQYLQEQMTEMERSHTQRLMEVSLRHRQELDSESNRAHSIQQQVESTLESRERSHRQRVRGLEEQINSLQEQLEQEVRRRQ 1972          
BLAST of Rootletin-2 vs. Ensembl Xenopus
Match: pgm2 (phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1006723])

HSP 1 Score: 533.102 bits (1372), Expect = 2.514e-155
Identity = 582/1999 (29.11%), Postives = 1066/1999 (53.33%), Query Frame = 1
Query:  478 LKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGR-NGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLII----DTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKG----QLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRM--KATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRE 6441
            L+ EN +L+D L  +E+ L   ++ER++L+I+  A+NEKL + + + + G+                    + LR++  ++   YKRKL+A  + Q +QA+L++RLQ K+ Q + R   L ++L ++ S+  SE  RL          L  R+D AE  L   + + +++L + +  L EEQ +S SL Q+   LR+Q+++    N+ LTE+++RL+ +      +L+Q++ +W+ +   ++ +L  E + I +LW      + QF D++   ER L +++ +I +S++ +  AC NLD+N   RLSQ          + ++LE  L     +  + ++Q+  +   LN +   ++   E L +E + KEK                +  I  N    T Q +     + D++ Q L  I Q+   DV     SP   D    ES  TG      + N +   +SVSP        F+S  + R    R +SP   ++    AV++ L +   + ++L S++ +A+++    KKQ    E  +   E    EL+ E    +  L+ +++E +R +++I +L  +K  +++S     ++ +    + E+LK +N EL R +E L +  ++L+R  +R  KE+ER  +  E  E K S LK+++ +++ESL++  LE++VL+ E   +  +L+K E  +AE E+  N+  +E A L D   ++ ++N  L ++      +I Q E E+  L  +++A E     ++E+   +E+E  +L   + GL +  +  E+ ++  +++L  ++ E+G    QL  AN  +Q     L  +L ++RR+ +   +A+Q++ +  E L  +  +L  QL   E E +E+ +    L+ +KE L+ +LYE+Q+  +QLE + E LE  +  L   +  +  E QR   E +  L  L + K +++++L ++E+     L ++ +  ++ ++RL  E+E LR   +  K++   + ++E +DL       K++L+ EI+ +Q ER++ LL+ E  KQ A+ L E EK S+ EK+      L  ++ ++ER R E +I+ +QD+ ++     +LK  +  FE     H +E KNL+   K+L  ++    +E EEL++ L++AE++RD+LR+D+ E    +RE E+  E  R+E ++ +R+  ++ +E ET+Q SN ELR  +K  E ++  +Q  +++ Q ++S+L+E K   ++E    R  L+D E++ ++ RR+L+ELR QVK L  E  +   EV+ LQ R+  +E KE ++RRE+  L+Q++ ESE+ +E   +++    +    LE     +EK  +Q   E     + L+E+  +L+ QL+       +    L   E R+  LE +++     R+ AE+ +  ++S LR+ IG R +     R  S + G  S   SP +GRV+  +      S DR R               P  +L+PE V+ ALRD  Q +   +RERD+  I+  +   + +++    ++   +  +LQ+   +++E ++G + RL +A T + + ++ +  +E ER++  +++ +LE  L   E E +  Q+R+ + R  E+  E E +GL + ++ +ENR T+LEL +R LEGEL+R +M   ++E E Q L++R   L +Q+ D E +  SLQ  + RL++ L+R ++ E   ++K   L  +L E      ++Q+ + +LQ  L ++E DRRVLQERL+SV+  LS++K  N  L   +  +  Q E M    R+ + + +  + + I  Q++E EQ        + +E   + E+L  L    A +E ++++I+   +  EK  N+L+ TLDK+++E+ R E    +  +++ +       L  +     RQ Q LQ Q+ E E+ H QR+ME++ R + E+ SE +R  S     E TL+ RERSHRQ+V+ LEEQIN L++QL QE+++R+
Sbjct:   73 LQEENRSLQDELLRMEDLLSLTRSEREDLSIRNQALNEKLEQ-YQSHRSGE----------------TEAVLDLRQRFHEEEMAYKRKLSAYQEGQQRQAQLVQRLQDKVLQYKRRCRELEQQLLEKTSE--SEQQRLA---------LQARLDSAETKLNRMDQNHSLELNNALTRLDEEQQRSSSLAQVNNTLREQMEQLKTTNEKLTEEIKRLTSDLHKSHEDLDQREAEWRKERQNYTFYLSNEHSGILTLWRKAAALRSQFLDMRGITERGLAEIKTDISRSSRRMHTACLNLDSNL--RLSQSAAGASL---HTARLEQQLRDKVRQMMQLQSQWDAEKVELNSRVSELSLQTEKLVRENSKKEK----------------EKQILENSGCDTLQELEGVREECDSLQQVLSSITQMCQTDV-----SP---DPTCVES--TG----VSATNEM--RQSVSPLFV-----FSSSPIRRRSPTRMRSPQR-SELALKAVQNVLQRHQDREKELHSELAAARDSLEQTKKQ---QEKNQHVSEAHTEELKKENKEINTILESVKQELQRCQNSIELLTREKEDMEESLQTIKQKAEGSLLETERLKAVNAELLRQREALEEQKEELNRERDRSQKELERGQRIQEQLEEKVSILKKDLVTVRESLSQTALERDVLQGEKEAVASALSKAESSRAELELALNQMHSERATLTDSLAKMGALNEGLAQDKVALNRVILQLEGERAALHEDRRAGEANCAALKEQQEALEHEVSQLQADRVGLERRCREAEEKHKRQEEQLLGVHKERGKLQDQLAQANTLVQ----TLQDQLKESRREMDLQGSALQRAAQRMEELTSQNAELGVQLAALEDERQEHEEEFAQLRAQKESLESTLYETQRRAAQLEDRREQLEGEIHTLTLVKQSLQVETQRQALEAEEALAGLRQQKVTVELQLAQTEQAAQLSLSNQSQQHQDTVDRLKREKESLRLTMIADKQDSVQRLEKEKEDLLFDRENVKQKLSAEILRLQEEREESLLKVESEKQKALLLKETEKNSLSEKLMNTQRELSDTKMEMERCRREAQIKQEQDKTSLDNVLSELKALQSDFEDAVSAHSKENKNLRDRMKQLSQERESLNKEVEELRTQLRLAEDSRDSLRRDIIEVQRLLREKEEICESQRKETLELRRDVGDLTRERETLQKSNTELRACIKKIESERSSLQVAMEEKQQRISVLQEGKSCAEREAAHLRATLRDVERSHIEARRQLQELRRQVKTLGGESSQKEQEVAELQARIQQEEQKEQQSRRESLELRQRITESESEREAARREILTLQQHLSALESSSRQREKELEQRLSESRAGEQRLQEACKSLQEQLQRCTSESGDSRLQLGAFEARVRALEAELSKSQASRREAESHVNGLYSALRRTIGVRGRSPSPRRALSSTKGLDSSHGSPMEGRVTPSSR---GVSPDRSRS--------------PYPELEPELVKQALRDFMQELRDTQRERDEAGIQVLSLRRQLEDSINSCERLQSQQQKLQRQLADLQEGQRGTEERLGTAHTEMRLLQDNLRHSEAERQASGERIMELEHSLRICEDENRDFQDRLSRARNAENRQELECKGLREVLEASENRGTELELRKRSLEGELERTRMSLAEREAEVQTLQERAHHLQEQLKDSEDREASLQTEVQRLNLALSRAQDGERQLQEKSQGLTQALGEATAGRGNLQEDVSRLQGALTAAEQDRRVLQERLDSVRQALSDSKRHNLRLSQTIQEQQQQLEEMHLNCRELQAQLQDLQQTLIKQQQREEEQ------GAALLE---VQEKLKMLQGDKAQVELDKQEIQHSAVLLEKGNNTLRATLDKVKREQLRIEGEAQRLSVEKEQLSHSVISLRKDLAEAQRQNQYLQEQMTEMERSHTQRLMEVSLRHRQELDSESNRAHSIQQQVESTLESRERSHRQRVRGLEEQINSLQEQLEQEVRRRQ 1967          
BLAST of Rootletin-2 vs. Ensembl Xenopus
Match: pgm2 (phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1006723])

HSP 1 Score: 527.324 bits (1357), Expect = 1.826e-153
Identity = 588/2071 (28.39%), Postives = 1080/2071 (52.15%), Query Frame = 1
Query:  307 PQKMPEVVK---DIILRDFGDTDEDE-------DSIKDLRMPKPN------SQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLII----DTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKG----QLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRM--KATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRE 6441
            P K+  V++   D++L + G + ED        +  +D   P P       +QN +  S   +  + L+    L+ EN +L+D L  +E+ L   ++ER++L+I+  A+NEKL + + + + G+                    + LR++  ++   YKRKL+A  + Q +QA+L++RLQ KL+                                       R+D AE  L   + + +++L + +  L EEQ +S SL Q+   LR+Q+++    N+ LTE+++RL+ +      +L+Q++ +W+ +   ++ +L  E + I +LW      + QF D++   ER L +++ +I +S++ +  AC NLD+N   RLSQ          + ++LE  L     +  + ++Q+  +   LN +   ++   E L +E + KEK                +  I  N    T Q +     + D++ Q L  I Q+   DV     SP   D    ES  TG      + N +   +SVSP        F+S  + R    R +SP   ++    AV++ L +   + ++L S++ +A+++    KKQ    E  +   E    EL+ E    +  L+ +++E +R +++I +L  +K  +++S     ++ +    + E+LK +N EL R +E L +  ++L+R  +R  KE+ER  +  E  E K S LK+++ +++ESL++  LE++VL+ E   +  +L+K E  +AE E+  N+  +E A L D   ++ ++N  L ++      +I Q E E+  L  +++A E     ++E+   +E+E  +L   + GL +  +  E+ ++  +++L  ++ E+G    QL  AN  +Q     L  +L ++RR+ +   +A+Q++ +  E L  +  +L  QL   E E +E+ +    L+ +KE L+ +LYE+Q+  +QLE + E LE  +  L   +  +  E QR   E +  L  L + K +++++L ++E+     L ++ +  ++ ++RL  E+E LR   +  K++   + ++E +DL       K++L+ EI+ +Q ER++ LL+ E  KQ A+ L E EK S+ EK+      L  ++ ++ER R E +I+ +QD+ ++     +LK  +  FE     H +E KNL+   K+L  ++    +E EEL++ L++AE++RD+LR+D+ E    +RE E+  E  R+E ++ +R+  ++ +E ET+Q SN ELR  +K  E ++  +Q  +++ Q ++S+L+E K   ++E    R  L+D E++ ++ RR+L+ELR QVK L  E  +   EV+ LQ R+  +E KE ++RRE+  L+Q++ ESE+ +E   +++    +    LE     +EK  +Q   E     + L+E+  +L+ QL+       +    L   E R+  LE +++     R+ AE+ +  ++S LR+ IG R +     R  S + G  S   SP +GRV+  +      S DR R               P  +L+PE V+ ALRD  Q +   +RERD+  I+  +   + +++    ++   +  +LQ+   +++E ++G + RL +A T + + ++ +  +E ER++  +++ +LE  L   E E +  Q+R+ + R  E+  E E +GL + ++ +ENR T+LEL +R LEGEL+R +M   ++E E Q L++R   L +Q+ D E +  SLQ  + RL++ L+R ++ E   ++K   L  +L E      ++Q+ + +LQ  L ++E DRRVLQERL+SV+  LS++K  N  L   +  +  Q E M    R+ + + +  + + I  Q++E EQ        + +E   + E+L  L    A +E ++++I+   +  EK  N+L+ TLDK+++E+ R E    +  +++ +       L  +     RQ Q LQ Q+ E E+ H QR+ME++ R + E+ SE +R  S     E TL+ RERSHRQ+V+ LEEQIN L++QL QE+++R+
Sbjct:    8 PMKLETVIQHLEDVVL-NPGSSVEDRALSVRSGEGERDALTPVPARIREIVTQNLREDSAYMSPESHLN--LSLQEENRSLQDELLRMEDLLSLTRSEREDLSIRNQALNEKLEQ-YQSHRSGE----------------TEAVLDLRQRFHEEEMAYKRKLSAYQEGQQRQAQLVQRLQDKLQA--------------------------------------RLDSAETKLNRMDQNHSLELNNALTRLDEEQQRSSSLAQVNNTLREQMEQLKTTNEKLTEEIKRLTSDLHKSHEDLDQREAEWRKERQNYTFYLSNEHSGILTLWRKAAALRSQFLDMRGITERGLAEIKTDISRSSRRMHTACLNLDSNL--RLSQSAAGASL---HTARLEQQLRDKVRQMMQLQSQWDAEKVELNSRVSELSLQTEKLVRENSKKEK----------------EKQILENSGCDTLQELEGVREECDSLQQVLSSITQMCQTDV-----SP---DPTCVES--TG----VSATNEM--RQSVSPLFV-----FSSSPIRRRSPTRMRSP-QRSELALKAVQNVLQRHQDREKELHSELAAARDSLEQTKKQ---QEKNQHVSEAHTEELKKENKEINTILESVKQELQRCQNSIELLTREKEDMEESLQTIKQKAEGSLLETERLKAVNAELLRQREALEEQKEELNRERDRSQKELERGQRIQEQLEEKVSILKKDLVTVRESLSQTALERDVLQGEKEAVASALSKAESSRAELELALNQMHSERATLTDSLAKMGALNEGLAQDKVALNRVILQLEGERAALHEDRRAGEANCAALKEQQEALEHEVSQLQADRVGLERRCREAEEKHKRQEEQLLGVHKERGKLQDQLAQANTLVQ----TLQDQLKESRREMDLQGSALQRAAQRMEELTSQNAELGVQLAALEDERQEHEEEFAQLRAQKESLESTLYETQRRAAQLEDRREQLEGEIHTLTLVKQSLQVETQRQALEAEEALAGLRQQKVTVELQLAQTEQAAQLSLSNQSQQHQDTVDRLKREKESLRLTMIADKQDSVQRLEKEKEDLLFDRENVKQKLSAEILRLQEEREESLLKVESEKQKALLLKETEKNSLSEKLMNTQRELSDTKMEMERCRREAQIKQEQDKTSLDNVLSELKALQSDFEDAVSAHSKENKNLRDRMKQLSQERESLNKEVEELRTQLRLAEDSRDSLRRDIIEVQRLLREKEEICESQRKETLELRRDVGDLTRERETLQKSNTELRACIKKIESERSSLQVAMEEKQQRISVLQEGKSCAEREAAHLRATLRDVERSHIEARRQLQELRRQVKTLGGESSQKEQEVAELQARIQQEEQKEQQSRRESLELRQRITESESEREAARREILTLQQHLSALESSSRQREKELEQRLSESRAGEQRLQEACKSLQEQLQRCTSESGDSRLQLGAFEARVRALEAELSKSQASRREAESHVNGLYSALRRTIGVRGRSPSPRRALSSTKGLDSSHGSPMEGRVTPSSR---GVSPDRSRS--------------PYPELEPELVKQALRDFMQELRDTQRERDEAGIQVLSLRRQLEDSINSCERLQSQQQKLQRQLADLQEGQRGTEERLGTAHTEMRLLQDNLRHSEAERQASGERIMELEHSLRICEDENRDFQDRLSRARNAENRQELECKGLREVLEASENRGTELELRKRSLEGELERTRMSLAEREAEVQTLQERAHHLQEQLKDSEDREASLQTEVQRLNLALSRAQDGERQLQEKSQGLTQALGEATAGRGNLQEDVSRLQGALTAAEQDRRVLQERLDSVRQALSDSKRHNLRLSQTIQEQQQQLEEMHLNCRELQAQLQDLQQTLIKQQQREEEQ------GAALLE---VQEKLKMLQGDKAQVELDKQEIQHSAVLLEKGNNTLRATLDKVKREQLRIEGEAQRLSVEKEQLSHSVISLRKDLAEAQRQNQYLQEQMTEMERSHTQRLMEVSLRHRQELDSESNRAHSIQQQVESTLESRERSHRQRVRGLEEQINSLQEQLEQEVRRRQ 1944          
BLAST of Rootletin-2 vs. Ensembl Xenopus
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:100486658])

HSP 1 Score: 417.542 bits (1072), Expect = 1.116e-119
Identity = 317/878 (36.10%), Postives = 504/878 (57.40%), Query Frame = 1
Query: 3487 HRLNRDKEELA-----------QEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKE-LENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPG--------SDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNS 6060
            HRL +++EEL            +EI  +Q+ERD+ LL+AE  KQ A+++ E EK S+ EK+S     L     +LER + + +IR +QD+ TI   N +LK  R Q E+  + HDRE+K L    +E L         E EELK+ L + E+ RD +R++L E+  ++RE ++  E  ++E M+ +R   +  KE E +Q SN+ELR  ++ +E ++I ++R  ++ + +LS+LEE +   +KEV D R +L+D E++R++ RREL++LR Q+K LD E  K   +++ +Q R++T E +E E+RR+NF LKQK++E+EA +E   K+L    RK  E+E     +E+  +   DE   + K L ++  NLE +L+       +L   LS  E R+  LE +++ L+  ++  E +L ++HS LR+ +G                           GR     S  +         GR G     +    P         +D+DPE VR ALRD  Q +   ERERD++  +   S     E   + D A+ R+ QLQK   E EE K+ +D +L   QT L++QEET+ R ERERK   +K   LER L   E E++  Q++++K++  E+ +E ERR L + +D +E+R T+LEL RRGLEGELQR K+   D+E E Q ++ R++AL +Q+SD E +  +LQL ++RL+  LA+ +E E + K+KV  L  +LS+      S  DKL QLQ  L  SEH+RR+LQERLE+ +  ++E K QN  L+++ +  + E  E E ++ E+EG+++++ +IL QRQE E      + +   E+ +L ERL  L  ++  LESE+R++E+  ++ EK+KN+
Sbjct:  470 HRLTQEREELVARHEMEREEMSEEIAALQQERDESLLQAEFEKQQALSVKESEKASLSEKLSHAQHGLSGLSLELERHKRDSQIRQEQDRGTILALNSELKGLRGQLEEALVLHDRELKGLNDKSREPLGLDLIGCCLEVEELKTQLCVVEDARDAVRRELIEAHRRVREGQELLEGHKKENMELRRALGDEAKEKEAVQKSNEELRGAVRRAESERISLKRSNEEKEQRLSVLEEARGASEKEVNDLRSSLRDVERSRLEARRELQDLRRQLKLLDDESIKRSRDMAEVQARLSTYEQREEESRRDNFTLKQKLMETEAGREAARKELSALQRKVAEVEGEFGVRERELQGSLDEARGNEKKLLDNTRNLEIKLQAAQEESGQLGLRLSASEGRVHGLEAELSRLEGLKREVEFKLGSLHSALRRTLGI--------------------------GRAGRTPSPAYR--------GRSGSPKSKTPERPPSPTRGEQLVADIDPEVVRAALRDFLQELRDTERERDELRTQLGTSNRHLAEMEAERDGAITRVQQLQKVLSECEEAKRNVDGKLGGLQTTLILQEETLRRYERERKLAQEKAASLERSLQAAEGEQRAAQDKMNKIKANEAKYENERRRLKEVLDASESRNTKLELSRRGLEGELQRHKLVLADREAEMQEMQQRMEALQRQLSDSEGRVGTLQLCVERLNSTLAKAQESETSLKEKVQSLTGALSDSNCTSASSHDKLNQLQKVLTGSEHERRILQERLEAARQAVAEGKKQNVALMEQNQVLRDEQAEGELQRAELEGQVRQMQEILRQRQESEGASLRNVQKLQEEREVLQERLCGLQRAVVQLESEKREVERSSMRLEKDKNA 1313          

HSP 2 Score: 209.534 bits (532), Expect = 1.503e-53
Identity = 151/402 (37.56%), Postives = 242/402 (60.20%), Query Frame = 1
Query: 2014 LTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQL--ETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQL 3213
            L  ++++ +    S++KQL D+ENERR LE++  +L+ E D      +D +R+  R+R+ I  L  +K  L+KS  N  EE    +Q+ EKL+  N +LQR ++ L +  +D+ R+ ER  + V+R  K+ E  E K S L++E+  +KESL++  LE+EV E E   ++ +L+K E   AE E+  N+ +TEEA LRD   ++ ++N  L ++ +E   II Q E E+  L G+K  +EQEK  IR+EL+R+E EK EL+  + GL  S+Q +E++ E L  E+  L  E+GQL  +   V+L     ++  +L+Q+RRD E  S  + ++ ++KE L K+K  L+ QLT  E E R  A+ I VL+ EKE L+ +L+E+QQ +  + ++ E LE   Q L
Sbjct:   23 LRGRLDAGQETVGSLRKQLSDNENERRALEQKIQQLQQERDVMGGAKEDAERDVTRLRNHIEQLNGEKGALEKSLQNLQEELNGQRQENEKLQLANSDLQRQRDLLQEEKEDVCRDRERALQNVDRGHKAQEQLEVKLSALRKELVVVKESLHKCSLEREVSEAERVDVSQALSKAETRLAELELTLNRQRTEEASLRDALSKMSALNESLAQDKTELSRIIAQLEEERAHLQGQKHEVEQEKASIRDELVRLEQEKLELDTERFGLDNSLQAMEQNREKLLQEVQALRKERGQLQEQLGQVSLL----SIRDDLVQSRRDVELQSECLLRASREKEELMKDKGSLVVQLTASERESRALAEEIAVLRTEKEALETALFEAQQQLIHVTSRKEQLEVESQNL 420          
BLAST of Rootletin-2 vs. Ensembl Xenopus
Match: ENSXETT00000012599.1 (centrosomal protein 250 [Source:NCBI gene;Acc:100498015])

HSP 1 Score: 82.4185 bits (202), Expect = 1.139e-14
Identity = 43/140 (30.71%), Postives = 80/140 (57.14%), Query Frame = 1
Query:  982 DLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQL 1401
            +LE  + +L+EEQ +  +L  + ALLR+ L     AN+ L  D+ +L+ + +    EL+ K+ DW+ +   ++  + GE +R+  +W  VV F+R F ++KS+ ERDL  +R +  +    ++  CS+L +  ++ L  L
Sbjct:   63 ELERALQKLEEEQQRCENLAAVNALLREDLGHTQEANKVLCNDMHKLTADWTSALQELKHKENDWEQEREHYNSLMKGEHSRLLRIWTEVVTFRRHFRELKSATERDLSSVRADWSRCLCLIQSCCSSLKSYKIHGLPVL 202          
BLAST of Rootletin-2 vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 776.163 bits (2003), Expect = 0.000e+0
Identity = 674/2028 (33.23%), Postives = 1114/2028 (54.93%), Query Frame = 1
Query:  460 LDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSL-SKMKEEFRKTETQYQKQIES--LNEQFVHVNRSNESLTKELADKEKV-------LTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVD---QVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNK-SPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQ------EKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGD---------VNQYSESVIPG-------SDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKK 6435
            + S+  L+ EN  L+  L  VE+ L + + ERD LAIK+NA+NE+L +          R+     E      L  Q+++LR+QL ++   Y+RKL A  + Q +QA+L++RLQ K+ Q            +Q S+L  ++             ++R  ++ +  L+  +T+ + DL+S +  L+EEQ +S SL Q+ A+LR+QLD+A  ANQ L+ED+++++ + +    ELEQ++  W+ +E +F+ +   E +R+  LW  V+  +RQ +++K   ERDL QL   + +++++++     L  +     S+ +  L+ +K   +QLE  L +K+  E    + Q Q  ++   L+ +   +  S E L  + ++K++V       L  L  LR      LD                D + + Q LRD+AQ  ++D +   Q+  S    D       + G      S+      R+ +P R S           R R  R   SP     ST   + SALHKR LQVQD+  +  +++    SV+KQL DSE ERR LE+Q   LR +  ++ +  +D QRE +R+R    +L  +K  L  S   + ++ K  +Q++EKL+    EL+R    L D  +D  +   R  +E+ER  + +E  E K S L +E+  ++E+L+ A+L+++VL+ E + + ++L K E  +A+ E+   K + EEA LRD   ++ ++N  L ++  E   +I Q E EK  L G ++  E       EK  + E+L R+E E E     + GL  S+   E++ E L+ ++  L  E+  L+     L R+ +    EL QA R+++R   A++++ ++KE +AKE+  L  +L   E E R  ++    L+ EKE L+ SL++ Q+ ++QLEA+ E LE++ Q L   +  +  E   L+ +     +K +  KE +  KL ++E+E    LR ++ A EED++RL  E+E    E    + +++ Q Q+E ++L  R+  +KEEL++EI  +Q+ERD+ LL AE  KQ A++L E EK ++ EK+      L     ++ER + + + R +QD+NT+     +L+  R Q E+    H + +K L+     L  Q+   MRE EEL++ L++ E+TRD LR++L E+  K R+++D  E  R+E  + +R+  E  KE E ++ SN+ELR  +K +E ++I ++   +D + KL++LEE +  + KE  + R +LQ+ E++R++ RREL+ELR Q+K LD++ G+L  E++ LQ R+A  E  E E+RRE  GL+Q++++ E++ E L ++L  S RK +E E    ++E+      +E     K L +S  +LE +LE       EL   LS  E R   LE ++  ++ +R+ AE +L  + S LR+ +G                           GRVSS  + E          G  GD          +  S+   PG        DLDPEAVR ALRD  Q + S +RERD+++++    + +  E   + D A  R  QLQK   E EE  +  D RLS AQ  L +QEE++ R++RE ++ +D++  LER L   E+E +  QE+V KM+  E+  E ++R L + +D +E+R  +LEL RR LEGELQR ++G  D+E   Q L+DRVD+L +Q++D E KA +LQLT++RLS  LA+ EE E   + KV  L  +L++   +L S QDK + LQ  L++ EHDR+VLQERL++ +  LSEA+ Q+ +L ++++  + EL   E ++ + EG++++L Q L QRQE E      + +   E+ LL ERL SL  +LA LE+E+RD+E+  ++ +K++ +L+KTLDK+E+EK RS E   +   +R   D      E +     +Q+Q L+ Q+  A + +   +       + E+  E++RL+SA   TE+TL+ RER+HRQ+V  LEEQ++ LK QL QEL++
Sbjct:   75 MASLLSLQEENQLLQQELSRVEDLLAQSRAERDELAIKYNAVNERLEQAV--------RLETGELEAQEPRGLVRQSVELRRQLQEEQSSYRRKLQAYQEGQQRQAQLVQRLQAKILQY----------KKQCSELEKQL-------------MDRSTELEQQRLR--DTEHSQDLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLRLQEQTTLDTE--------------DGEGLQQTLRDLAQAALSDTESGVQLSSSERTADT------SDG------SLRGFSGQRTPTPPRHSP---------GRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQL-RLEQEVE-----RQGLQGSLCVAEQAREALEQQILVLRSERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL--------------------------GRVSSSPAREAP-------AGGSGDGLSSPSPLEYSPRSQPPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1995          
BLAST of Rootletin-2 vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 634/1900 (33.37%), Postives = 1052/1900 (55.37%), Query Frame = 1
Query:  844 LNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSL-SKMKEEFRKTETQYQKQIES--LNEQFVHVNRSNESLTKELADKEKV-------LTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVD---QVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNK-SPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQ------EKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGD---------VNQYSESVIPG-------SDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKK 6435
            L ++N  L+ E+SR+++    + ++ +  + I  N +   +T+ + DL+S +  L+EEQ +S SL Q+ A+LR+QLD+A  ANQ L+ED+++++ + +    ELEQ++  W+ +E +F+ +   E +R+  LW  V+  +RQ +++K   ERDL QL   + +++++++     L  +     S+ +  L+ +K   +QLE  L +K+  E    + Q Q  ++   L+ +   +  S E L  + ++K++V       L  L  LR      LD                D + + Q LRD+AQ  ++D +   Q+  S    D       + G      S+      R+ +P R S           R R  R   SP     ST   + SALHKR LQVQD+  +  +++    SV+KQL DSE ERR LE+Q   LR +  ++ +  +D QRE +R+R    +L  +K  L  S   + ++ K  +Q++EKL+    EL+R    L D  +D  +   R  +E+ER  + +E  E K S L +E+  ++E+L+ A+L+++VL+ E + + ++L K E  +A+ E+   K + EEA LRD   ++ ++N  L ++  E   +I Q E EK  L G ++  E       EK  + E+L R+E E E     + GL  S+   E++ E L+ ++  L  E+  L+     L R+ +    EL QA R+++R   A++++ ++KE +AKE+  L  +L   E E R  ++    L+ EKE L+ SL++ Q+ ++QLEA+ E LE++ Q L   +  +  E   L+ +     +K +  KE +  KL ++E+E    LR ++ A EED++RL  E+E    E    + +++ Q Q+E ++L  R+  +KEEL++EI  +Q+ERD+ LL AE  KQ A++L E EK ++ EK+      L     ++ER + + + R +QD+NT+     +L+  R Q E+    H + +K L+     L  Q+   MRE EEL++ L++ E+TRD LR++L E+  K R+++D  E  R+E  + +R+  E  KE E ++ SN+ELR  +K +E ++I ++   +D + KL++LEE +  + KE  + R +LQ+ E++R++ RREL+ELR Q+K LD++ G+L  E++ LQ R+A  E  E E+RRE  GL+Q++++ E++ E L ++L  S RK +E E    ++E+      +E     K L +S  +LE +LE       EL   LS  E R   LE ++  ++ +R+ AE +L  + S LR+ +G                           GRVSS  + E          G  GD          +  S+   PG        DLDPEAVR ALRD  Q + S +RERD+++++    + +  E   + D A  R  QLQK   E EE  +  D RLS AQ  L +QEE++ R++RE ++ +D++  LER L   E+E +  QE+V KM+  E+  E ++R L + +D +E+R  +LEL RR LEGELQR ++G  D+E   Q L+DRVD+L +Q++D E KA +LQLT++RLS  LA+ EE E   + KV  L  +L++   +L S QDK + LQ  L++ EHDR+VLQERL++ +  LSEA+ Q+ +L ++++  + EL   E ++ + EG++++L Q L QRQE E      + +   E+ LL ERL SL  +LA LE+E+RD+E+  ++ +K++ +L+KTLDK+E+EK RS E   +   +R   D      E +     +Q+Q L+ Q+  A + +   +       + E+  E++RL+SA   TE+TL+ RER+HRQ+V  LEEQ++ LK QL QEL++
Sbjct:    7 LQEENQLLQQELSRVEDLLAQSRAERDE-LAIKYNAVNERDTEHSQDLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLRLQEQTTLDTE--------------DGEGLQQTLRDLAQAALSDTESGVQLSSSERTADT------SDG------SLRGFSGQRTPTPPRHSP---------GRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQL-RLEQEVE-----RQGLQGSLCVAEQAREALEQQILVLRSERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL--------------------------GRVSSSPAREAP-------AGGSGDGLSSPSPLEYSPRSQPPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1831          
BLAST of Rootletin-2 vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 634/1900 (33.37%), Postives = 1052/1900 (55.37%), Query Frame = 1
Query:  844 LNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSL-SKMKEEFRKTETQYQKQIES--LNEQFVHVNRSNESLTKELADKEKV-------LTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVD---QVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNK-SPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQ------EKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGD---------VNQYSESVIPG-------SDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKK 6435
            L ++N  L+ E+SR+++    + ++ +  + I  N +   +T+ + DL+S +  L+EEQ +S SL Q+ A+LR+QLD+A  ANQ L+ED+++++ + +    ELEQ++  W+ +E +F+ +   E +R+  LW  V+  +RQ +++K   ERDL QL   + +++++++     L  +     S+ +  L+ +K   +QLE  L +K+  E    + Q Q  ++   L+ +   +  S E L  + ++K++V       L  L  LR      LD                D + + Q LRD+AQ  ++D +   Q+  S    D       + G      S+      R+ +P R S           R R  R   SP     ST   + SALHKR LQVQD+  +  +++    SV+KQL DSE ERR LE+Q   LR +  ++ +  +D QRE +R+R    +L  +K  L  S   + ++ K  +Q++EKL+    EL+R    L D  +D  +   R  +E+ER  + +E  E K S L +E+  ++E+L+ A+L+++VL+ E + + ++L K E  +A+ E+   K + EEA LRD   ++ ++N  L ++  E   +I Q E EK  L G ++  E       EK  + E+L R+E E E     + GL  S+   E++ E L+ ++  L  E+  L+     L R+ +    EL QA R+++R   A++++ ++KE +AKE+  L  +L   E E R  ++    L+ EKE L+ SL++ Q+ ++QLEA+ E LE++ Q L   +  +  E   L+ +     +K +  KE +  KL ++E+E    LR ++ A EED++RL  E+E    E    + +++ Q Q+E ++L  R+  +KEEL++EI  +Q+ERD+ LL AE  KQ A++L E EK ++ EK+      L     ++ER + + + R +QD+NT+     +L+  R Q E+    H + +K L+     L  Q+   MRE EEL++ L++ E+TRD LR++L E+  K R+++D  E  R+E  + +R+  E  KE E ++ SN+ELR  +K +E ++I ++   +D + KL++LEE +  + KE  + R +LQ+ E++R++ RREL+ELR Q+K LD++ G+L  E++ LQ R+A  E  E E+RRE  GL+Q++++ E++ E L ++L  S RK +E E    ++E+      +E     K L +S  +LE +LE       EL   LS  E R   LE ++  ++ +R+ AE +L  + S LR+ +G                           GRVSS  + E          G  GD          +  S+   PG        DLDPEAVR ALRD  Q + S +RERD+++++    + +  E   + D A  R  QLQK   E EE  +  D RLS AQ  L +QEE++ R++RE ++ +D++  LER L   E+E +  QE+V KM+  E+  E ++R L + +D +E+R  +LEL RR LEGELQR ++G  D+E   Q L+DRVD+L +Q++D E KA +LQLT++RLS  LA+ EE E   + KV  L  +L++   +L S QDK + LQ  L++ EHDR+VLQERL++ +  LSEA+ Q+ +L ++++  + EL   E ++ + EG++++L Q L QRQE E      + +   E+ LL ERL SL  +LA LE+E+RD+E+  ++ +K++ +L+KTLDK+E+EK RS E   +   +R   D      E +     +Q+Q L+ Q+  A + +   +       + E+  E++RL+SA   TE+TL+ RER+HRQ+V  LEEQ++ LK QL QEL++
Sbjct:    7 LQEENQLLQQELSRVEDLLAQSRAERDE-LAIKYNAVNERDTEHSQDLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLRLQEQTTLDTE--------------DGEGLQQTLRDLAQAALSDTESGVQLSSSERTADT------SDG------SLRGFSGQRTPTPPRHSP---------GRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQL-RLEQEVE-----RQGLQGSLCVAEQAREALEQQILVLRSERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL--------------------------GRVSSSPAREAP-------AGGSGDGLSSPSPLEYSPRSQPPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1831          
BLAST of Rootletin-2 vs. Ensembl Mouse
Match: Crocc (ciliary rootlet coiled-coil, rootletin [Source:MGI Symbol;Acc:MGI:3529431])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 634/1900 (33.37%), Postives = 1052/1900 (55.37%), Query Frame = 1
Query:  844 LNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSL-SKMKEEFRKTETQYQKQIES--LNEQFVHVNRSNESLTKELADKEKV-------LTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVD---QVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNK-SPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQ------EKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGD---------VNQYSESVIPG-------SDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKK 6435
            L ++N  L+ E+SR+++    + ++ +  + I  N +   +T+ + DL+S +  L+EEQ +S SL Q+ A+LR+QLD+A  ANQ L+ED+++++ + +    ELEQ++  W+ +E +F+ +   E +R+  LW  V+  +RQ +++K   ERDL QL   + +++++++     L  +     S+ +  L+ +K   +QLE  L +K+  E    + Q Q  ++   L+ +   +  S E L  + ++K++V       L  L  LR      LD                D + + Q LRD+AQ  ++D +   Q+  S    D       + G      S+      R+ +P R S           R R  R   SP     ST   + SALHKR LQVQD+  +  +++    SV+KQL DSE ERR LE+Q   LR +  ++ +  +D QRE +R+R    +L  +K  L  S   + ++ K  +Q++EKL+    EL+R    L D  +D  +   R  +E+ER  + +E  E K S L +E+  ++E+L+ A+L+++VL+ E + + ++L K E  +A+ E+   K + EEA LRD   ++ ++N  L ++  E   +I Q E EK  L G ++  E       EK  + E+L R+E E E     + GL  S+   E++ E L+ ++  L  E+  L+     L R+ +    EL QA R+++R   A++++ ++KE +AKE+  L  +L   E E R  ++    L+ EKE L+ SL++ Q+ ++QLEA+ E LE++ Q L   +  +  E   L+ +     +K +  KE +  KL ++E+E    LR ++ A EED++RL  E+E    E    + +++ Q Q+E ++L  R+  +KEEL++EI  +Q+ERD+ LL AE  KQ A++L E EK ++ EK+      L     ++ER + + + R +QD+NT+     +L+  R Q E+    H + +K L+     L  Q+   MRE EEL++ L++ E+TRD LR++L E+  K R+++D  E  R+E  + +R+  E  KE E ++ SN+ELR  +K +E ++I ++   +D + KL++LEE +  + KE  + R +LQ+ E++R++ RREL+ELR Q+K LD++ G+L  E++ LQ R+A  E  E E+RRE  GL+Q++++ E++ E L ++L  S RK +E E    ++E+      +E     K L +S  +LE +LE       EL   LS  E R   LE ++  ++ +R+ AE +L  + S LR+ +G                           GRVSS  + E          G  GD          +  S+   PG        DLDPEAVR ALRD  Q + S +RERD+++++    + +  E   + D A  R  QLQK   E EE  +  D RLS AQ  L +QEE++ R++RE ++ +D++  LER L   E+E +  QE+V KM+  E+  E ++R L + +D +E+R  +LEL RR LEGELQR ++G  D+E   Q L+DRVD+L +Q++D E KA +LQLT++RLS  LA+ EE E   + KV  L  +L++   +L S QDK + LQ  L++ EHDR+VLQERL++ +  LSEA+ Q+ +L ++++  + EL   E ++ + EG++++L Q L QRQE E      + +   E+ LL ERL SL  +LA LE+E+RD+E+  ++ +K++ +L+KTLDK+E+EK RS E   +   +R   D      E +     +Q+Q L+ Q+  A + +   +       + E+  E++RL+SA   TE+TL+ RER+HRQ+V  LEEQ++ LK QL QEL++
Sbjct:    7 LQEENQLLQQELSRVEDLLAQSRAERDE-LAIKYNAVNERDTEHSQDLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLRLQEQTTLDTE--------------DGEGLQQTLRDLAQAALSDTESGVQLSSSERTADT------SDG------SLRGFSGQRTPTPPRHSP---------GRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQL-RLEQEVE-----RQGLQGSLCVAEQAREALEQQILVLRSERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL--------------------------GRVSSSPAREAP-------AGGSGDGLSSPSPLEYSPRSQPPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1831          
BLAST of Rootletin-2 vs. Ensembl Mouse
Match: Crocc2 (ciliary rootlet coiled-coil, rootletin family member 2 [Source:MGI Symbol;Acc:MGI:3045962])

HSP 1 Score: 156.762 bits (395), Expect = 1.693e-37
Identity = 173/640 (27.03%), Postives = 310/640 (48.44%), Query Frame = 1
Query: 3445 EIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGR---FGDVNQYSESVIPGS-DLDPEA-------VRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQA------LQ-RINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMR 5310
            E   ++ E+  +L  R   D+E L  EI  +++ERD+ LL+ E   Q A++L + EK  + +++S        +  +LER R E + +  Q + T+ T   +L+  ++QFE+    H RE   L+   +E+  ++    RE EEL++ L +A E    LRQ+L  S       E+ RE L+RE +  +R   +  +E + +Q SN ELR  +  +E +K  ++R  ++ + KL +L+E +   QKE  + R  LQ+ E+A+ D RR+L+E   QV+ L+ E  +   EVS LQ +V+ D     +  +E+  L+++V E++A  + + K++    +K  E+E    ++ K  + +  E  +  ++L+     +  +L+  ++  + L  +L    +R+ +LE ++   +  R  AE +L  + S L   +G  + +                         S +          + R GR         YS +  P    +DP++       VR ALRD+ Q ++  ++ERD+  I+  N        S QL +A      LQ R+ QLQ++  + EE ++  +S L SAQ A  +Q+E + R E E  +     G+          E++ LQE+VD +R
Sbjct:  919 EAAARWMEQQKELLTRSAADREALQGEIQNLKQERDESLLQLEHEMQQALSLKDAEKSLLSKELS-------GAHRELERARQEAQNQQVQAEATVTTMTKELRTLQVQFEEAISTHQREADTLREKLREIAAERSSVRREAEELQAQLNVAHERLAELRQELQAS-------EESREGLQREALGARRALEDEVQEKDVLQHSNTELRASIHRAEQEKASLKRSKEEQEQKLLLLQEAQVAAQKEAYELRTRLQELERAQRDTRRKLQERHRQVRTLEAENQRKRQEVSDLQAQVSRDAQHRQKNLQESLELQRQVAEAQAAHDGVQKEVLGLRQKLAEVEASGETRAKQLEGHLCESQRAEQTLQAELCRITRKLQEASNQADSLQRSLDNACSRVHVLEQELAKAEGARCNAEAQLGRLWSTLCSGLGQSRNLL-----------------------ASPKRPHSPTTGSSQTRPGRQRTSPPTRSYSPARWPSPVPVDPKSEVIDVAFVRDALRDLVQGLLEAQQERDNSGIQVAN-------LSSQLSEAERERLRLQSRVEQLQRDLADAEEGQRRAESALQSAQAARALQKEALQRLETEHLASARAAGQ----------ERRRLQEQVDTLR 1504          

HSP 2 Score: 135.576 bits (340), Expect = 4.669e-31
Identity = 175/769 (22.76%), Postives = 353/769 (45.90%), Query Frame = 1
Query:  886 LKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTL----HKLRNGMNGDLDNSIYNNDDSATRQLIID-----TDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEH--EL--RENADAIYVLQEEKEQLDGSLYESQ 3153
            L +     +  L  R+D  E  L+ +E + +MDLE  ++ L+  Q +SM L Q+  LLR QL+    AN  L  ++ R +     L+ +LE ++           R  + +   I  LW      +    ++++S ER L  ++ ++ ++ Q L +AC NLD+ H+ RL        T  +  S LE  L +   E  + + Q+  +  +L  +        E L+ +    E+ + TL     +L++  +G               QL +D      +++H  L  I ++  +D     +  W     + E++   +  P          RSVSP +             R    R  SP S+      AV++A+ +R  + Q+L  ++ S++     +++QL     E R  ++   +   E++    +L+  ++E +  + ++ +LE +K  L+ +      +    + + +KL+  N EL+R      +   +L +  ER  +E+E     +E  E K S L++E+++ +E+L+   L++++LE E   L  +L + E   A+ E+   + K E    +D   ++ ++   L ++      +  Q E E+ +L  ++K L+QE+ G+RE+L +   +   +   +  L ++  ++E+  ++L+ ++  L  E  QL      +  ++ AL  +L Q+ +D E     +Q+++ +K  L++E+  L+++    E   EL  +E AD    L+ E+  L+ SL+E+Q
Sbjct:  116 LASRCHMVSQRLQARLDTTEARLRKSELEHSMDLEEALSRLEASQQRSMGLSQVNTLLRQQLEHMQKANDTLARELTRATHSLVHLQRKLELQE---------SQRLSLRQPRDILPLWRQAKALQTHLAELRASTERGLTDVQADMTRTAQRLHMACLNLDS-HL-RL--------TASSMTSDLEQRLREQAREMLQLQGQWAAEKVALQARLSEQTLLVEKLSVQKEQGERAILTLKSDIQRLKSRRSGG--------------QLAVDELRDEVESLHHVLASIKEVAQSDA-MCPELAWSSSIEVREAQARLRSPP----------RSVSPHQ-------------RMSPARTSSPTSL-HPALQAVQAAIERRQQREQELRLRLESSQEEAAGLREQLSGYRQELRTSQRLLQDRAQEHEDLLGQLEAQRQEAQLSQASVHLLEREKEALETTMEELRAKADIREAETQKLEVTNAELRRSLLLRAEQKAELAQQSERSLRELEASQGRVEQLEEKVSGLRKELATSREALSSMQLQRDILETEKESLHGALAQAESGNADLELLVTRLKAEGMEQQDSLAKMAALLEGLSQDKGTLNHLALQLEQERDQLREQQKMLQQEQAGMREQLTQTGQQLGLIRAERRSLKETCGHLEQKQDHLEKQVVLLGQENAQLREQVGQVTNKKQALEKQLAQSLQDQEAQMDILQEALHEKNTLSEERAQLLAKQEALERHSELVTKEAAD----LRAERNSLENSLFEAQ 822          
BLAST of Rootletin-2 vs. UniProt
Match: sp|Q5TZA2|CROCC_HUMAN (Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=1)

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 694/2093 (33.16%), Postives = 1157/2093 (55.28%), Query Frame = 1
Query:  271 GIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNC--SQLENSLSKMKEEFRKTETQYQKQIES------LNEQFVHVNRSNESLTKELADKEKV-------LTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVD---QVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSS--RNSVEFNFSEDRKRVGRFGDVNQYS--------------ESVIPGS-DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSAL--KSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMEL-TSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKK 6435
            G+G  DL+   +   +P ++++I+ R+                       +Q  S +      + S+  L+ EN  L+  L  VE+ L + + ERD LAIK+NA++E+L +          R+     E      L  Q+++LR+QL ++   Y+RKL A  + Q +QA+L++RLQ K+ Q + R                  S L+         L R  ++ +  L+  +T+ + DLES +  L+EEQ +S SL Q+ A+LR+QLD+A +ANQ L+ED+++++ + +  + ELE ++  W+ +E +F+ +   E +R+  LW  VV F+R  +++K   ERDL QL   + +++++++ A   L T    RL++ + +   EK     +QLE  L   +++  + +   Q+Q++S      L+ +   +  + + L K+  +K++V       L  L  LR      L+                D + + Q LRD+AQ V++D +   Q+  S    D       + G      S+  L   R+ SP R   RS    G   R    R  SP     ST A + SALHKR LQVQD+  +  ++++   +++KQL DSE+ERR LE+Q   LR + D   +  +D QRE +R+R    +L  +K  L  S   + ++ +  +Q+ EKL+    EL+R ++ L +  +D  ++  R  +E+ER  + +E  E K S L +E+  ++E+L+RA L++++L+ E + + ++L K E  + E E+   K + EEA L+D   +L ++N  L ++  +   ++ Q E EK  L G ++  EQE    REE  R+E  + E    + GL  S++  E++ E L+ +L  L +E+ QL+     L R+ +    EL QARR+A+R   A++++ ++KE LAKE   L  QL   E E R  ++    L+ EKE L+GSL+E Q+ ++QLEA+ E LE+  Q L   +  +  E   L+ +     +K S  KE +  KL ++E+E    LR ++ A EED++RL  E+E    E    + +++ Q Q E ++L  RL  +KEEL++EI  +Q+ERD+ LL AE  KQ A++L E EK ++ EK+      L T   ++ER + + + R +QD++T+     +L+  R Q E+    H +E++ LQ   ++L  Q+   +RE EEL++ L++ E+ RD LR++L E+  K+RE+++ RE  R+E  + +R+  E  KE E ++ SN+ELR  +K +E ++I ++   +D + KL++LEE +  + KE  + R  LQ+ E++R++ RREL+ELR Q+K LD+E  +L  E++ LQ R+A  E  E E+RRE  GL+Q++++ EA+ E + ++L  + RK +E E    ++E+      +E     K   +    LE +LE       EL   LS  E R   LE ++  ++ +R+ AE +L  + S LR+ +G                           GR  S     V  + + D    G    +N  S               +  P S DLDPEAVR ALR+  Q + S +RERD  E++ + SAL  +  E   + D A  R  QLQK   E EE ++ +D RLS  Q  L +QEE++ R+ERER++ +D+V  LER L   E+E +  QE++ KM+  E+  E ++R L + +D +E+R  +LEL RR LEGELQR ++G +D+E + Q L+DRVD+L +Q++D E KA +LQLT++RL+  LA+ EE E   +DKV  L  +L++   +L S +DK + LQ  L + EHDR+VLQERL++ +  LSEA+ Q+ +L ++++  + E+ + E ++ E EG++++L ++L QRQE E    + + +   E+ LL ERL SL  +LA LE+E+R++E+  ++ EK++ +L++TLDK+E+EK RS E   +   ++   D      E E     RQ+Q+L+ Q+   EQ H+   +E+   + + E+  E++RL+SA   TE+TL+ RER+HRQ+V+ LEEQ++ LK QL QEL++
Sbjct:   32 GLGARDLAQDAQITSLPALIREIVTRNL----------------------SQPESPVLLPATEMASLLSLQEENQLLQQELSRVEDLLAQSRAERDELAIKYNAVSERLEQAL--------RLEPGELETQEPRGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKR-----------------CSELEQQL------LERSGELEQQRLR--DTEHSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGL--RLAESRAEAALEKQALLQAQLEEQL---RDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLRLQEQAALETE--------------DGEGLQQTLRDLAQAVLSDSESGVQLSGSERTAD------ASNG------SLRGLSGQRTPSPPR---RSSPGRGRSPR----RGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRHERSQLQEQLAQLSRQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGL--------------------------GRAPSPAPRPVPGSPARDAPAEGSGEGLNSPSTLECSPGSQPPSPGPATSPASPDLDPEAVRGALREFLQELRSAQRERD--ELRTQTSALNRQLAEMEAERDSATSRARQLQKAVAESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQATESELRASQEKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSASLNSTRDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVADLELQRVEAEGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVERLRSAQAQTERTLEARERAHRQRVRGLEEQVSTLKGQLQQELRR 2003          
BLAST of Rootletin-2 vs. UniProt
Match: sp|Q8CJ40|CROCC_MOUSE (Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2)

HSP 1 Score: 776.163 bits (2003), Expect = 0.000e+0
Identity = 674/2028 (33.23%), Postives = 1114/2028 (54.93%), Query Frame = 1
Query:  460 LDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSL-SKMKEEFRKTETQYQKQIES--LNEQFVHVNRSNESLTKELADKEKV-------LTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVD---QVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNK-SPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQ------EKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGD---------VNQYSESVIPG-------SDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKK 6435
            + S+  L+ EN  L+  L  VE+ L + + ERD LAIK+NA+NE+L +          R+     E      L  Q+++LR+QL ++   Y+RKL A  + Q +QA+L++RLQ K+ Q            +Q S+L  ++             ++R  ++ +  L+  +T+ + DL+S +  L+EEQ +S SL Q+ A+LR+QLD+A  ANQ L+ED+++++ + +    ELEQ++  W+ +E +F+ +   E +R+  LW  V+  +RQ +++K   ERDL QL   + +++++++     L  +     S+ +  L+ +K   +QLE  L +K+  E    + Q Q  ++   L+ +   +  S E L  + ++K++V       L  L  LR      LD                D + + Q LRD+AQ  ++D +   Q+  S    D       + G      S+      R+ +P R S           R R  R   SP     ST   + SALHKR LQVQD+  +  +++    SV+KQL DSE ERR LE+Q   LR +  ++ +  +D QRE +R+R    +L  +K  L  S   + ++ K  +Q++EKL+    EL+R    L D  +D  +   R  +E+ER  + +E  E K S L +E+  ++E+L+ A+L+++VL+ E + + ++L K E  +A+ E+   K + EEA LRD   ++ ++N  L ++  E   +I Q E EK  L G ++  E       EK  + E+L R+E E E     + GL  S+   E++ E L+ ++  L  E+  L+     L R+ +    EL QA R+++R   A++++ ++KE +AKE+  L  +L   E E R  ++    L+ EKE L+ SL++ Q+ ++QLEA+ E LE++ Q L   +  +  E   L+ +     +K +  KE +  KL ++E+E    LR ++ A EED++RL  E+E    E    + +++ Q Q+E ++L  R+  +KEEL++EI  +Q+ERD+ LL AE  KQ A++L E EK ++ EK+      L     ++ER + + + R +QD+NT+     +L+  R Q E+    H + +K L+     L  Q+   MRE EEL++ L++ E+TRD LR++L E+  K R+++D  E  R+E  + +R+  E  KE E ++ SN+ELR  +K +E ++I ++   +D + KL++LEE +  + KE  + R +LQ+ E++R++ RREL+ELR Q+K LD++ G+L  E++ LQ R+A  E  E E+RRE  GL+Q++++ E++ E L ++L  S RK +E E    ++E+      +E     K L +S  +LE +LE       EL   LS  E R   LE ++  ++ +R+ AE +L  + S LR+ +G                           GRVSS  + E          G  GD          +  S+   PG        DLDPEAVR ALRD  Q + S +RERD+++++    + +  E   + D A  R  QLQK   E EE  +  D RLS AQ  L +QEE++ R++RE ++ +D++  LER L   E+E +  QE+V KM+  E+  E ++R L + +D +E+R  +LEL RR LEGELQR ++G  D+E   Q L+DRVD+L +Q++D E KA +LQLT++RLS  LA+ EE E   + KV  L  +L++   +L S QDK + LQ  L++ EHDR+VLQERL++ +  LSEA+ Q+ +L ++++  + EL   E ++ + EG++++L Q L QRQE E      + +   E+ LL ERL SL  +LA LE+E+RD+E+  ++ +K++ +L+KTLDK+E+EK RS E   +   +R   D      E +     +Q+Q L+ Q+  A + +   +       + E+  E++RL+SA   TE+TL+ RER+HRQ+V  LEEQ++ LK QL QEL++
Sbjct:   75 MASLLSLQEENQLLQQELSRVEDLLAQSRAERDELAIKYNAVNERLEQAV--------RLETGELEAQEPRGLVRQSVELRRQLQEEQSSYRRKLQAYQEGQQRQAQLVQRLQAKILQY----------KKQCSELEKQL-------------MDRSTELEQQRLR--DTEHSQDLDSALLRLEEEQQRSASLAQVNAMLREQLDQANLANQALSEDIRKVTSDWTRSCKELEQREAVWRREEESFNTYFSSEHSRLLRLWRQVMGLRRQASEVKMGTERDLLQLGGELVRTSRAVQELGLGLSASLHRAESKAEAALEKQKLLQAQLEEQLQAKLLREKDLAQLQVQSDLDKADLSARVTELALSVEHLQNQNSEKDQVNRTLSDKLEALESLRLQEQTTLDTE--------------DGEGLQQTLRDLAQAALSDTESGVQLSSSERTADT------SDG------SLRGFSGQRTPTPPRHSP---------GRGRSPRRGLSPACSDSSTLTLIHSALHKRQLQVQDMRGRYEASQELLGSVRKQLSDSEGERRGLEEQLQRLRDQTAASAQAQEDAQREAQRLRSANELLSREKGNLTHSLQVTQQQAKELRQELEKLQAAQEELKRQHNQLEDAQEDSVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAILQRDVLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQL-RLEQEVE-----RQGLQGSLCVAEQAREALEQQILVLRSERSHLQEQLAQLSRQLSGRDQELEQALRESQRQVEALERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQASLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSKEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEELRTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGESSLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDSARSLELRLEAVRAETSELGLRLSAAEGRAQGLEVELARVEAQRRVAEAQLGGLRSALRRGLGL--------------------------GRVSSSPAREAP-------AGGSGDGLSSPSPLEYSPRSQPPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELKVQTSTLSQQLVEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGNLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQEGEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPVQPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELRR 1995          
BLAST of Rootletin-2 vs. UniProt
Match: sp|H7BZ55|CRCC2_HUMAN (Putative ciliary rootlet coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=CROCC2 PE=5 SV=4)

HSP 1 Score: 258.84 bits (660), Expect = 7.168e-68
Identity = 394/1524 (25.85%), Postives = 697/1524 (45.73%), Query Frame = 1
Query:  886 LKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLAC----SNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERM-----RHTISMLEEDKLKLDKSRMNSYE-ECKSYKQDMEK--LKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLE--TANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIE--ALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTE-----------RGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSD----LDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERR---GLIK 5355
            L +  +  +  L  R++  E  L+ +E + ++DLE  +  L+  + +S  L Q+ ALLR+QL+    AN  L  ++  ++     L+ ELE +   W   + T S  L G+   +  LW   V       +++ + ER L  L+ +  ++ + L  AC    SNL  +  +  S L  QL  +     QL+      K   +            L+EQ + V    E LT++   K K +  L         DL N +   D                      +L  + + ++ +                   P   + S    R+ SP + +   H  S             P ++ D    A+R+A+ +R  + Q+L  ++ S++    S+++QL +S  E    +K   + R+   +  RE    Q E +R+     R +  +L  +K  L+   M   E + K+   D EK  L+    ELQR      +  ++L    ER  + +E     ++  E K S L+EE++S++E+L+ A L+++V+E E   L  +L + E   A+ E+   + K+E    RD    + ++   L ++ S    +  Q E E+ +L  ++K LEQE+    E+L + E +       + GL Q+   +E+  E L+ + + L  EK QL+     VT Q++  AL  +L Q+ +D E     +Q++++ K+ L++E+  L+++    E + R  A+    L+ E++ L+ SL E+QQ  ++L+ ++E  A  + L      R  +  E ++LQ +++V+  KL +    LQ ++ + E+E  + L S+  A  E + +L  E+E L     + KE  + Q ++E  +L  +   ++E L  EI ++++ERD+ LL+ E   Q A++L E E+  + E++S+       +   LER + E + + +Q Q TI     +LK  + QFE     H RE   L+ + ++L  ++    RE E L++ L +A+E    LRQ+L       +  E+ RE L RE  + +R   +  +E + + L N ELR  +  +E +K   +R  ++ + KL ILEE +  LQ+E    R +L + E+A  D R+EL EL  QV+ L  E           + +   EV  L+ + A  E K   AR+E  GL++K+ E EA  E   ++L + LR++   E+ L +          E+    + L+E+           +   + L + L    +RI  LE ++   +  R+ AE +L  + S LR+ +G ++Q                +  SP KG   S +S      +      R     ++  S  PG      +D   V+  LRD  Q +   +RERDD  I+    + +  E   +  +A  R+ QLQK   E EE ++ ++  LSSA+ A  +Q+E + R E E  + +   G+          EK+ LQE+++ +R      EE RR   GL K
Sbjct:  117 LASRCRVVSEQLQARLETTEAQLRRSELEHSVDLEEALGRLEAAEERSTGLCQVNALLREQLEHMKKANDALGRELAGMTGSVQRLQGELELRR--WAQRQ-TRSGGL-GQPRDLLLLWRQAVVLGTDLAELRVATERGLADLQADTARTARRLHTACLNLDSNLRLSASSTASTLGQQLRDKAGEMLQLQGRWDAEKVALQA----------RLSEQTLLV----EKLTEQNEQKAKTIAALRT-------DLQNLVAQEDARCL------------------ELAGSSITELGE-------------------PRRPLRS--PQRATSPHQGASPPHICS-------------PATL-DPALQAMRAAIERRWRREQELCLQLKSSQALVASLQEQLSESRRELWAAQK-LQQERAREQAREREALRGQLEAQRLEVQQCRASCKLLGREKAALE---MVVEELKGKADAADAEKQGLEAEAAELQRSLLLQAERREELALRRERSCRALETSQGRLQQLEEKVSGLREELASVREALSTAQLQRDVVESEREGLRSALARAECSNADLELLVRRLKSEGVEQRDSLAAMAALMEGLAQDKSALNHLALQLEQERDQLREQRKTLEQERARAGEQLAQAEQQLALERAERRGLQQACGRLEQRQEQLEGQAALLGREKAQLQEQVGQVTCQKQ--ALEEQLAQSLQDQEAQMGTLQQALQGKDALSEERAQLLAKQEALERQGRLAAEEAADLRVERDSLESSLLEAQQLATKLQEQLEEEARSAGL-----ARQALQVEMEQLQSDWEVQEMKLRQDTVRLQRQVAQQEREAQRALESQALAHREALAQLQREKETLSLTLAEEKEVARCQLEQE-KELVTKSAAEREALKGEIQSLKQERDESLLQLEHKMQQALSLKETERSLLSEELSR-------ARRTLERVQQEAQSQQEQAQATISATTEELKALQAQFEDAITAHQRETTALRESLQDLAAERGDVEREAERLRAQLTVAQEGLAALRQEL-------QGVEESREGLHREAQEARRALSDEAREKDVLLLFNSELRATICRAEQEKASFKRSKEEKEQKLLILEEAQAALQQEASALRAHLWELEQAGGDARQELRELHRQVRTLKAENQRRSGEAHELQAQCSQEVLELRRQAAKAEAKHEGARKEVLGLQRKLAEVEAAGEAHGQRLQEHLRESRGAEQTLRA----------ELHSVTRKLQEA-----------SGVADALQARLDQACHRIHSLEQELAQAEGARQDAEAQLGRLCSTLRRGLGLQRQ---------SPWASPEQPGSPTKG---SDSSQALPGQQGTSPPARPHSPLRWP-SPTPGGRSSELMDVATVQDILRDFVQKLREAQRERDDSRIQMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLASVRAAGQ----------EKRRLQEQLETLR---QALEESRRHSQGLAK 1489          

HSP 2 Score: 63.5438 bits (153), Expect = 2.824e-8
Identity = 35/83 (42.17%), Postives = 57/83 (68.67%), Query Frame = 1
Query: 6193 RQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRE 6441
            RQ Q+LQ Q+ E EQ H QR+ +LT++ + ++ +E +RL  A     + L+ +E +H+Q+VK LEEQ+  LK+QL QE++ R+
Sbjct: 1555 RQNQQLQAQMTEMEQAHTQRLQDLTAQHQRDLATEAERLHGARPQATQALESQEWTHQQQVKVLEEQVASLKEQLDQEVQWRQ 1637          
BLAST of Rootletin-2 vs. UniProt
Match: sp|Q9BV73|CP250_HUMAN (Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 1.956e-41
Identity = 291/1208 (24.09%), Postives = 555/1208 (45.94%), Query Frame = 1
Query:  685 QTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNL-------DTNHVNRL-----SQLQF------QLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNE---SLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQ-------EIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELE------TIQLSNKELR----EKLKTSEMQKIDIQRQ-LQDLQNKLSILEEQKQVLQKEVKD 4191
            Q + L++Q+ ++     RKL    + Q +QA L+++LQ K+ Q                  RS    L+   + T   + +R +  E        + N+D   ++  L+EEQ +  SL ++   LR  +++A   N+ L EDV++L+ + S  + EL +K+  W+ ++  F  +L GE  R+ SLW  VV F+R F ++KS+ +RDL +L+    + + SL   C  L       + N   R+     +QL        +L+ E +  SQ    L ++K +    + + Q ++  L+       + NE    + K L +  ++L T H             +  ++ S +R    +  ++ Q ++DI Q+++ + D +             ++ +G        NSL  + S+        S F+         Y++      AD     VRS L +R   VQDL  ++   +   N +++Q D  E E + L ++  +L  E D+   +  D+Q E       +  L +++  L K+R    ++ +  +Q+  +L+ +N ELQ   ++     ++    L    +E ERL + +   E+K S    E+ +L+E+L  + LE E+L QE + +T +L + E   AE     N  KTE A LR    +L ++N  L  +       + Q E E   +    +A EQ +  ++ +L   E  +E L +    L   +Q  E++   LQ +L  +  EK +++      + ++ A +T+L Q  ++A+R    + +++++KE L +EK  L  +L   E + ++ A+ +  L   KE L+ SL+E+QQ  S +E     LE  +Q + + + +I  E + L+ E D E  +  + +++   +L ++E+E    L  +K A E+++ +L            K+++E +   Q+E+      L R+K EL         E+  IQ +R++   +AE          E+E++S+ E + Q    L  +   LER R + +++  ++Q T       L++ + + ++    H  ++  LQ     L   K    ++ E+LKS L   ++++  + Q++ E   K+RET++               Y  ++KELE      T+ L  KE R    ++  +   Q++   RQ +Q+ Q +   L  Q ++L++EVK+
Sbjct:   23 QVLALQQQMAENQAASWRKLKNSQEAQQRQATLVRKLQAKVLQY-----------------RSWCQELEKRLEATGGPIPQRWENVE--------EPNLD--ELLVRLEEEQQRCESLAEVNTQLRLHMEKADVVNKALREDVEKLTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDGREPAQLLLLLAKTQELEKEAHERSQ---ELIQLKSQGDLEKAELQDRVTELSALLTQSQKQNEDYEKMIKALRETVEILETNH-----------TELMEHEASLSRNAQEEKLSLQQVIKDITQVMVEEGDNI-------------AQGSGH------ENSLELDSSIF-------SQFD---------YQD------ADKALTLVRSVLTRRRQAVQDLRQQLAGCQEAVNLLQQQHDQWEEEGKALRQRLQKLTGERDTLAGQTVDLQGE-------VDSLSKERELLQKAREELRQQLEVLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAKQSESLSELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADLRAAAVKLSALNEALALDKVGLNQQLLQLEEENQSVCSRMEAAEQARNALQVDLAEAEKRREALWEKNTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQLHQEAKRQEEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSLFEAQQQNSVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEGKTALEQQKAAHEKEVNQLRE----------KWEKE-RSWHQQELAKALESLEREKMELEMRLKEQQTEMEAIQAQREEERTQAESALCQMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKLKEQETTGILQTQLQEAQRELKEAARQHRDDLAALQEESSSLLQDKMDLQKQVEDLKSQLVAQDDSQRLVEQEVQE---KLRETQE---------------YNRIQKELEREKASLTLSLMEKEQRLLVLQEADSIRQQELSALRQDMQEAQGEQKELSAQMELLRQEVKE 1112          
BLAST of Rootletin-2 vs. UniProt
Match: sp|Q8IVE0|CROL2_HUMAN (Putative ciliary rootlet coiled-coil protein-like 2 protein OS=Homo sapiens OX=9606 GN=CROCCP3 PE=5 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.750e-16
Identity = 60/184 (32.61%), Postives = 107/184 (58.15%), Query Frame = 1
Query: 2050 NSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTE---VLKAEYEVKANKFKTE 2592
             +++KQL DSE+ERR LE+Q   LR + DS  +  +D QRE +R+R    +L  +K  L  S   + ++ K  +Q+ +KL+    EL+R +  L +  +D  ++  R  +E+ER  + +E  E K S L +E+  ++E+L+RA L++++L+ E + + ++L K E    L A   V+A + + E
Sbjct:   13 GTLRKQLSDSESERRALEEQLQRLRDKTDSTMQAHEDAQREVQRLRSAKELLRREKSNLAHSLQVAQQQAKELRQERKKLQAAQEELRRQRYWLGEEQEDAVQDGVRVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEGRGGLPAGLPVQAERPQRE 196          
BLAST of Rootletin-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|20317756 (tr|A0A481MTJ1|A0A481MTJ1_SCHMD Rootletin-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 4162.45 bits (10794), Expect = 0.000e+0
Identity = 2190/2203 (99.41%), Postives = 2191/2203 (99.46%), Query Frame = 1
Query:  109 MSSANRDERLEQVAQKLNKFTDIFYQRVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA 6717
            MSSANRDERLEQVAQ           RVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQ+KLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNN NVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA
Sbjct:    1 MSSANRDERLEQVAQ-----------RVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQMKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNSNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA 2192          
BLAST of Rootletin-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|18314330 (tr|A0A267H6I3|A0A267H6I3_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018782g1 PE=4 SV=1)

HSP 1 Score: 1256.89 bits (3251), Expect = 0.000e+0
Identity = 842/2042 (41.23%), Postives = 1283/2042 (62.83%), Query Frame = 1
Query:  691 IQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSA-ETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNS--------IYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGS-------------------------DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISK-TSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPT 6711
            + LRK+LDD+ + YKRKLA   + Q +QA+L+++LQ K+   + +   V + + +N +L++++      F+ +      ++D +E  L+S  + D + DLES +  L+EEQ +S SL  + A+LR+QLD+AT  NQ LTED++RLSE+    +S+LE+++ +W+D+EA+FS +   E NR+ SLW  +V+F+RQFN++K++NERDL+  +  + + ++ +  AC NL+ N  +  +Q    LD E++  + LE++L +   E +  + +++     L+ +   ++  NE L  +LA+K++ L+ L +LR+   G    S            DD+ATR LI +T+A+HQ+LRDIAQ V++D D   D       + D  +                 RSVSP     RS             R++SP + ADST +AV++AL+KRALQVQ+L  K+ SAK+  +++++QLD+SENERR LE Q + LR E D+  R   D  R+ ER++  ++  E+++ +L+K R    E+ +S   D+++L+  N ELQR ++ L D   D  ++L+RQ KE ER  + I+  E K S LK ++   KE+LNRA LEKEVL+QE + ++D+L+++E+ KAE E++ NK K+EEA LRD   +++S+N  L  +  E   I+   E+EK +LSGEK+ALEQEKYGIREEL+R E EK EL+  K GL+Q+++  E S E L+DEL  +N E+ +L      + R++ AL+ ELL +RR+ ER S  V +  K+KE L KEK +L+ QLT  E E+R   +    L+ +K+QL+ +L+E+Q+ I QLE +   LE   Q+L  K+  +  E  R+  EF+VE  KL++ +E+LQ K+ + E++    L  E+++ E+D+ERL  E++  R E+   ++E   Q   E +++     R++E+L  EI   QRERD+ L+ AE  KQ A++++EQEK ++ E++      L+T  S+L+R R E   + QQD+ TI + NG+LKKFR QFEQ   +H+ E++ L     EL  Q+    RE  ELK  L++AE+ RDNLR++L ++  +IRE E+  +  +RE+ + KR   E  +  E ++ SN+ELR+K+K  E ++I+  R + + + ++ +LEEQK  L KEV D R NL++ EKARV+ +REL+ELR QVK LDTERGKL  EV  LQ RVA DE K+ E RRENFGLKQKV+E+EA++E L K+L  S R+  +LEE L SK++      +E  K+ + L++++  L+  +E  +    EL   L   E RI+ LE  +   D  +K  E +LA+IHS +R+LIGFRQ   ++            R  SP   R S  NS    F   +     F    +   S IP S                         D+DPEAVR+ALRD  Q +V+ ERERDD    A++   +  E      +  QR  QL +N  E EEDKKGID RL+SAQTALM+QEETI RNERE+K+L DK+  LERQ++ +ETEK+ LQE+++KM+  ++  EE+++ L +++DD ENRCTQLEL +R LEG++QR+++   DK+ ENQVL DRVD L KQI+DLESKAQSLQLTI+RLS++LA+TEE+ + QKD+V QLN S+S+    + S+Q+++ QLQ  L SSEHDRRVLQERL++    L+EAK QNH L++R+++ Q EL ++E R++++EG  ++ + +L+Q+QE EQEL  K++++  E+  + ER+ SL  +LAGLE+E+++IEK   + EK+K +LKKTLDK+E+E+ R+EE+ ++S   R E D   RRLE+ENE L RQVQ LQ+ LAEAEQ H+QR+M+L ++ + E  +E++RLK+   + E+TL+ RER HRQ+VK LEEQ+  LKDQL+QE+++R   L+KS RG   D+ DI++IL+ +   +S+    D  L++ E RR+ + L      +N       K++  P     +    R +  S  P 
Sbjct:   31 MDLRKRLDDEQQSYKRKLATYQEGQQRQAQLVQKLQAKVLAYKKK---VSESDLENQRLKTQL----RSFKQSNDSYQFKLD-SETRLRSGGDEDHSSDLESALIRLEEEQQRSASLAHVNAMLREQLDQATQVNQSLTEDMKRLSEDFQRTRSDLERRESEWRDEEASFSEYFSSEHNRLLSLWRNLVSFRRQFNELKTANERDLNNFKNEMTRQSRGVHAACQNLNANLKSAETQGAVALDQERSGRANLESALRERTRELQDLQAKFEAHQADLSGRVNELSVQNEKLKFQLAEKDRTLSHLQRLRSSGGGGGGGSASRSQSAEPPGADDAATRALIEETEAMHQSLRDIAQAVISDADGYRD-------FSDAGR----------------GRSVSPVGRGGRSPAGR--------QRSRSP-AFADSTYSAVQAALNKRALQVQELRGKLASAKDAGDNIRRQLDESENERRRLEHQVLGLREELDTVQRAQTDSGRDYERLKSALTAREQERSQLEKVRSALNEQIESLHADLDRLQQANSELQRCRDCLEDQKADQKKDLDRQVKENERCQRCIDQLEEKLSNLKSDLVQTKENLNRACLEKEVLDQEKAEVSDALSRSELAKAELELELNKMKSEEAALRDALLKMQSLNEGLGHDKVELNKILMMYENEKAQLSGEKQALEQEKYGIREELLRCEQEKMELDNEKAGLYQTLELSEMSREKLEDELQSINRERLELAEQLNAIGRQKRALAEELLASRRETERASNTVLRVAKEKEDLTKEKGELVVQLTACEREIRRLGELASGLRADKDQLEDALHEAQELIVQLETRKGQLEGENQELIIKKENLTAEISRITKEFEVECDKLTRQRENLQQKMQQMERDLKHALAQEQQSHEDDLERLTKEKDNQRAEYENQRQETIHQNNMEREEMVSSFEREREQLHTEIAACQRERDESLMLAENDKQQALSIVEQEKSTILERLGNTHAELQTVASELDRARREAAAKQQQDKETINSLNGELKKFRDQFEQTVEEHEAEVRKLNEQINELTQQREAACREVAELKVQLRMAEDARDNLRRELIDANRRIREQEEALDAQKREIFELKRQLAEEGRAREAVEKSNEELRKKIKEMEAERIERDRSIAEQKQRIGVLEEQKAALGKEVADLRGNLREVEKARVEAKRELQELRRQVKMLDTERGKLCKEVCDLQSRVAHDEEKDEENRRENFGLKQKVVETEASREALRKELGNSKRREADLEEELRSKQRDFALAMEEARKELRRLDDARSELQLSVEAASAENNELRQALGGAEGRINALETTLARTDSVKKELEYKLASIHSSMRRLIGFRQDNPRS--------PSPMRGRSPSPARRSRPNSPTKGFDGSQP----FATTAEGRGSPIPRSGSPAARGRSPFRSGSPSRGDIANACDIDPEAVRLALRDFVQQLVNTERERDDALAAARSLEQRVAEMEEAAQRNEQRTQQLHRNLCETEEDKKGIDGRLASAQTALMLQEETIRRNEREKKALGDKMSGLERQISGLETEKRQLQEKLNKMKQHDARQEEDKKNLKRSLDDVENRCTQLELTKRALEGDMQRMRLALGDKDAENQVLHDRVDNLNKQIADLESKAQSLQLTIERLSVSLAKTEEDGSQQKDRVQQLNGSVSDMAATIDSLQERVGQLQKALTSSEHDRRVLQERLDNTHAALNEAKHQNHQLLERVQSLQGELTDNEHRRNDLEGSNRQTNSLLAQKQEAEQELTQKLNKANQERAAMQERVQSLQRALAGLENEKKEIEKSASRLEKDKTALKKTLDKVERERIRTEEAASKSAFARGELDSALRRLEEENEALQRQVQALQSHLAEAEQAHSQRLMDLGAKHREETDTELERLKAGQLAAERTLENRERLHRQRVKGLEEQVATLKDQLAQEVRRRNQFLSKSARGAAGDLSDIRTILDSSLGTVSRDPGLDAALFDAESRRLDEALD----LHNAFPGGAGKRAGSPSRLGGAGGALRSSTPSGRPA 2016          
BLAST of Rootletin-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|18229458 (tr|A0A1I8FWZ5|A0A1I8FWZ5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1251.11 bits (3236), Expect = 0.000e+0
Identity = 875/2236 (39.13%), Postives = 1343/2236 (60.06%), Query Frame = 1
Query:  109 MSSANRDERLEQVAQKLNKFTDIFYQRVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSA-ETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNS--------IYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGS-------------------------DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISK-TSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPT 6711
            M+S  RD++LE+V  +L           ++VL +  + GYL+            G GG +        ++   ++D I R+  D       + D         +              D V +L+ E       L  +EE L   + ERD L+I++NA++E+ ++    +  G R +                 + LRK+LDD+ + YKRKLA   + Q +QA+L+++LQ K+   + +   V + + +N +L++++      F+ +      ++D +E  L+S  + D + DLES +  L+EEQ +S SL  + A+LR+QLD+AT  NQ LTED++RLSE+    +S+LE+++ +W+D+EA+FS +   E NR+ SLW  +V+F+RQFN++K++NERDL+  +  + + ++ +  AC NL+ N  +  +Q    LD E++  + LE++L +   E +  + +++     L+ +   ++  NE L  +LA+K++ L+ L +LR+   G    S            DD+ATR LI +T+A+HQ+LRDIAQ V++D D   D       + D  +                 RSVSP     RS             R++SP + ADST +AV++AL+KRALQVQ+L  K+ SAK+  +++++QLD+SENERR LE Q + LR E D+  R   D  R+ ER++  ++  E+++ +L+K R    E+ +S   D+++L+  N ELQR ++ L D   D  ++L+RQ KE ER  + I+  E K S LK ++   KE+LNRA LEKEVL+QE + ++D+L+++E+ KAE E++ NK K+EEA LRD   +++S+N  L  +  E   I+   E+EK +LSGEK+ALEQEKYGIREEL+R E EK EL+  K GL+Q+++  E S E L+DEL  +N E+ +L      + R++ AL+ ELL +RR+ ER S  V +  K+KE L KEK +L+ QLT  E E+R   +    L+ +K+QL+ +L+E+Q+ I QLE +   LE   Q+L  K+  +  E  R+  EF+VE  KL++ +E+LQ K+ + E++    L  E+++ E+D+ERL  E++  R E+   ++E+  Q   E +++     R++E+L  EI   QRERD+ L+ AE  KQ A++++EQEK ++ E++      L+T  S+L+R R E   + QQD+ TI + NG+LKKFR QFEQ   +H+ E++ L     EL  Q+    RE  ELK  L++AE+ RDNLR++L ++  +IRE E+  +  +RE+ + KR   E  +  E ++ SN+ELR+K                    ++ +LEEQK  L KEV D R NL++ EKARV+ +REL+ELR QVK LDTERGKL  EV  LQ RVA DE K+ E RRENFGLKQKV+E+EA++E L K+L  S R+  +LEE L SK++      ++  K+ + L++++  L+  +E  +    EL   L   E RI+ LE  +   D  +K  E +LA+IHS +R+LIGFRQ   ++            R  SP   R S  NS    F   +     F    +   S IP S                         D+DPEAVR+ALRD  Q +V+ ERERDD    A++   +  E      +  QR  QL +N  E EEDKKGID RL+SAQTALM+QEETI RNERE+K+L DK+  LERQ++ +ETEK+ LQE+++KM+  ++  EE+++ L +++DD ENRCTQLEL +R LEG+LQR+++   DK+ ENQVL DRVD L KQI+DLESKAQSLQLTI+RLS++LA+TEE+ + QKD+V QLN S+S+    + S+Q+++ QLQ  L SSEHDRRVLQERL++    ++EAK QNH L++R+++ Q EL ++E R++++E   ++ + +L+Q+QE EQEL  K++++  E+  + ER+ SL  +LAGLE+E+++IEK   + EK+K +LKKTLDK+E+E+ R+EE+ ++S   R E D   RRLE+ENE L RQVQ LQ+ LAEAEQ H+QR+M+L ++ + E  +E++RLK+   + E+TL+ RER HRQ+VK LEEQ+  LKDQL+QE+++R   L+KS RG   D+ DI++IL+ +   +S+    D  L++ E RR+ + L      +N       K++  P     +    R +  S  P 
Sbjct:    1 MTSGERDQKLEKVIHRLE----------QSVLKEGQSGGYLRT-----------GTGGRE--------RVSARIRDSITRNLDDPVGTGSGVADWSGVGGRVGSGGGVGSG-------DEVARLQRE-------LNRLEEALADTRAERDQLSIRYNALSERQHED-PGDDPGSRGLMQM-------------NMDLRKRLDDEQQSYKRKLATYQEGQQRQAQLVQKLQAKVLAYKKK---VSESDLENQRLKTQL----RSFKQSNDSYQFKLD-SETRLRSGGDEDHSSDLESALIRLEEEQQRSASLAHVNAMLREQLDQATQVNQSLTEDMKRLSEDFQRTRSDLERRESEWRDEEASFSEYFSSEHNRLLSLWRNLVSFRRQFNELKTANERDLNNFKNEMTRQSRGVHAACQNLNANLKSAETQGAVALDQERSGRANLESALRERTRELQDLQAKFEAHQADLSGRVNELSVQNEKLKFQLAEKDRTLSHLQRLRSSGGGGGGGSASRSQSAEPPGADDAATRALIEETEAMHQSLRDIAQAVISDADGYRD-------FSDAGR----------------GRSVSPVGRGGRSPAGR--------QRSRSP-AFADSTYSAVQAALNKRALQVQELRGKLASAKDAGDNIRRQLDESENERRRLEHQVLGLREELDTVQRAQTDSGRDYERLKSALTAREQERSQLEKVRSALNEQIESLHADLDRLQQANSELQRCRDCLEDQKADQKKDLDRQVKENERCQRCIDQLEEKLSNLKSDLVQTKENLNRACLEKEVLDQEKAEVSDALSRSELAKAELELELNKMKSEEAALRDALLKMQSLNEGLGHDKVELNKILMMYENEKAQLSGEKQALEQEKYGIREELLRCEQEKMELDNEKAGLYQTLELSEMSREKLEDELQSINRERLELAEQLNAIGRQKRALAEELLASRRETERASNTVLRVAKEKEDLTKEKGELVVQLTACEREIRRLGELASGLRADKDQLEDALHEAQELIVQLETRKGQLEGENQELIIKKENLNAEISRITKEFEVECDKLTRQRENLQQKMQQMERDLKHALAQEQQSHEDDLERLTKEKDNQRAEYENQRQEMIHQNNMEREEMVSSFEREREQLHTEIAACQRERDESLMLAENDKQQALSIVEQEKSTILERLGNTHAELQTVASELDRARREAAAKQQQDKETINSLNGELKKFRDQFEQTVEEHEAEVRKLNEQINELTQQREAACREVAELKVQLRMAEDARDNLRRELIDANRRIREQEEALDAQKREIFELKRQLAEEGRAREAVEKSNEELRKK--------------------RIGVLEEQKAALGKEVADLRGNLREVEKARVEAKRELQELRRQVKMLDTERGKLCKEVCDLQSRVAHDEEKDEENRRENFGLKQKVVETEASREALRKELGNSKRREADLEEELRSKQRDFALAMEDARKELRRLDDARSELQLSVEAASAENNELRQALGGAEGRINALETTLARTDSVKKELEYKLASIHSSMRRLIGFRQDNPRS--------PSPMRGRSPSPARRSRPNSPTKGFDGSQP----FATTAEGRGSPIPRSGSPAARGRSPFRSGSPSRGDIANACDIDPEAVRLALRDFVQQLVNTERERDDALAAARSLEQRVAEMEEAAQRNEQRTQQLHRNLCETEEDKKGIDGRLASAQTALMLQEETIRRNEREKKALGDKMSGLERQISGLETEKRQLQEKLNKMKQHDARQEEDKKNLKRSLDDVENRCTQLELTKRALEGDLQRMRLALGDKDAENQVLHDRVDNLNKQIADLESKAQSLQLTIERLSVSLAKTEEDGSQQKDRVQQLNGSVSDMAATIDSLQERVGQLQKALTSSEHDRRVLQERLDNTHAAMNEAKHQNHQLLERVQSLQGELTDNEHRRNDLEDSNRQTNSLLAQKQEAEQELTQKLNKANQERAAMQERVQSLQRALAGLENEKKEIEKSASRLEKDKTALKKTLDKVERERIRTEEAASKSAFARGELDSALRRLEEENEALQRQVQALQSHLAEAEQAHSQRLMDLGAKHREETDTELERLKAGQLAAERTLENRERLHRQRVKGLEEQVATLKDQLAQEVRRRNQFLSKSARGAAGDLSDIRTILDSSLGTVSRDPGLDAALFDAESRRLDEALD----LHNAFPGGAGKRAGSPSRLGGAGGALRSSTPSGRPA 2103          
BLAST of Rootletin-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|18247968 (tr|A0A267F2Q1|A0A267F2Q1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001435g3 PE=4 SV=1)

HSP 1 Score: 1249.96 bits (3233), Expect = 0.000e+0
Identity = 840/2042 (41.14%), Postives = 1283/2042 (62.83%), Query Frame = 1
Query:  691 IQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSA-ETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNS--------IYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGS-------------------------DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISK-TSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPT 6711
            + LRK+LDD+ + YKRKLA   + Q +QA+L+++LQ K+   + +   V + + +N +L++++      F+ +      ++D +E  L+S  + D + DLES +  L+EEQ +S SL  + A+LR+QLD+AT  NQ LTED++RLSE+    +S+LE+++ +W+D+EA+FS +   E NR+ SLW  +V+F+RQFN++K++NERDL+  +  + + ++ +  AC NL+ N  +  +Q    LD E++  + LE++L +   E +  + +++     L+ +   ++  NE L  +LA+K++ L+ L +LR+   G    S            DD+ATR LI +T+A+HQ+LRDIAQ V++D D   D       + D  +                 RSVSP     RS             R++SP + ADST +AV++AL+KRALQVQ+L  K+ SAK+  +++++QLD+SENERR LE Q + LR E D+  R   D  R+ ER++  ++  E+++ +L+K R    E+ +S   D+++L+  N ELQR ++ L D   D  ++L+RQ KE ER  + I+  E K S LK ++   KE+LNRA LEKEVL+QE + ++D+L+++E+ KAE E++ NK K+EEA LRD   +++S+N  L  +  E   I+   E+EK +LSGEK+ALEQEKYGIREEL+R E EK EL+  K GL+Q+++  E S E L+DEL  +N E+ +L      + R++ AL+ ELL +RR+ ER S  V +  K+KE L KEK +L+ QLT  E E+R   +    L+ +K+QL+ +L+E+Q+ I QLE +   LE   Q+L  K+  +  E  R+  EF+VE  KL++ +E+LQ K+ + E++    L  E+++ E+D+ERL  E++  R E+   ++E+  Q   E +++     R++E+L  EI   QRERD+ L+ AE  KQ A++++EQEK ++ E++      L+T  S+L+R R E   + QQD+ TI + NG+LKKFR QFEQ   +H+ E++ L     EL  Q+    RE  ELK  L++AE+ RDNLR++L ++  +IRE E+  +  +RE+ + KR   E  +  E ++ SN+ELR+K+K  E ++I+  R + + + ++ +LEEQK  L KEV D R NL++ EKARV+ +REL+ELR QVK LDTERGKL  EV  LQ RVA DE K+ E RRENFGLKQKV+E+EA++E L K+L  S R+  +LEE L SK++      ++  K+ + L++++  L+  +E  +    EL   L   E RI+ LE  +   D  +K  E +LA+IHS +R+LIGFRQ   ++            R  SP   R S  NS    F   +     F    +   S IP S                         D+DPEAVR+ALRD  Q +V+ ERERDD    A++   +  E      +  QR  QL +N  E EEDKKGID RL+SAQTALM+QEETI RNERE+K+L DK+  LERQ++ +ETEK+ LQE+++KM+  ++  EE+++ L +++DD ENRCTQLEL +R LEG+LQR+++   DK+ ENQVL DRVD L KQI+DLESKAQSLQLTI+RLS++LA+TEE+ + QKD+V QLN S+S+    + S+Q+++ QLQ  L SSEHDRRVLQERL++    ++EAK QNH L++R+++ Q EL ++E R++++E   ++ + +L+Q+QE EQEL  K++++  E+  + ER+ SL  +LAGLE+E+++IEK   + EK+K +LKKTLDK+E+E+ R+EE+ ++S   R E D   RRLE+ENE L RQVQ LQ+ LAEAEQ H+QR+M+L ++ + E  +E++RLK+   + E+TL+ RER HRQ+VK LEEQ+  LKDQL+QE+++R   L+KS RG   D+ DI++IL+ +   +S+    D  L++ E RR+ + L      +N       K++  P     +    R +  S  P 
Sbjct:   31 MDLRKRLDDEQQSYKRKLATYQEGQQRQAQLVQKLQAKVLAYKKK---VSESDLENQRLKTQL----RSFKQSNDSYQFKLD-SETRLRSGGDEDHSSDLESALIRLEEEQQRSASLAHVNAMLREQLDQATQVNQSLTEDMKRLSEDFQRTRSDLERRESEWRDEEASFSEYFSSEHNRLLSLWRNLVSFRRQFNELKTANERDLNNFKNEMTRQSRGVHAACQNLNANLKSAETQGAVALDQERSGRANLESALRERTRELQDLQAKFEAHQADLSGRVNELSVQNEKLKFQLAEKDRTLSHLQRLRSSGGGGGGGSASRSQSAEPPGADDAATRALIEETEAMHQSLRDIAQAVISDADGYRD-------FSDAGR----------------GRSVSPVGRGGRSPAGR--------QRSRSP-AFADSTYSAVQAALNKRALQVQELRGKLASAKDAGDNIRRQLDESENERRRLEHQVLGLREELDTVQRAQTDSGRDYERLKSALTAREQERSQLEKVRSALNEQIESLHADLDRLQQANSELQRCRDCLEDQKADQKKDLDRQVKENERCQRCIDQLEEKLSNLKSDLVQTKENLNRACLEKEVLDQEKAEVSDALSRSELAKAELELELNKMKSEEAALRDALLKMQSLNEGLGHDKVELNKILMMYENEKAQLSGEKQALEQEKYGIREELLRCEQEKMELDNEKAGLYQTLELSEMSREKLEDELQSINRERLELAEQLNAIGRQKRALAEELLASRRETERASNTVLRVAKEKEDLTKEKGELVVQLTACEREIRRLGELASGLRADKDQLEDALHEAQELIVQLETRKGQLEGENQELIIKKENLNAEISRITKEFEVECDKLTRQRENLQQKMQQMERDLKHALAQEQQSHEDDLERLTKEKDNQRAEYENQRQEMIHQNNMEREEMVSSFEREREQLHTEIAACQRERDESLMLAENDKQQALSIVEQEKSTILERLGNTHAELQTVASELDRARREAAAKQQQDKETINSLNGELKKFRDQFEQTVEEHEAEVRKLNEQINELTQQREAACREVAELKVQLRMAEDARDNLRRELIDANRRIREQEEALDAQKREIFELKRQLAEEGRAREAVEKSNEELRKKIKEMEAERIERDRSIAEQKQRIGVLEEQKAALGKEVADLRGNLREVEKARVEAKRELQELRRQVKMLDTERGKLCKEVCDLQSRVAHDEEKDEENRRENFGLKQKVVETEASREALRKELGNSKRREADLEEELRSKQRDFALAMEDARKELRRLDDARSELQLSVEAASAENNELRQALGGAEGRINALETTLARTDSVKKELEYKLASIHSSMRRLIGFRQDNPRS--------PSPMRGRSPSPARRSRPNSPTKGFDGSQP----FATTAEGRGSPIPRSGSPAARGRSPFRSGSPSRGDIANACDIDPEAVRLALRDFVQQLVNTERERDDALAAARSLEQRVAEMEEAAQRNEQRTQQLHRNLCETEEDKKGIDGRLASAQTALMLQEETIRRNEREKKALGDKMSGLERQISGLETEKRQLQEKLNKMKQHDARQEEDKKNLKRSLDDVENRCTQLELTKRALEGDLQRMRLALGDKDAENQVLHDRVDNLNKQIADLESKAQSLQLTIERLSVSLAKTEEDGSQQKDRVQQLNGSVSDMAATIDSLQERVGQLQKALTSSEHDRRVLQERLDNTHAAMNEAKHQNHQLLERVQSLQGELTDNEHRRNDLEDSNRQTNSLLAQKQEAEQELTQKLNKANQERAAMQERVQSLQRALAGLENEKKEIEKSASRLEKDKTALKKTLDKVERERIRTEEAASKSAFARGELDSALRRLEEENEALQRQVQALQSHLAEAEQAHSQRLMDLGAKHREETDTELERLKAGQLAAERTLENRERLHRQRVKGLEEQVATLKDQLAQEVRRRNQFLSKSARGAAGDLSDIRTILDSSLGTVSRDPGLDAALFDAESRRLDEALD----LHNAFPGGAGKRAGSPSRLGGAGGALRSSTPSGRPA 2016          
BLAST of Rootletin-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|17038078 (tr|A0A1S3JC29|A0A1S3JC29_LINUN rootletin-like isoform X4 OS=Lingula unguis OX=7574 GN=LOC106171578 PE=4 SV=1)

HSP 1 Score: 1242.64 bits (3214), Expect = 0.000e+0
Identity = 851/2028 (41.96%), Postives = 1307/2028 (64.45%), Query Frame = 1
Query:  685 QTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDD---SATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTR-PSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXX---XXXXXXEKG-------RVSSRNS-VEFNFSEDRKR--VGRFGDVNQYS-ESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISK-TSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPT 6711
            Q ++LR++L+++H  YKRKL A  D Q +QA+L+++LQ K+ Q + + G   +L  QNS+ +SE  ++K   Q+T   L  R++  E  L+ AE D +MDLE+ + +L+EEQ +S SL  + ++LR+QLD+AT+ANQ LT+D+ RL+ +    + ELEQK+ +W+D+E +F+ +   E +R+ SLW AVV F+RQF ++KS+ ERDL  +R ++ ++++S+  AC NL  N  +  +Q Q   D ++++ + LEN L     E  + +T++      LN +   +   NE L  +L +K+K ++TL    + ++     +    +     A++ +  +T+A+H ALRDIAQ V++D DQ            DE  +T +L            RS+SP+R P  R+   S S  R       SP + ADST +AV++AL+KR LQVQ++ +K N++K+ + +++KQLDD+ENERR +E+Q +E R E D+  R+ +D  R+ +R ++ + +   +K +L++ R    E+ ++   + EKL+  N E+QR ++N+ D   D+ ++ ERQ KE ER  K IE  E K S+L+E+    KE+L+++ L+K+VLE E + + ++L+K E+  AE E+  NK KTEEA LRD   +++++N  L ++  E   II Q E+EK  L GEK A+  EK GI+EEL+RVE EK +L+  K GL+Q+++  E++ ENLQ+E++ LN EK ++     ++ R+++AL+ ELLQ+R++ ER S  V +  K+KE L KEK  LI QLT+ E E R+ ++ I   + +KE L+ +LYE+QQ  +QLE + E LE   Q+L  ++  +  E  RL+ E ++E++KL + KES+  KL ++E++ N  L  EK+A EEDIERL  E+E  R E+   +EEI      E +++  R   +KE+L QE+  IQRERDD +L AE  KQ  ++L+EQEK ++ EK++     L++   + ER + E   R + D+N+I     +LKKFR QFE+  +  DRE+K+L    +EL+ QK Q +RE  ELK  LK+ EETRD +R+DL E+  KIRE ++ +E +R+E+ D KR+  +  +E E +Q +N+ELR K+K +E +KI++ R LQ+ + ++ ILEEQK  +QKE  D R +L++ EKAR+D RREL+ELR QVK LD+ER KL  EV  LQ RVA DE KE E+RRE +GLKQKV+E+EA++E L K+L    R+  ELE+    KEK  +   ++  ++ + LEE + NLE  LE  N+   EL   LS  E R++ LE Q+  ++  ++  E +L++IHS LR+ IGFRQ + ++      +       +R  SP KG           R S +    S DR R    R  D++    +  +  +D+DPEAVRIALRD  Q +   ERERDD   + ++ +++  E     D+   R+ QLQK+ GE EEDK+GIDSRL+SAQTALM+QEETI RNERERK++ +K+  LER LA +E+EK+ LQERV KM+  E+  EE+++ L  A+DD+E RCT+ EL +R +EG+LQRLK+  NDKETENQVL++R+D LT+Q+ DL+SK QSLQLTIDRLS  L++TEEEE+ QKDKV  LN+SLSE    +  +Q+++ QLQ  L SSEHDRRVLQERL++ +   +EAK QNH+L++R++A Q EL +SE R++E+EG++++   I+ QRQE EQEL  ++ +   EK  L ER+ SL    A LE+++R+IE+  I+TEK+K++LKKTLDK+E+EK ++EE  ++S+ ++   +   +RLE+EN  L RQ+Q +Q Q+AE EQ H+QR+++LT+R ++E   E +RL+SA    E+TL+ RER+HRQ+VK LEEQIN LKDQL+QE++KR+  + +S R   +DI DI++IL+ +   +++    D LL + E  ++ D +      ++ + IS  + S R  S  +S S  R    +++P 
Sbjct:   44 QNVELRRKLEEEHASYKRKLQAYQDGQQRQAQLVQKLQAKVLQYKKKCG---ELEAQNSQFKSESQQVKRSLQSTQDVLQSRLETTEARLRMAEEDASMDLETALIKLEEEQQRSSSLAHVNSMLREQLDQATSANQQLTQDIHRLTTDWQRAREELEQKESEWRDEEQSFNEYFSAEHSRLLSLWRAVVAFRRQFGEMKSATERDLSHIRADLTRTSRSMHSACLNLSANLRSMDTQSQVSADRDRSDRNALENQLRDKVREVMELQTKFDIHTSELNSKVNELTMMNEKLKIQLIEKDKSISTLQANMDRVDAGRMEAARERESMEVEASQTMREETEALHAALRDIAQAVISDADQ--------SKLEDEGASTAELA-----------RSMSPSRSPRMRTRTRSASPSR-------SP-AFADSTFSAVQAALNKRQLQVQEMRAKFNASKDQNAALRKQLDDTENERRRIERQMMEYREELDNARRDKEDSFRDRDRFKNQLDLTGSEKSQLERMRQALNEQIEALNTENEKLQAANSEIQRQRDNIEDEKDDVIKDKERQIKENERCHKVIEQLEMKLSKLREDFVETKETLHKSQLDKDVLENEKAEMGEALSKAELRMAELELAVNKLKTEEAGLRDALLKMQALNEGLGQDKIELNKIIMQLEAEKASLFGEKHAIIAEKSGIQEELVRVEQEKMDLDTEKLGLNQTVEIHEQTVENLQEEITILNREKVEITEQLNSVSRQKSALAEELLQSRKECERQSDTVVRIAKEKEDLTKEKASLIVQLTSSERENRQQSEIIAGFKADKESLENALYEAQQLNAQLETRKEQLEGENQELILRKEALQAEIARLRKEMELEIEKLERQKESITAKLGQTERDLNVSLTQEKQAHEEDIERLTREKETQRIEYEANREEILHHNAMEKEEMIARAENEKEQLQQELAAIQRERDDSMLFAENEKQQVLSLMEQEKSTLAEKLNSTQKDLQSQIVENERLKRESMSRQESDKNSINGLQAELKKFRSQFEEATVAQDRELKDLNGRMQELQRQKEQALREVAELKVQLKMVEETRDTIRRDLIEANRKIREADETKELMRKEIGDLKRSVNDEVREKEAVQKANEELRNKIKRAEGEKIELSRNLQEAKQRIGILEEQKTGVQKEASDLRASLREVEKARLDARRELQELRRQVKMLDSERSKLGKEVGDLQNRVARDEEKEEESRREQYGLKQKVVETEASREALRKELANLQRRYAELEDESRVKEKDYQMALEDSRRNERKLEEIRRNLETNLEACNNEIGELKLALSGAEGRVNALEAQLARVEGAKRDVEFKLSSIHSTLRRTIGFRQDMPRSPSPTMRARSPSPRRTRPTSPAKGFDNTFTTTTDGRGSPIARTGSPDRARSPTRRERDMSPSRLDQSVSIADIDPEAVRIALRDFVQQLAGSERERDDCLSQVRSLSMQLKEMEEDRDRTEARLQQLQKSLGEAEEDKRGIDSRLASAQTALMLQEETIRRNERERKTMAEKINTLERGLAAMESEKRQLQERVGKMKQNEAKLEEDKKQLRMALDDSEQRCTKTELAKRSMEGDLQRLKLAMNDKETENQVLQERIDNLTRQMQDLDSKCQSLQLTIDRLSNALSKTEEEESVQKDKVQVLNMSLSEQSATIADLQERVQQLQRALTSSEHDRRVLQERLDTTRQAQNEAKKQNHSLMERVQAIQNELSDSEVRRNELEGQVRQAHGIIVQRQEQEQELNQRLQKLGTEKQGLQERVASLQRQYAQLETDKREIERNVIRTEKDKSALKKTLDKVEREKMKTEEVASRSMTEKGSMEGTLKRLEEENMDLQRQLQSMQAQMAEMEQAHSQRLIDLTTRHRSETEMETERLRSAQLQAERTLEARERAHRQRVKGLEEQINTLKDQLAQEMRKRQQFIQRSTRT-GDDIKDIRNILDSSLGTVARDPGLDTLLLDHETSKLGDTV------DHHSTISPTRLSPRRRSPTRSTSPVRLGRVTSTPA 2034          
BLAST of Rootletin-2 vs. Ensembl Cavefish
Match: crocc2 (rootletin-like [Source:NCBI gene;Acc:103030367])

HSP 1 Score: 475.322 bits (1222), Expect = 2.688e-136
Identity = 471/1521 (30.97%), Postives = 847/1521 (55.69%), Query Frame = 1
Query: 1936 SPVSIA-----DSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKA---KESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEEL-KSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLE-ESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSD--LDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQ--ALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNK 6456
            SPV        D+T  +V+ AL +R    QDL + +++A +    ++ +L DSE+E R LE++  +L+ E     +   +I R+ +R R ++ ++  +K +L+K    +  +    + ++E+L++ + ++QR ++ L    +DL+R L R+  E ER  ++IE  E+K S +++E+ +++E+L++  L+KEVLE E + L  +L+K E   AE E+   K ++EEA LRD F ++ ++   L K+  E   ++ Q E+EK  LS  K+  E E+   REEL  ++ E  ++   K  L  S   +++S   L  EL+ L  EK  +      +  ++ AL  +L   +R++E  ++++Q++ +++E LA++K  L  QLT  +   +  A  +   + E E L+ ++++ Q+ IS LEA +  LE     L++    +  E  R+Q E +   Q++S+A   +++L++KL ++E+   + L S +++ +E +E    ++E +R      +E+++ Q + E ++LR R   D ++L +E+   Q+   D LL+AE  KQ A++  E EK  + E+I  L   + T+  + ER R +   + +QD++T      +L++ RL FE+     +   K L    +EL  Q+++  +E E+L +S+L++ EE+RD +R++L E+  ++RE   +RE  RRE ++ +R      +E E I  SN+ELR  +K +E +   ++R L++ + +L++LEE K  LQ+E    R ++++ EK+ +  RREL+ELR +VK L+ + G+   EV  LQ R+  +E +E EAR+E+F LKQ+V+ES+A +E   K++    R+  ELEE+    EK  ++  D  L+D +  + E    LE  L+       E N  L   E R   LE Q+ + D  R   E RL+ + S LR+ +G   +                R+ SPEKG  S                G  G V   S S + G D  LD E+V+ ALR+  Q +   +RERDD   +A+  +LK   + +Q  Q  +  R  QL+ +  ++E+ K+ +  RL + Q +L +QEE   R +RER+ + +++ +L+  L   +   + LQER++++   E+    E R L +  D AE R ++LEL  R LEGELQR ++   + E E   L++R+ +L +++ + E     L++  +R +  LAR E +E   ++K+     +L E   +  + +++  QLQSTL +SE + R LQERLE ++  LS++K QN+ L +R++  Q+   E E R  E++     L + L QR+++ +E ++       ++  L ER+ +L  SL  L+ +R  ++K+  +  K+K +LK+TL K+E+E+ R EE +     ++ E ++    LE +    H +   L++QL+  EQ H+QR++E+T+R + E+  E +RL+ +    E+ L+ RE++HRQ+V+ LEEQ+  LK+QL QE+++R+  +++
Sbjct:  472 SPVPTVSSPQRDNTLISVQRALSQRQKLTQDLQTCLDAALDQAAVLRDRLQDSESECRQLEQRIQQLQQENRHAEKAGVEISRDAQRYRTSLGLITSEKGELEKHLFVAQHQLNHDQAELERLRSSSLDVQRQRDILRQQREDLERQLARERSEAERGLRTIEQLEAKHSDVRKELVTVREALSQITLQKEVLEDEKASLEKALSKAEAQNAEQELALTKLQSEEAGLRDSFEKMAALCEGLAKDKVELNRVLLQVEAEKAELSERKREAELERAAAREELALIQQELMDVVAEKRALEASHVLLQESRAGLDTELTLLQREKSSVLEQLAQVSEQKQALMEQLSVCQRESELQTSSLQRTGREREELARDKAGLSVQLTAEQRRAKTLAQELAAARVEWESLESAVFDGQEQISALEADLSRLEGERGNLQQANEALTREVSRIQSELE---QQVSQALLERQALELKLTQAERNAQRSLASAQQSHQEQLEAERKDKESVRLALTAQREQVEEQLRVEYEELRLRSRTDLQQLQEELARAQQHCTDSLLQAESHKQQALSEKEAEKTVLTERILSLQRDIETTALETERMRRDFLNKQEQDKDTAAGLQSELQQLRLHFEESLSSREISEKRLNDQIRELSLQRHEAQQEVEQLRRSVLEV-EESRDGVRKELVEARAELRECVQEREAGRRESLELRRALGNESREKEAIHTSNQELRTSVKRAESENNGLKRTLEEREQRLTVLEECKSSLQQEALKVRNSMRELEKSHLQARRELQELRRKVKTLEGQCGQQEQEVGELQARLVQEEQREEEARKESFSLKQRVLESDAGREAALKEVAGLQRRVAELEEV-QRVEKECQRQRDASLQDSQRRQREETARLEGALQEVQAELREQNVELKLAEGRGRSLEEQLALADASRSDLEQRLSGLSSALRRTLGIGCRARSPTPRPRGRRPSPWRNRSPEKGSESVSG-------------GPMGSVQDPSVSPVHGEDGKLDVESVQAALRNFQQELRDAQRERDD--AQAQVMSLKRQLSELQAGQEKSSARAQQLKHSIKDLEQGKRDLAERLEAVQASLSLQEEAGRRGDRERRVMEEELSRLKNGLQASDAGARALQERLERVEQSEAGLGAECRRLKECWDAAEARASRLELSHRTLEGELQRSQIRSAELEAELSSLQERMSSLRRELGESEECTALLKVEGERAATALARAELQEAQLREKLQSTAAALKESCSSAGAAKEQTAQLQSTLTASELEGRTLQERLEKMREALSDSKKQNYALSERLQNLQRTQEEYELRVSELDKHTHSLQEALRQREQVVEEARADCTVLQKDRVELQERVTNLQTSLHSLQDDRTQLDKILTRLGKDKAALKRTLQKVEQERRRQEEEVLCVGRQKEELEQSLSSLEQQLSDTHAESHTLKSQLSHLEQAHSQRLLEVTARHRQELELETERLRGSQQQAERALEAREKAHRQRVRCLEEQVCTLKEQLEQEMRRRQTYMSQ 1972          

HSP 2 Score: 94.3597 bits (233), Expect = 1.318e-18
Identity = 92/354 (25.99%), Postives = 163/354 (46.05%), Query Frame = 1
Query:  316 MPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTN 1377
            +P  ++ II R+  +             P  +         L   G+G +   Q   EN  LKD L        RL  +RD L  K  A+  +L +   A+  GD    +                  +++L D+ R Y+ KL A  D Q +QA+L+ +LQ K+ Q + R G   ++ QQ  +  SE+ +L+   QT        +D + +  + +E + ++D +S +  L+EE+ +   L ++ ALLR+QL++A  ANQ LTE +    EE        EQ+D+  + ++   +  L  EQ R+++LW    + +  F  +++  +R+L  +R     + + L +AC NL + 
Sbjct:   51 VPARIRQIITRNLAEG------------PAVSGAGV-----LGAVGSGGEQSVQ--EENRRLKDLLSQT-----RL--DRDQLLSKQTALTSRLEQMLAAQS-GDSDQDSVYGGE-------------QQRLRDESRAYRLKLQAYQDSQHRQAQLVHKLQTKVLQYKKRCG---EMEQQVLEKTSELEKLRLSLQT-------HLDSSAHRFQLSEQEHSLDAQSKLALLEEERRRCSGLTKVNALLREQLEQANEANQALTESLHEAQEEA-------EQRDIRLRREQEMSASRLGREQARVRALWRQAASLRSTFTQLRAFADRNLSDIRGEFANANRKLHVACLNLQSG 347          
BLAST of Rootletin-2 vs. Ensembl Cavefish
Match: crocc2 (rootletin-like [Source:NCBI gene;Acc:103030367])

HSP 1 Score: 465.307 bits (1196), Expect = 3.790e-133
Identity = 460/1521 (30.24%), Postives = 823/1521 (54.11%), Query Frame = 1
Query: 1936 SPVSIA-----DSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKA---KESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEEL-KSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLE-ESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSD--LDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQ--ALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNK 6456
            SPV        D+T  +V+ AL +R    QDL + +++A +    ++ +L DSE+E R LE++  +L+ E     +   +I R+ +R R ++ ++  +K +L+K    +  +    + ++E+L++ + ++QR ++ L    +DL+R L R+  E ER  ++IE  E+K S +++E+ +++E+L++  L+KEVLE E + L  +L+K E   AE E+   K ++EEA LRD F ++ ++   L K+  E   ++ Q E+EK  LS  K+  E E+   REEL  ++ E  ++   K  L  S   +++S   L  EL+ L  EK  +      +  ++ AL  +L   +R++E  ++++Q++ +++E LA++K  L  QLT  +   +  A  +   + E E L+ ++++ Q+ IS LEA +  LE     L++    +  E  R+Q E +   Q++S+A   +++L++KL ++E+   + L S +++ +E +E    ++E +R      +E+++ Q + E ++LR R   D ++L +E+   Q+   D LL+AE  KQ A++  E EK  + E+I  L   + T+  + ER R +   + +QD++T      +L++ RL FE+     +   K L    +EL  Q+++  +E E+L +S+L++ EE+RD +R++L E+  ++RE   +RE  RRE ++ +R      +E E I  SN+ELR  +K +E +   ++R L++ + +L++LEE K  LQ+E    R ++++ EK+ +  RREL+ELR +VK L+ + G+   EV  LQ R+  +E +E EAR+E+F LKQ+V+ES+A +E   K++    R+  ELEE+    EK  ++  D  L+D +  + E    LE  L+       E N  L   E R   LE Q+ + D  R   E RL+ + S LR+ +G   +                R+ SPEKG  S                G  G V   S S + G D  LD E+V+ ALR+  Q +   +RERDD   +A+  +LK   + +Q  Q  +  R  QL+ +  ++E+ K+ +  RL + Q +L +QEE   R +RER+ + +++ +L+  L   +   + LQER++++   E+    E R L +  D AE R ++LEL  R LEGELQR ++   + E E   L++R+ +L +++ + E     L++  +R +  LAR E +E   ++K+     +L E   +  + +++  QLQSTL +SE + R LQERLE ++  LS++K QN+ L +R++  Q+   E E R  E++     L + L QR+++ +E ++       ++  L ER+ +L  SL  L+ +R                                          ++ D+   RL  +   L R +QK  +QL+  EQ H+QR++E+T+R + E+  E +RL+ +    E+ L+ RE++HRQ+V+ LEEQ+  LK+QL QE+++R+  +++
Sbjct:  472 SPVPTVSSPQRDNTLISVQRALSQRQKLTQDLQTCLDAALDQAAVLRDRLQDSESECRQLEQRIQQLQQENRHAEKAGVEISRDAQRYRTSLGLITSEKGELEKHLFVAQHQLNHDQAELERLRSSSLDVQRQRDILRQQREDLERQLARERSEAERGLRTIEQLEAKHSDVRKELVTVREALSQITLQKEVLEDEKASLEKALSKAEAQNAEQELALTKLQSEEAGLRDSFEKMAALCEGLAKDKVELNRVLLQVEAEKAELSERKREAELERAAAREELALIQQELMDVVAEKRALEASHVLLQESRAGLDTELTLLQREKSSVLEQLAQVSEQKQALMEQLSVCQRESELQTSSLQRTGREREELARDKAGLSVQLTAEQRRAKTLAQELAAARVEWESLESAVFDGQEQISALEADLSRLEGERGNLQQANEALTREVSRIQSELE---QQVSQALLERQALELKLTQAERNAQRSLASAQQSHQEQLEAERKDKESVRLALTAQREQVEEQLRVEYEELRLRSRTDLQQLQEELARAQQHCTDSLLQAESHKQQALSEKEAEKTVLTERILSLQRDIETTALETERMRRDFLNKQEQDKDTAAGLQSELQQLRLHFEESLSSREISEKRLNDQIRELSLQRHEAQQEVEQLRRSVLEV-EESRDGVRKELVEARAELRECVQEREAGRRESLELRRALGNESREKEAIHTSNQELRTSVKRAESENNGLKRTLEEREQRLTVLEECKSSLQQEALKVRNSMRELEKSHLQARRELQELRRKVKTLEGQCGQQEQEVGELQARLVQEEQREEEARKESFSLKQRVLESDAGREAALKEVAGLQRRVAELEEV-QRVEKECQRQRDASLQDSQRRQREETARLEGALQEVQAELREQNVELKLAEGRGRSLEEQLALADASRSDLEQRLSGLSSALRRTLGIGCRARSPTPRPRGRRPSPWRNRSPEKGSESVSG-------------GPMGSVQDPSVSPVHGEDGKLDVESVQAALRNFQQELRDAQRERDD--AQAQVMSLKRQLSELQAGQEKSSARAQQLKHSIKDLEQGKRDLAERLEAVQASLSLQEEAGRRGDRERRVMEEELSRLKNGLQASDAGARALQERLERVEQSEAGLGAECRRLKECWDAAEARASRLELSHRTLEGELQRSQIRSAELEAELSSLQERMSSLRRELGESEECTALLKVEGERAATALARAELQEAQLREKLQSTAAALKESCSSAGAAKEQTAQLQSTLTASELEGRTLQERLEKMREALSDSKKQNYALSERLQNLQRTQEEYELRVSELDKHTHSLQEALRQREQVVEEARADCTVLQKDRVELQERVTNLQTSLHSLQDDR------------------------------------------TQLDKILTRLGKDKAALKRTLQK--SQLSHLEQAHSQRLLEVTARHRQELELETERLRGSQQQAERALEAREKAHRQRVRCLEEQVCTLKEQLEQEMRRRQTYMSQ 1928          

HSP 2 Score: 93.9745 bits (232), Expect = 1.774e-18
Identity = 92/354 (25.99%), Postives = 163/354 (46.05%), Query Frame = 1
Query:  316 MPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTN 1377
            +P  ++ II R+  +             P  +         L   G+G +   Q   EN  LKD L        RL  +RD L  K  A+  +L +   A+  GD    +                  +++L D+ R Y+ KL A  D Q +QA+L+ +LQ K+ Q + R G   ++ QQ  +  SE+ +L+   QT        +D + +  + +E + ++D +S +  L+EE+ +   L ++ ALLR+QL++A  ANQ LTE +    EE        EQ+D+  + ++   +  L  EQ R+++LW    + +  F  +++  +R+L  +R     + + L +AC NL + 
Sbjct:   51 VPARIRQIITRNLAEG------------PAVSGAGV-----LGAVGSGGEQSVQ--EENRRLKDLLSQT-----RL--DRDQLLSKQTALTSRLEQMLAAQS-GDSDQDSVYGGE-------------QQRLRDESRAYRLKLQAYQDSQHRQAQLVHKLQTKVLQYKKRCG---EMEQQVLEKTSELEKLRLSLQT-------HLDSSAHRFQLSEQEHSLDAQSKLALLEEERRRCSGLTKVNALLREQLEQANEANQALTESLHEAQEEA-------EQRDIRLRREQEMSASRLGREQARVRALWRQAASLRSTFTQLRAFADRNLSDIRGEFANANRKLHVACLNLQSG 347          
BLAST of Rootletin-2 vs. Ensembl Cavefish
Match: si:dkey-230p4.1 (trichohyalin-like [Source:NCBI gene;Acc:103036019])

HSP 1 Score: 78.1814 bits (191), Expect = 1.291e-13
Identity = 39/121 (32.23%), Postives = 76/121 (62.81%), Query Frame = 1
Query:  985 LESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSL 1347
            LES +  L+EEQ +S++L+++ ALLR QL ++  ANQ L +D+++L+ + S    E  Q+++DW+ ++      +  E+ R+  LW   V+ +RQ + +K++ ++DL +LR    + + +L
Sbjct:  128 LESTLIRLEEEQQRSVALVEVNALLRSQLSQSAEANQTLQDDLRKLTADWSRAVEEAGQREIDWQKEKEVLVGCVSAERARLMMLWGKAVSLRRQCHTVKTATDKDLWELRAEFSRLSSTL 248          
BLAST of Rootletin-2 vs. Ensembl Cavefish
Match: si:dkey-230p4.1 (trichohyalin-like [Source:NCBI gene;Acc:103036019])

HSP 1 Score: 78.1814 bits (191), Expect = 1.291e-13
Identity = 39/121 (32.23%), Postives = 76/121 (62.81%), Query Frame = 1
Query:  985 LESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSL 1347
            LES +  L+EEQ +S++L+++ ALLR QL ++  ANQ L +D+++L+ + S    E  Q+++DW+ ++      +  E+ R+  LW   V+ +RQ + +K++ ++DL +LR    + + +L
Sbjct:  128 LESTLIRLEEEQQRSVALVEVNALLRSQLSQSAEANQTLQDDLRKLTADWSRAVEEAGQREIDWQKEKEVLVGCVSAERARLMMLWGKAVSLRRQCHTVKTATDKDLWELRAEFSRLSSTL 248          
BLAST of Rootletin-2 vs. Ensembl Cavefish
Match: ENSAMXT00000053516.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:18273005:18276973:-1 gene:ENSAMXG00000035105.1 transcript:ENSAMXT00000053516.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 2.070e-10
Identity = 49/168 (29.17%), Postives = 89/168 (52.98%), Query Frame = 1
Query:  685 QTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDE 1188
            Q + LR++L+++   YKRKL A  + Q +QA+L+++LQ K+ Q       ++ L  Q           K H     S   R   + E         +++ +   V       S+S SL  + A+LR+QL++A+ AN+ L++D++RL+ + +  + ELEQ++ DW+ +E
Sbjct:   22 QNVDLRRRLEEEQAAYKRKLTAYQEGQQRQAQLVQKLQAKVFQ-----TFIKHLQHQ-----------KPH-----SHQQRNCSLYET--------QSVCVCVCV-------SRSSSLSAVNAMLREQLEQASLANEALSQDIRRLTADWTKAREELEQREADWRREE 153          
BLAST of Rootletin-2 vs. Ensembl Nematostella
Match: EDO42343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1K9])

HSP 1 Score: 321.242 bits (822), Expect = 2.376e-95
Identity = 241/604 (39.90%), Postives = 392/604 (64.90%), Query Frame = 1
Query: 4924 GSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKN--SALKS-DETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEI-----RRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPT 6711
              ++DPE VR+ALRD  Q +   ERERD+   +A N   AL   +E   ++DQ +Q I   QK+ GE EE+++G D RLSSAQTALM+QEETI R ERERK+L +K+  L+  LA  E +++ L+++V  ++  ES  ++E+  +   +++ E+R T++EL +R +EG+++RL+M  ++ E E   L++R+D + K   +LES+A SLQLT+DRL++ LA+TEEEE   K+KV +L++SL++     QS+Q+++ QLQ  L +SEHDR+++QERLE++K+   EAK +N+ L DRM+  + E  +++ R+ E+EG+I++L QIL Q++E E+EL ++I +   EK  L ERL     S+A  E E+R++E+ H++ EK+K +L+ TLDK+E+EK  ++E+  +    R   D  +   E EN+ LHRQ+Q LQ QLAE EQ HA++++E+TSR + E+  E DR + +    EKT   RER+H+Q+VK LEEQ+  LKDQL++EL+K++  L ++ +   ++I D++S LE + N +++    + +YEP +     +++++ L +  Y            S RP S       S    ++++P 
Sbjct:    2 SGEIDPETVRVALRDFAQSMKEAERERDEAVTRANNLQRALAELEEERTRMDQRMQSI---QKSLGESEEERRGADGRLSSAQTALMLQEETIRRLERERKALNEKITALDSSLAQAEGDRRQLRDKVANLQQSESKSDQEKEAMRAQIENTESRLTKVELKKRSVEGDIERLRMLNSENEAEKIALQERIDQMLKSQQELESRATSLQLTVDRLTLALAKTEEEEMAFKNKVTELSMSLNDSNSTSQSLQERIQQLQRALTNSEHDRKIMQERLEALKNAQQEAKGRNNMLQDRMQQMKNEQADADVRRMELEGQIRQLQQILRQQKEAEEELVARIGKLQEEKRELQERLAKFQRSVAAAEQEKRELERAHVRLEKDKKALRNTLDKIEREKLETDETNTRLRDDRERLDRSSANFEHENQELHRQIQILQQQLAETEQSHARKLVEVTSRHRQEIEMEGDRARQSQGQLEKTQMARERAHKQRVKGLEEQVATLKDQLAKELQKKQSYLTRTAQK-SDEIKDLRSKLEDSLNIVAR----DTIYEPTVLDRESQKLEESLVDGSYG-----------SIRPKSASPPPRYSADKFATSTPA 586          
BLAST of Rootletin-2 vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 400.208 bits (1027), Expect = 3.511e-113
Identity = 417/1308 (31.88%), Postives = 699/1308 (53.44%), Query Frame = 1
Query: 2557 EYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLE--TANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFD-EKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMREN---EELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGS--DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQI--LSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNL 6450
            E  +  +K + E+A LRD   ++ ++N  LV++  +    I Q E EK  L  +K+  EQEK  IR+EL+R E  + EL   +  L QS+Q+ E S   ++ EL  L  E+ +L+   A V       +L +EL  A+ + +R   A++++ + +  L K+K  L+ QLT  E E    A+ +   + E+E L+ SL+++QQ + Q E+  E LE+  Q L  +     D E Q  Q E D   Q L++A  + Q+     E +   ++R                     +  M+++  ++ + ++E++D   +  R+KEEL   +  +Q ERD  LL+AE  KQ A++L E EK  + EK+S L   L     + ERT  E     +Q+Q  +     +L++ R Q E     H+R+I +L        N+   D+R     E+ ++ L  AEE R+ LR+D  E+  ++ +T++  E  RRE  + +R+  +V +E + +  SN +LRE L+++E ++I ++RQ ++ + +L +LEE     QKEV + R  L++ E++R++ RREL+ELR Q+K LD +R +   E++ LQ R++ +E +E E  +E F LKQK+ E++ T     K+L +S       E    S E+       E     K L++   NL  + +    +   L +T           E ++   +  ++  E RL+++ S L + +G                           GR S   S     + D   +G      +   + +P +  +LDP+ +R  LRD  Q +    R+RDD + +      + +E  ++ + A  R  QLQ +  E +E K+G+D RL+S Q  L  QE+ + R +RER++L D+V +LER L   E EKK+ QE+++K R  E+  E ER+ L +A++ AE R T++EL RR LEGELQRLK+G  D+E E+Q  ++R D L +Q+++ E++   LQ  +DRLS  L + +E E   K KV  L+ SL E   +  S Q +L  LQ TL+  E D+R+LQE+++  + +++EAK     L +R+++ Q EL +SE  + E+E E+K   ++  L QR     E Q  I ++  E+  + ERL +L  ++A LE+E++D E+   + EK+K++L+ TLDK+E++K + EE   +   +++  D     +E E +   +Q+  LQ  LAE EQ H+    E   R ++E   E ++L+++    E+TL  RER+HR +VK LEEQ++ LK+QL QE+K+R+  L
Sbjct:  431 ELSLHLSKLQYEDAALRDSLTKMGNLNEGLVQDKVDLNKYILQLEEEKAVLQAQKREAEQEKLSIRDELVRQEQNRLELESSRVTLQQSLQDTEFSRVGVEAELQNLRAERLKLQEKVAQVA------SLDSELSLAKGEGQRSEMALEEAGRSRAELTKDKAALVVQLTASERENAMLAEELTAFRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETATDAENQLAQAERDK--QALTQALSAAQL-----EAQQASLVR--------------------HSLQMEHETAVR-KLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSL--------NETCADLRSRADLEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQ-TLSMTQKRLVES-------ESGWRSCERELTAQLQEARGCEKKLQDEAKNLSVRAQAAQESAGRLTAT-----------EAELTRAEASKRDLEFRLSSLQSALTRTLGI-----------------------GASGRASRGRSPGGRSTPDNT-MGSGAVSPEGGGTPLPPAQPELDPDTLRSGLRDFLQELRDAHRQRDDAQCQLMTLQRELEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQEAAADHSSTQTRLTALQKTLSLVEQDKRLLQEKMDEARTSVTEAKRSMFALTERVQSLQGELTQSELLREELEAELKNTQEVRALRQRSGSLAETQHSIQKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEGSMRLSAEKTRLDRSLNAVEQELQEAQQQMLMLQVTLAEMEQAHSG--CEGLLRQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVSTLKEQLQQEMKRRQPPL 1651          

HSP 2 Score: 127.487 bits (319), Expect = 1.045e-28
Identity = 103/361 (28.53%), Postives = 178/361 (49.31%), Query Frame = 1
Query:  292 SNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDT 1374
            S  D P  +P  V++I+ ++  D                       SS        + S+  L+ EN  L+  L  +E+ L   + +RD LAIK+ AI+E+L +   +E            +   + SLA Q ++LR++LD++   Y+RKL A  + Q +QA+L+++LQ K+ Q + R G +E+  Q+ S   SE+ +                           +D +  LE  +  L+EEQ +S SL  + A+LR+QL++A  AN+ L+ D++RL+ + +  + ELEQK+ DW+ +E +F  +   E  R+ + W  VV F+R   ++KSS   D+    ++ + S Q  R   S +D+
Sbjct:   25 SPDDPPACLPARVREIVTKNLSD-----------------------SSECSPQAGEMSSLMSLQEENRVLQGELARLEDLLAHSRADRDELAIKYGAISERLEQALRSE------TGEGEADSQASRSLAQQNVELRRRLDEEQAAYRRKLTAYQEGQQRQAQLVQKLQAKVLQYKKRCGDLEQKLQEKS---SELEKC--------------------------SDSSSSLEEALLHLEEEQQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSS---DVRGRLLSAQSSAQKFRKQLSEIDS 324          
BLAST of Rootletin-2 vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 384.8 bits (987), Expect = 4.254e-108
Identity = 407/1308 (31.12%), Postives = 696/1308 (53.21%), Query Frame = 1
Query: 2557 EYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLE--TANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEK------QRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQI--LSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNL 6450
            E  +  +K + E+A LRD   ++ ++N  LV++  +    I Q E EK  L  +K+  EQEK  IR+EL+R E  + EL   +  L QS+Q+ E S   ++ EL  L  E+ +L+   A V       +L +EL  A+ + +R   A++++ + +  L K+K  L+ QLT  E E    A+ +   + E+E L+ SL+++QQ + Q E+  E LE+  Q L  +      E       Q  Q E D   Q L++A  + Q+     E +   ++R                     +  M+++  ++ + ++E++D   +  R+KEEL   +  +Q ERD  LL+AE  KQ A++L E EK  + EK+S L   L     + ERT  E     +Q+Q  +     +L++ R Q E     H+R+I +L     +L ++    ++E E+ ++ L  AEE R+ LR+D  E+  ++ +T++  E  RRE  + +R+  +V +E + +  SN +LRE L+++E ++I ++RQ ++ + +L +LEE     QKEV + R  L++ E++R++ RREL+ELR Q+K LD +R +   E++ LQ R++ +E +E E  +E F LKQK+ E++ T     K+L +S       E    S E+       E     K L++   NL  + +    +  + +  LS  + R++  E ++   +  ++  E RL+++ S L + +G                           GR S   S   + +         G +++ +       +LDP+ +R  LRD  Q +    R+RDD + +      + +E  ++ + A  R  QLQ +  E +E K+G+D RL+S Q  L  QE+ + R +RER++L D+V +LER L   E EKK+ QE+++K R  E+  E ER+ L +A++ AE R T++EL RR LEGELQRLK+G  D+E E+Q  ++R D L +Q+++ E++   LQ  +DRLS  L + +E E   K KV  L+ SL E   +  S Q +L  LQ TL+  E D+R+LQE+++  + +++EAK     L +R+++ Q EL +SE  + E+E E+K   ++  L QR     E Q  I ++  E+  + ERL +L  ++A LE+E++D E+   + EK+K++L+ TLDK+E++K + EE   +   +++  D     +E E +   +Q+  LQ   A     H+  ++    R ++E   E ++L+++    E+TL  RER+HR +VK LEEQ+     QL QE+K+R+  L
Sbjct:  438 ELSLHLSKLQYEDAALRDSLTKMGNLNEGLVQDKVDLNKYILQLEEEKAVLQAQKREAEQEKLSIRDELVRQEQNRLELESSRVTLQQSLQDTEFSRVGVEAELQNLRAERLKLQEKVAQVA------SLDSELSLAKGEGQRSEMALEEAGRSRAELTKDKAALVVQLTASERENAMLAEELTAFRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETATGEGKTNAENQLAQAERDK--QALTQALSAAQL-----EAQQASLVR--------------------HSLQMEHETAVR-KLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSLNETCADLRSRADVALKELEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQ-TLSMTQKRLVES-------ESGWRSCERELTAQLQEARGCEKKLQDEAKNLSVRAQAAQESAAQCSLQLSEAQGRLTATEAELTRAEASKRDLEFRLSSLQSALTRTLGI-----------------------GASGRASRGRSPGGSSASP-------GSISRGTPLPPAQPELDPDTLRSGLRDFLQELRDAHRQRDDAQCQLMTLQRELEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQEAAADHSSTQTRLTALQKTLSLVEQDKRLLQEKMDEARTSVTEAKRSMFALTERVQSLQGELTQSELLREELEAELKNTQEVRALRQRSGSLAETQHSIQKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEGSMRLSAEKTRLDRSLNAVEQELQEAQQQMLMLQV-TASNSSAHSTGLL----RQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVWFHDSQLQQEMKRRQPPL 1668          

HSP 2 Score: 126.331 bits (316), Expect = 2.611e-28
Identity = 97/334 (29.04%), Postives = 167/334 (50.00%), Query Frame = 1
Query:  292 SNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSN 1293
            S  D P  +P  V++I+ ++  D                       SS        + S+  L+ EN  L+  L  +E+ L   + +RD LAIK+ AI+E+L +   +E            +   + SLA Q ++LR++LD++   Y+RKL A  + Q +QA+L+++LQ K+ Q + R G +E+  Q+ S   SE+ +                           +D +  LE  +  L+EEQ +S SL  + A+LR+QL++A  AN+ L+ D++RL+ + +  + ELEQK+ DW+ +E +F  +   E  R+ + W  VV F+R   ++KSS+
Sbjct:   35 SPDDPPACLPARVREIVTKNLSD-----------------------SSECSPQAGEMSSLMSLQEENRVLQGELARLEDLLAHSRADRDELAIKYGAISERLEQALRSE------TGEGEADSQASRSLAQQNVELRRRLDEEQAAYRRKLTAYQEGQQRQAQLVQKLQAKVLQYKKRCGDLEQKLQEKS---SELEKC--------------------------SDSSSSLEEALLHLEEEQQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSSS 310          
BLAST of Rootletin-2 vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 361.688 bits (927), Expect = 3.464e-101
Identity = 372/1185 (31.39%), Postives = 641/1185 (54.09%), Query Frame = 1
Query: 2935 ALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEK------QRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMREN---EELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGS--DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQI--LSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNL 6450
            +L +EL  A+ + +R   A++++ + +  L K+K  L+ QLT  E E    A+ +   + E+E L+ SL+++QQ + Q E+  E LE+  Q L  +      E       Q  Q E D   Q L++A  + Q+     E +   ++R                     +  M+++  ++ + ++E++D   +  R+KEEL   +  +Q ERD  LL+AE  KQ A++L E EK  + EK+S L   L     + ERT  E     +Q+Q  +     +L++ R Q E     H+R+I +L        N+   D+R     E+ ++ L  AEE R+ LR+D  E+  ++ +T++  E  RRE  + +R+  +V +E + +  SN +LRE L+++E ++I ++RQ ++ + +L +LEE     QKEV + R  L++ E++R++ RREL+ELR Q+K LD +R +   E++ LQ R++ +E +E E  +E F LKQK+ E++  +E L ++L  + ++  E E    S E+       E     K L++   NL  + +    +  + +  LS  + R++  E ++   +  ++  E RL+++ S L + +G                       +  + R +  N++           G      +   + +P +  +LDP+ +R  LRD  Q +    R+RDD + +      + +E  ++ + A  R  QLQ +  E +E K+G+D RL+S Q  L  QE+ + R +RER++L D+V +LER L   E EKK+ QE+++K R  E+  E ER+ L +A++ AE R T++EL RR LEGELQRLK+G  D+E E+Q  ++R D L +Q+++ E++   LQ  +DRLS  L + +E E   K KV  L+ SL E   +  S Q +L  LQ TL+  E D+R+LQE+++  + +++EAK     L +R+++ Q EL +SE  + E+E E+K   ++  L QR     E Q  I ++  E+  + ERL +L  ++A LE+E++D E+   + EK+K++L+ TLDK+E++K + EE   +   +++  D     +E E +   +Q+  LQ  LAE EQ H+    E   R ++E   E ++L+++    E+TL  RER+HR +VK LEEQ++ LK+QL QE+K+R+  L
Sbjct:  416 SLDSELSLAKGEGQRSEMALEEAGRSRAELTKDKAALVVQLTASERENAMLAEELTAFRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETATGEGKTNAENQLAQAERDK--QALTQALSAAQL-----EAQQASLVR--------------------HSLQMEHETAVR-KLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSL--------NETCADLRSRADLEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQTARESLKRELSMTQKRLVESESGWRSCERELTAQLQEARGCEKKLQDEAKNLSVRAQAAQESAAQCSLQLSEAQGRLTATEAELTRAEASKRDLEFRLSSLQSALTRTLGI---------------------GASGRARSTPDNTM-----------GSGAVSPEGGGTPLPPAQPELDPDTLRSGLRDFLQELRDAHRQRDDAQCQLMTLQRELEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQEAAADHSSTQTRLTALQKTLSLVEQDKRLLQEKMDEARTSVTEAKRSMFALTERVQSLQGELTQSELLREELEAELKNTQEVRALRQRSGSLAETQHSIQKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEGSMRLSAEKTRLDRSLNAVEQELQEAQQQMLMLQVTLAEMEQAHSG--CEGLLRQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVSTLKEQLQQEMKRRQPPL 1530          

HSP 2 Score: 95.9005 bits (237), Expect = 4.796e-19
Identity = 58/177 (32.77%), Postives = 107/177 (60.45%), Query Frame = 1
Query:  844 LNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDT 1374
            L ++N  L+ E++RL++    + +D   R ++A  +   +E D +  LE  +  L+EEQ +S SL  + A+LR+QL++A  AN+ L+ D++RL+ + +  + ELEQK+ DW+ +E +F  +   E  R+ + W  VV F+R   ++KSS ERDL  +R  + + +  ++++C+ L  
Sbjct:    7 LQEENRVLQGELARLEDLLAHSRAD---RDELAIKYGAISERDSSSSLEEALLHLEEEQQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSSAERDLSDMRGELVRMSHLVQVSCAGLSA 180          
BLAST of Rootletin-2 vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 348.206 bits (892), Expect = 1.482e-96
Identity = 401/1309 (30.63%), Postives = 690/1309 (52.71%), Query Frame = 1
Query: 2665 FKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQ--DELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQK------------------SMKDK--------EVLAKEKIDL-------ISQLTTFEHELREN---ADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMREN---EELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGS--DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLA-EAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKS 6459
            F+  + + +S K       +AL+++K     E    + EKE+L Q +D       N+EK+ + L   +++ +++YEK QL  A+   QRER+    E   A  D ER    +Q+                  +++D         E L ++K+DL       ++    F   L+     A A    + E+E L+ SL+++QQ + Q E+  E LE+  Q L  +      E +RL+ + + +L +  + K++L   L+ ++ E  +  R      +E++ERL  E+E +R+      E    + ++E++D   +  R+KEEL   +  +Q ERD  LL+AE  KQ A++L E EK  + EK+S L   L     + ERT  E     +Q+Q  +     +L++ R Q E     H+R+I +L        N+   D+R     E+ ++ L  AEE R+ LR+D  E+  ++ +T++  E  RRE  + +R+  +V +E + +  SN +LRE L+++E ++I ++RQ ++ + +L +LEE     QKEV + R  L++ E++R++ RREL+ELR Q+K LD +R +   E++ LQ R++ +E +E E  +E F LKQK+ E++  +E L ++L  + ++  E E    S E+       E     K L++   NL  + +    +  + +  LS  + R++  E ++   +  ++  E RL+++ S L + +G                       +  + R +  N++           G      +   + +P +  +LDP+ +R  LRD  Q +    R+R +   K +    + +E  ++ + A  R  QLQ +  E +E K+G+D RL+S Q  L  QE+ + R +RER++L D+V +LER L   E EKK+ QE+++K R  E+  E ER+ L +A++ AE R T++EL RR LEGELQRLK+G  D+E E+Q  ++R D L +Q+++ E++   LQ  +DRLS  L + +E E   K KV  L+ SL E   +  S Q +L  LQ TL+  E D+R+LQE+++  + +++EAK     L +R+++ Q EL +SE  + E+E E+K   + L QR     E Q  I ++  E+  + ERL +L  ++A LE+E++D E+   + EK+K++L+ TLDK+E++K + EE    S+   +E     R L   N V     +  Q  L  +  Q H+    E   R ++E   E ++L+++    E+TL  RER+HR +VK LEEQ++ LK+QL QE+K+R+  L  +
Sbjct:  394 FRKQLSEIDSAKRDADQRNQALQRDKDAALRERETAQREKEQLKQERDN---EKANLEKAVQALHSSNQMLQMDYEKLQLAVASA--QRERDREREEKEAAIHDGERWKTEIQRITNKELSLHLSKLQYEDAALRDSLTKMGNLNEGLVQDKVDLNKYILQVMAMCLHFSLVLKYRILVAFACLACRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETATVELRRLRSDAENQLAQAERDKQALTQALSAAQLEAQQASRKATSEHQEEVERLALEKEVVRHSLQMEHETAVRKLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSL--------NETCADLRSRADLEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQTARESLKRELSMTQKRLVESESGWRSCERELTAQLQEARGCEKKLQDEAKNLSVRAQAAQESAAQCSLQLSEAQGRLTATEAELTRAEASKRDLEFRLSSLQSALTRTLGI---------------------GASGRARSTPDNTM-----------GSGAVSPEGGGTPLPPAQPELDPDTLRSGLRDFLQELRDAHRQRVNDCFKHETDTAQLEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQEAAADHSSTQTRLTALQKTLSLVEQDKRLLQEKMDEARTSVTEAKRSMFALTERVQSLQGELTQSELLREELEAELKNTQEALRQRSGSLAETQHSIQKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEG---SMRLSAEKTRLDRSL---NAVEQELQEAQQQMLMLQVTQAHSG--CEGLLRQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVSTLKEQLQQEMKRRQPPLPST 1649          

HSP 2 Score: 145.206 bits (365), Expect = 4.751e-34
Identity = 103/361 (28.53%), Postives = 179/361 (49.58%), Query Frame = 1
Query:  292 SNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDT 1374
            S  D P  +P  V++I+ ++  D                       SS        + S+  L+ EN  L+  L  +E+ L   + +RD LAIK+ AI+E+L +   +E            +   + SLA Q ++LR++LD++   Y+RKL A  + Q +QA+L+++LQ K+ Q + R G +E+  Q+                                 KS+E +K     S +  L+EEQ +S SL  + A+LR+QL++A  AN+ L+ D++RL+ + +  + ELEQK+ DW+ +E +F  +   E  R+ + W  VV F+R   ++KSS ERDL  +R  + + +  ++++C+ L  
Sbjct:   25 SPDDPPACLPARVREIVTKNLSD-----------------------SSECSPQAGEMSSLMSLQEENRVLQGELARLEDLLAHSRADRDELAIKYGAISERLEQALRSE------TGEGEADSQASRSLAQQNVELRRRLDEEQAAYRRKLTAYQEGQQRQAQLVQKLQAKVLQYKKRCGDLEQKLQE---------------------------------KSSELEKC----SALLHLEEEQQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSSAERDLSDMRGELVRMSHLVQVSCAGLSA 319          
BLAST of Rootletin-2 vs. Ensembl Medaka
Match: CROCC (ciliary rootlet coiled-coil, rootletin [Source:NCBI gene;Acc:101159974])

HSP 1 Score: 347.436 bits (890), Expect = 2.315e-96
Identity = 392/1308 (29.97%), Postives = 674/1308 (51.53%), Query Frame = 1
Query: 2557 EYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLE--TANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEK------QRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGS--DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNL 6450
            E  +  +K + E+A LRD   ++ ++N  LV++  +    I Q E EK  L  +K+  EQEK  IR+EL+R E  + EL   +  L QS+Q+ E S   ++ EL  L  E+ +L+   A V       +L +EL  A+ + +R   A++++ + +  L K+K  L+ QLT  E E    A+ +   + E+E L+ SL+++QQ + Q E+  E LE+  Q L  +      E       Q  Q E D   Q L++A  + Q+     E +   ++R                     +  M+++  ++ + ++E++D   +  R+KEEL   +  +Q ERD  LL+AE  KQ A++L E EK  + EK+S L   L     + ERT  E     +Q+Q  +     +L++ R Q E     H+R+I +L     +L ++    ++E E+ ++ L  AEE R+ LR+D  E+  ++ +T++  E  RRE  + +R+  +V +E + +  SN +LRE L+++E ++I ++RQ ++ + +L +LEE     QKEV + R  L++ E++R++ RREL+ELR Q+K LD +R +   E++ LQ R++ +E +E E  +E F LKQK+ E++ T     K+L +S       E    S E+       E     K L++   NL  + +    +  + +  LS  + R++  E ++   +  ++  E RL+++ S L + +G                             + +  S   N       +G      +   + +P +  +LDP+ +R  LRD  Q +    R+RDD + +      + +E  ++ + A  R  QLQ +  E +E K+G+D RL+S Q  L  QE+ + R +RER++L D+V +LER L   E EKK+ QE+++K R  E+  E ER+ L +A++ AE R T++EL RR LEGELQRLK+G  D+E E+Q  ++R D L +Q+++ E++   LQ  +DRLS  L + +E E   K KV  L+ SL E                   A+++H     Q RL +++  LS                   L+E + R  ++ G  +   + L+       E Q  I ++  E+  + ERL +L  ++A LE+E++D E+   + EK+K++L+ TLDK+E++K + EE   +   +++  D     +E E +   +Q+  LQ  +   EQ H+    E   R ++E   E ++L+++    E+TL  RER+HR +VK LEEQ++ LK+QL QE+K+R+  L
Sbjct:  452 ELSLHLSKLQYEDAALRDSLTKMGNLNEGLVQDKVDLNKYILQLEEEKAVLQAQKREAEQEKLSIRDELVRQEQNRLELESSRVTLQQSLQDTEFSRVGVEAELQNLRAERLKLQEKVAQVA------SLDSELSLAKGEGQRSEMALEEAGRSRAELTKDKAALVVQLTASERENAMLAEELTAFRSERETLETSLFDAQQQLLQAESCREQLEAENQNLRVRCETATGEGKTNAENQLAQAERDK--QALTQALSAAQL-----EAQQASLVR--------------------HSLQMEHETAVR-KLRQEVEDQLQKARREKEELQDGLRALQHERDQSLLQAETEKQQALSLKEAEKTVLLEKVSGLQADLSALSLEAERTAREAAQYKEQEQIRVGALTSELQELRSQMEDAAAGHERDILSLNETCADLRSRADVALKELEQCRASLSAAEENREQLRRDFLETERRLTQTQEASENHRREGAELRRSLCDVTRERDALSQSNAQLREALRSAETERISVKRQCEEKEQRLVVLEESLSSSQKEVAELRSCLREVERSRLEARRELQELRRQLKVLDADREQKGRELAELQTRLSLEEQREEERGKEVFILKQKLAETQ-TLSMTQKRLVES-------ESGWRSCERELTAQLQEARGCEKKLQDEAKNLSVRAQAAQESAAQCSLQLSEAQGRLTATEAELTRAEASKRDLEFRLSSLQSALTRTLG-----------------------------IGASGSTPDNT------MGSGAVSPEGGGTPLPPAQPELDPDTLRSGLRDFLQELRDAHRQRDDAQCQLMTLQRELEEQKLERECAENRSTQLQNSLKECQEGKRGLDDRLTSTQILLQQQEDAVKRVDRERRALADRVRELERSLHTAEMEKKHTQEQLNKQRATEARLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLGLGDREAESQASQERHDCLLRQVAEGEAQVSLLQTEVDRLSQALLKAQEGEAALKQKVTTLSQSLQE-------------------AAADHS--STQTRLTALQKTLS-------------------LVEQDKRLLQVSGSTRGGWRSLA-------ETQHSIQKAQTERAAVEERLLALQRAVALLETEKKDAERQAARLEKDKDALRNTLDKVERQKLKCEEGSMRLSAEKTRLDRSLNAVEQELQEAQQQMLMLQVTM---EQAHSG--CEGLLRQRDEAQQEAEKLRNSCKDLERTLSTRERAHRHRVKGLEEQVSTLKEQLQQEMKRRQPPL 1630          

HSP 2 Score: 127.102 bits (318), Expect = 1.491e-28
Identity = 103/361 (28.53%), Postives = 178/361 (49.31%), Query Frame = 1
Query:  292 SNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDT 1374
            S  D P  +P  V++I+ ++  D                       SS        + S+  L+ EN  L+  L  +E+ L   + +RD LAIK+ AI+E+L +   +E            +   + SLA Q ++LR++LD++   Y+RKL A  + Q +QA+L+++LQ K+ Q + R G +E+  Q+ S   SE+ +                           +D +  LE  +  L+EEQ +S SL  + A+LR+QL++A  AN+ L+ D++RL+ + +  + ELEQK+ DW+ +E +F  +   E  R+ + W  VV F+R   ++KSS   D+    ++ + S Q  R   S +D+
Sbjct:   39 SPDDPPACLPARVREIVTKNLSD-----------------------SSECSPQAGEMSSLMSLQEENRVLQGELARLEDLLAHSRADRDELAIKYGAISERLEQALRSE------TGEGEADSQASRSLAQQNVELRRRLDEEQAAYRRKLTAYQEGQQRQAQLVQKLQAKVLQYKKRCGDLEQKLQEKS---SELEKC--------------------------SDSSSSLEEALLHLEEEQQRSSSLSAVNAMLREQLEQAGLANEALSRDIRRLTADWTKAREELEQKESDWRREEESFHSYFSSEHGRLLTFWRQVVGFRRHVCEMKSS---DVRGRLLSAQSSAQKFRKQLSEIDS 338          
BLAST of Rootletin-2 vs. Planmine SMEST
Match: SMESG000081227.1 (SMESG000081227.1)

HSP 1 Score: 4200.97 bits (10894), Expect = 0.000e+0
Identity = 2203/2203 (100.00%), Postives = 2203/2203 (100.00%), Query Frame = 1
Query:  109 MSSANRDERLEQVAQKLNKFTDIFYQRVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA 6717
            MSSANRDERLEQVAQKLNKFTDIFYQRVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA
Sbjct:    1 MSSANRDERLEQVAQKLNKFTDIFYQRVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA 2203          
BLAST of Rootletin-2 vs. Planmine SMEST
Match: SMESG000081227.1 (SMESG000081227.1)

HSP 1 Score: 4165.15 bits (10801), Expect = 0.000e+0
Identity = 2192/2203 (99.50%), Postives = 2192/2203 (99.50%), Query Frame = 1
Query:  109 MSSANRDERLEQVAQKLNKFTDIFYQRVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA 6717
            MSSANRDERLEQVAQ           RVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA
Sbjct:    1 MSSANRDERLEQVAQ-----------RVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA 2192          
BLAST of Rootletin-2 vs. Planmine SMEST
Match: SMESG000081227.1 (SMESG000081227.1)

HSP 1 Score: 4091.19 bits (10609), Expect = 0.000e+0
Identity = 2161/2203 (98.09%), Postives = 2161/2203 (98.09%), Query Frame = 1
Query:  109 MSSANRDERLEQVAQKLNKFTDIFYQRVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA 6717
            MSSANRDERLEQVAQ           RVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQK                               FQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA
Sbjct:    1 MSSANRDERLEQVAQ-----------RVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQK-------------------------------FQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYEPEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASPTRA 2161          
BLAST of Rootletin-2 vs. Planmine SMEST
Match: SMESG000081227.1 (SMESG000081227.1)

HSP 1 Score: 3755.3 bits (9737), Expect = 0.000e+0
Identity = 1973/1984 (99.45%), Postives = 1973/1984 (99.45%), Query Frame = 1
Query:  109 MSSANRDERLEQVAQKLNKFTDIFYQRVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVXXXXXXXXXXXXXXXQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNS 6060
            MSSANRDERLEQVAQ           RVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNS
Sbjct:    1 MSSANRDERLEQVAQ-----------RVENVLADRDNQGYLKYNSGRIVSNTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKPNSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERDNLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAEREELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYSESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNS 1973          
BLAST of Rootletin-2 vs. Planmine SMEST
Match: SMESG000071494.1 (SMESG000071494.1)

HSP 1 Score: 1085.86 bits (2807), Expect = 0.000e+0
Identity = 805/1998 (40.29%), Postives = 1246/1998 (62.36%), Query Frame = 1
Query:  691 IQLRKQLDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQNSKLR-SEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNELKEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELEQKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLHQLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLSKMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHKLRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVDDSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSLDRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSVKKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLEEDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDRNLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQENSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKENSEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKDGLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVLQEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQHEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKXXXXXXXXXXXXXXXXXXXXFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDCLLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIRAQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQDMRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEKRNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEEQKQVLQKEVKDTRYNLQDTEKARVDVXXXXXXXXSQVKKLDTERGKLVNEVSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKNEELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELNSTLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQTLXXXXXXXXXXXXXXXXEKGR---------VSSRNSVE--FNFSEDRK--RVGRFGDVN--QYSESVIPGS------DLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETSVQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNERERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKAVDDAENRCTXXXXXXXXXXXXXXXXKMGFNDKETENQVLRDRVDALTKQISDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQSMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKATQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLLTERLNSLTASLAGLESERRDIEKVHIKTEKEKNSXXXXXXXXXXXXNRSEESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIMELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILKDQLSQELKKR-----ELNLNKSNRGLKNDICDIKSILEKNSNNISK-TSFDNLLYEPEIRRMKDILSESG 6600
            ++LRK+L+++H EY+RKL    D Q KQA+L++RLQ+K+ Q +      EK  +  SK++  +    K  + + T+  N     +EN         N+DLES + +L+EEQ K+  L +    L++QL +AT +NQ LT D+ +LSEE    + ELEQ++  W+++E +F+ +L  E + +++L    +NF+RQF ++K+S ER+++ L+    +  + L+ ACSNL  N  +  S+ Q   + E  +   LEN L +   E    +T+Y+ ++  L  +   +   ++ L  +  +K++ LT L +++NG   D    I N +D ATR LI DT+++HQALR+I+Q+V+ND            DY D   T  +   T+  N    NRS     P++  H +                 + D+T AAV+SA++K++LQ+Q+L SK+NS+K +  + K+Q+DD+ENERR LE Q + +R E +S  R+ DD  RE +R ++ +++   ++ +L+K R +  ++ +    ++E+LK+ N+ELQR +E L D  +D  ++LERQ KE ER  +SI+  E K SR KE++ + KE++N+  LEKEVL QE   + D+L++ E+ KAE E++ NK +T E  L +   +L S    L  + +E    I Q E E+  L  EK+ LEQEK G+++EL+R E E   L+  K    Q ++ +E + E L++ELS+LN EK  L      LQR+++AL+ ELLQ RR+ ER + +V    K+KE L KEK +L+ Q+T  E E R+ ++ I  L  ++EQL+ +LY++QQ I QLE + E LE   Q+L  K+  +  E  RL+ EF +E +K+  ++E L  +  + +KE+   ++ E+++  ED+ERL    E  R+     +EE+  +F  E DD+     ++K+E+AQEI+TIQRERDD LL AE  KQ +++LLEQEK ++ EK+ +    L++ ES+L+R + E   R +QD+  I   + +LK FR QFE    +H+ E+K+L    K+L   K Q ++E  +L + LKIAEETRDNLR+++ E   K++E E+ +E L+RE+ + KR   E ++E E +  SN+ LR+K+K  E ++ID+ RQ+ D + K+++ +EQ    ++EV + R NL+D EKAR+DV+REL+ELR  +K+LDTERGKL  EV+ LQ RVA DE KE EARRENFGLKQKV+E+EA++E + K L  + R   +LE +L SK++      +   +DY+ L +++ +L+   +    +  EL   LS  E R+S LE+ I  ++  +K  E +LA+IHS LR+LIGFRQ+   T+R+R+ S           +GR         VS     +  +  + D K   + R G  +  Q   S  P +      D++PEAVR+ALR+  Q +V  ER+RDD   +A++   +  E   Q + A  R+ QLQ+   + EEDKKGID RLSSAQTALMMQEETI RNER+RK++ +K+   +R  A +E+EK+ L++R++K R  ++  EEE +   KA+++AENR TQL+L +R LEG+LQR+KM   DKETE +VL DRV++L KQI DLE K+QSLQLTIDR+S+ LA+TEEE +  KDK+ QLN+SLS H   L+ +Q+K+ QLQ  L SSE DRR+L+ERLES K  L EAK QN+ L++R++  Q +L +SE+R+ E+EG  ++ + ++ QRQE EQEL  K  +   EKN L ER+NS+  +LA  E+E+++I K H K EK++++LKK+L K+E++K ++EE  ++++ +RSE D+  RRLEDEN  L RQV  LQNQLAEAEQ H   +ME+ SR + EM  E++ L+++    E+TL+ RER+HRQ+VK LEEQI+ LKDQL+ E+++R       +  KSN+   +   D++ +L+ +   ++K    D +L E E RR+ + +   G
Sbjct:   35 LELRKRLEEEHNEYRRKLIVFQDSQQKQAQLVQRLQKKVLQYK------EKCTELESKMQFGDYETRKTKYGSPTN--NGYGSRSENPYD------NLDLESTLIKLEEEQKKTNYLTEFNERLQEQLTQATQSNQNLTRDISKLSEEWQRSREELEQREKIWRNEEMSFNDYLASEHSNLQNLQRNTINFRRQFIELKASTEREINNLKNEFNRQARCLQTACSNLSCNMKSAESKQQLSTERESRDKLNLENQLREKNRELTDYQTRYECEMTELQHRVKELTVLSDKLKIQNLEKDRALTALQRIKNG---DTAGEI-NMEDKATRVLIEDTESMHQALRNISQVVLND-----------SDYFDAEDTGFE---TVRKN----NRS-----PNQLKHRH-----------------LPDATYAAVQSAINKKSLQIQELKSKLNSSKESCTNFKRQIDDNENERRRLENQVLAMRDEIESLRRDKDDSFREADRFKNALNITSNERSQLEKIRSSLNDQIEQQLTEIERLKSANHELQRLREALEDEQEDTKKDLERQIKESERCQRSIDVLEDKISRFKEDVVNYKEAINKYQLEKEVLVQEKDEIGDALSRCEISKAELEIEVNKRQTIEVNLEENISKLSSEIEELNDKRAENHRTIKQLEHERSSLLNEKRCLEQEKSGLKDELVRSEQEALGLSNEKAIQRQRIEQLEINTERLEEELSELNREKLDLTEQIGCLQRQKSALAEELLQCRRELERSNNSVNNLSKEKEYLTKEKGELVVQVTACERENRQQSEVIASLNSDREQLEATLYDAQQLIIQLETRKEQLEGENQELIVKKENLNGELVRLRQEFQLEYEKVVNSREQLNCRYQQMDKEYKMAIQQERDSHAEDVERLTKINESNRHGSENEREELIHRFNMERDDMIQNYEQEKQEMAQEIMTIQRERDDSLLMAENEKQQSLSLLEQEKCAINEKLIKTQFELQSVESELDRIKKESSNRQEQDKQNIAGLSSELKSFRSQFEDKCQNHEMEVKSLNNGIKDLTLMKDQALKEVHDLHTGLKIAEETRDNLRREIMEMNRKLKEAEEAKEHLKREINELKRGLCEEQREKENVINSNENLRKKIKDVETERIDLHRQVTDSKQKVAVQDEQLVNSKQEVNELRNNLKDVEKARLDVKRELQELRRHIKELDTERGKLTKEVNDLQTRVARDEEKEDEARRENFGLKQKVVETEASREAVRKDLANAQRHIVDLENVLQSKDRDFSSMVESSRRDYRKLADARNSLQQVYDTMVADNNELRIALSGAEGRVSALESHIARVEGAKKEIEFKLASIHSSLRRLIGFRQENVVTIRSRNNSKSPV-------RGRSVSPLRSRPVSPTKGFDNTYATTTDGKGSPIPRTGSPSSKQRQLSRSPSNCDFNPVDINPEAVRLALREFVQQLVDAERDRDDAFAQARSLESRLKEQEEQNEYAENRLQQLQQALCDAEEDKKGIDGRLSSAQTALMMQEETIRRNERDRKAMAEKLSNYDRTFASMESEKRQLEDRLNKFRHHDARLEEEHKQSKKAIENAENRITQLQLAKRSLEGDLQRMKMALTDKETETEVLDDRVNSLLKQIQDLEGKSQSLQLTIDRMSVALAKTEEEGSFHKDKMQQLNMSLSTHSQQLEQLQNKISQLQKALGSSEQDRRLLEERLESSKGALHEAKHQNNLLMERIQIIQSDLNDSENRRSELEGLNRQSNTLIVQRQEAEQELNQKYQKLNSEKNTLQERVNSMQRNLALAEAEKQEIIKNHGKLEKDRSALKKSLGKVERQKLKTEEIASKTVFERSELDQILRRLEDENCELQRQVGILQNQLAEAEQAHCHHLMEINSRHRQEMSMEMEHLRASNVQIERTLEGRERAHRQRVKGLEEQISTLKDQLTHEMQRRMDSGYYESTRKSNQ--YDSTGDLRHVLDSSLTRVAKDPQLDAMLLETEARRLDESIFMCG 1965          
The following BLAST results are available for this feature:
BLAST of Rootletin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CROCC0.000e+033.16ciliary rootlet coiled-coil, rootletin [Source:HGN... [more]
CROCC1.929e-14232.19ciliary rootlet coiled-coil, rootletin [Source:HGN... [more]
CROCC5.760e-7730.00ciliary rootlet coiled-coil, rootletin [Source:HGN... [more]
CROCC23.246e-6725.88ciliary rootlet coiled-coil, rootletin family memb... [more]
CEP2504.073e-4224.09centrosomal protein 250 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Rootletin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lfi-12.326e-2522.51Lin-5 (Five) Interacting protein [Source:UniProtK... [more]
lfi-13.683e-2522.51Lin-5 (Five) Interacting protein [Source:UniProtK... [more]
lfi-13.683e-2522.51Lin-5 (Five) Interacting protein [Source:UniProtK... [more]
epi-15.024e-1321.15Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
epi-15.029e-1321.15Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Rootletin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Root2.327e-7423.12gene:FBgn0039152 transcript:FBtr0339245[more]
Root2.327e-7423.12gene:FBgn0039152 transcript:FBtr0339244[more]
Root2.327e-7423.12gene:FBgn0039152 transcript:FBtr0304161[more]
back to top
BLAST of Rootletin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
crocc24.201e-14328.76ciliary rootlet coiled-coil, rootletin family memb... [more]
crocc21.910e-5928.66ciliary rootlet coiled-coil, rootletin family memb... [more]
si:dkey-230p4.11.410e-1725.28si:dkey-230p4.1 [Source:ZFIN;Acc:ZDB-GENE-081104-3... [more]
si:dkey-230p4.12.721e-1725.36si:dkey-230p4.1 [Source:ZFIN;Acc:ZDB-GENE-081104-3... [more]
back to top
BLAST of Rootletin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgm23.753e-15628.81phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1... [more]
pgm22.514e-15529.11phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1... [more]
pgm21.826e-15328.39phosphoglucomutase 2 [Source:Xenbase;Acc:XB-GENE-1... [more]
CROCC1.116e-11936.10ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
ENSXETT00000012599.11.139e-1430.71centrosomal protein 250 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of Rootletin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crocc0.000e+033.23ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc0.000e+033.37ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc0.000e+033.37ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc0.000e+033.37ciliary rootlet coiled-coil, rootletin [Source:MGI... [more]
Crocc21.693e-3727.03ciliary rootlet coiled-coil, rootletin family memb... [more]
back to top
BLAST of Rootletin-2 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5TZA2|CROCC_HUMAN0.000e+033.16Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV... [more]
sp|Q8CJ40|CROCC_MOUSE0.000e+033.23Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 S... [more]
sp|H7BZ55|CRCC2_HUMAN7.168e-6825.85Putative ciliary rootlet coiled-coil protein 2 OS=... [more]
sp|Q9BV73|CP250_HUMAN1.956e-4124.09Centrosome-associated protein CEP250 OS=Homo sapie... [more]
sp|Q8IVE0|CROL2_HUMAN4.750e-1632.61Putative ciliary rootlet coiled-coil protein-like ... [more]
back to top
BLAST of Rootletin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203177560.000e+099.41tr|A0A481MTJ1|A0A481MTJ1_SCHMD Rootletin-2 OS=Schm... [more]
gnl|BL_ORD_ID|183143300.000e+041.23tr|A0A267H6I3|A0A267H6I3_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182294580.000e+039.13tr|A0A1I8FWZ5|A0A1I8FWZ5_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182479680.000e+041.14tr|A0A267F2Q1|A0A267F2Q1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|170380780.000e+041.96tr|A0A1S3JC29|A0A1S3JC29_LINUN rootletin-like isof... [more]
back to top
BLAST of Rootletin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crocc22.688e-13630.97rootletin-like [Source:NCBI gene;Acc:103030367][more]
crocc23.790e-13330.24rootletin-like [Source:NCBI gene;Acc:103030367][more]
si:dkey-230p4.11.291e-1332.23trichohyalin-like [Source:NCBI gene;Acc:103036019][more]
si:dkey-230p4.11.291e-1332.23trichohyalin-like [Source:NCBI gene;Acc:103036019][more]
ENSAMXT00000053516.12.070e-1029.17pep primary_assembly:Astyanax_mexicanus-2.0:22:182... [more]
back to top
BLAST of Rootletin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rootletin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rootletin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423432.376e-9539.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rootletin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CROCC3.511e-11331.88ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
CROCC4.254e-10831.12ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
CROCC3.464e-10131.39ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
CROCC1.482e-9630.63ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
CROCC2.315e-9629.97ciliary rootlet coiled-coil, rootletin [Source:NCB... [more]
back to top
BLAST of Rootletin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081227.10.000e+0100.00SMESG000081227.1[more]
SMESG000081227.10.000e+099.50SMESG000081227.1[more]
SMESG000081227.10.000e+098.09SMESG000081227.1[more]
SMESG000081227.10.000e+099.45SMESG000081227.1[more]
SMESG000071494.10.000e+040.29SMESG000071494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023882 ID=SMED30023882|Name=Rootletin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=6811bp
TATAAATTTTAGCAATCCATATCAACTGATATGAGATTTTCAATTTCGCA
TTAATTTAAAATATTTATTCAAGTCACACATCTTAAATCTGGTTTTATAA
GAATCATAATGAGTTCCGCAAATAGAGACGAGAGATTGGAACAAGTTGCA
CAAAAACTGAATAAATTTACAGATATATTTTACCAGAGAGTGGAAAATGT
TTTAGCTGATAGAGACAATCAAGGATACTTAAAATACAATTCCGGACGAA
TTGTAAGCAATACATCTCCTGGCATCGGCGGTTTCGACCTGTCAAACGGC
GATAAACCCCAAAAAATGCCAGAAGTTGTTAAAGACATCATTCTGAGAGA
TTTTGGTGACACTGATGAGGATGAAGATTCCATAAAGGATTTACGAATGC
CAAAACCAAACTCTCAAAACACTCAGTCAAGCAGTCGCTTACAAACCTAC
GGCAACGGATTAGATTCCGTAACTCAACTAAAAGCAGAAAATGCTACTCT
TAAAGATAGCTTGTTTAATGTTGAAGAAGAACTGTTACGATTGAAAAATG
AAAGAGATAATCTAGCAATTAAATTCAATGCCATAAATGAAAAACTCAAC
AAAACATTTACAGCGGAAAAATGTGGAGATAGAAGAGTGTCTAATGCCAG
CGAAGAACTTAGCAATGCGAATTCTTTAGCATCACAAACGATTCAATTGA
GAAAACAACTTGACGACGATCATCGGGAGTATAAACGCAAACTTGCCGCC
CAGCACGATCACCAGATTAAGCAGGCAGAATTAATTAAAAGACTCCAACA
AAAATTAGAACAACTCGAAGGTCGGAATGGCTTAGTGGAAAAATTAAACC
AACAGAATAGTAAGCTACGGTCTGAAATAAGTCGGTTAAAAAACCATTTC
CAAACAACAACTTCGGATTTAAATCGTCGAATTGACATTGCGGAAAATCA
TCTGAAATCAGCAGAAACCGATAAAAATATGGATCTCGAATCAGTGGTTA
ATGAATTGAAAGAGGAACAGTCAAAATCTATGAGTTTGTTGCAAATGACA
GCTTTATTGAGAGACCAATTAGACGAAGCTACAAATGCAAATCAAGGCCT
AACAGAGGACGTTCAAAGACTGTCAGAAGAAAATAGTTTCTTGAAAAGCG
AATTAGAACAAAAAGACATGGATTGGAAAGACGATGAAGCCACGTTTAGT
CGATTCTTGATTGGTGAACAGAATCGCATTAAATCTTTGTGGAATGCAGT
TGTAAATTTTAAAAGACAATTCAATGACATTAAATCGTCAAATGAACGAG
ATTTGCATCAGTTACGGGTTAACATTGAACAATCTACTCAGTCGTTACGA
TTAGCTTGTTCAAATCTTGACACGAATCACGTAAACAGGTTAAGTCAATT
ACAGTTCCAACTGGATACAGAAAAAAATAATTGCTCCCAGTTAGAAAATT
CTTTATCCAAAATGAAAGAAGAATTCCGAAAAACTGAAACTCAATATCAA
AAACAGATTGAATCATTAAATGAGCAATTTGTCCACGTCAATCGCTCTAA
TGAAAGTCTAACGAAAGAGCTTGCTGATAAAGAAAAAGTCCTAACTACTC
TCCACAAATTAAGAAATGGCATGAATGGAGATTTAGACAATTCAATATAC
AACAATGATGATTCTGCTACCAGACAGTTGATTATTGACACTGATGCTGT
TCATCAAGCATTAAGGGATATCGCTCAACTTGTTATGAATGATGTCGATC
AAGTTGATGACTCTCCATGGATGCAAGATGATTATCTGGACGAATCCAAA
ACCACGGGACAACTGAAACCAACCCTATCCATAAATAGTTTGCATTCAAA
TAGAAGTGTGAGCCCAACTCGCCCATCGAAACGTAGCCACTTCAACTCAG
GATCTTTAGACAGAAATCGCGTTTATCGAAATAAATCTCCAGTGAGTATT
GCTGATTCAACATGTGCAGCTGTCAGATCGGCTTTACACAAACGAGCACT
TCAAGTTCAAGATTTAACCAGCAAAATCAATTCCGCAAAAAATAATCACA
ATAGCGTCAAAAAACAATTGGATGACAGTGAAAACGAGCGCAGAAATTTA
GAAAAACAATTCATTGAATTGCGAAGTGAATACGATTCAAATCATCGGGA
ACTGGACGACATTCAACGGGAATGTGAACGGATGCGACATACAATTTCAA
TGCTGGAAGAAGACAAATTAAAGTTGGACAAAAGTCGAATGAATTCTTAT
GAAGAATGTAAATCATACAAACAAGACATGGAAAAACTAAAGACTCTTAA
TTACGAATTACAACGCGACAAAGAAAATCTAACAGATAATTGTCAAGATT
TAGATAGAAATCTAGAAAGACAAACGAAAGAAGTGGAGAGATTGACGAAA
TCAATTGAAAATTCCGAAAGTAAGAGTAGTCGACTGAAAGAAGAAATTTC
TTCCCTTAAAGAATCTTTAAATCGGGCTTTACTTGAGAAAGAAGTTTTAG
AACAAGAAAATTCAGTTCTCACAGATTCATTGAATAAGACCGAAGTTCTA
AAAGCCGAATACGAAGTTAAAGCAAACAAATTTAAAACGGAGGAAGCCAG
ACTTCGAGATAAATTCCATCAGTTGGAATCTATGAATCATTTCTTAGTCA
AAGAAAATTCTGAATTCAAAACGATCATAGATCAAACGGAATCGGAAAAG
CATCGGCTTTCTGGAGAGAAAAAAGCCTTGGAACAAGAGAAATACGGCAT
CCGAGAGGAATTAATGCGGGTTGAAAATGAGAAGGAAGAATTGAATCAAA
TGAAAGATGGTCTTCATCAGTCTATGCAAAATGTTGAAAAATCTTATGAA
AATTTACAAGATGAATTATCAAAATTAAATTATGAAAAAGGGCAATTAGA
AACCGCTAATGTGACTTTACAACGGGAGCGAAATGCACTTTCAACAGAAT
TGCTCCAAGCGAGACGAGATGCCGAGCGATTGTCAGCTGCTGTGCAAAAA
TCAATGAAAGATAAAGAAGTGCTAGCTAAAGAAAAAATCGATTTAATATC
ACAATTGACTACTTTTGAACACGAATTGAGAGAAAATGCGGACGCAATTT
ATGTTTTACAAGAAGAAAAAGAACAACTTGATGGTTCACTCTATGAAAGC
CAGCAAAACATTTCTCAATTGGAGGCTAAAATAGAAGCTCTCGAATCTAA
TTTGCAACAATTAGAAAGGAAAAGATCCATTATTTTTGACGAAAAACAAC
GATTGCAACATGAATTTGATGTAGAACTTCAAAAACTTAGTAAAGCTAAA
GAATCTTTACAAATAAAACTTAACGAATCCGAGAAAGAATGGAACAAAAT
TCTCCGATCGGAAAAAGAAGCTCGCGAAGAAGACATTGAACGCTTGATTG
CTGAGAGAGAAGAGCTTCGAAATGAATTCATGAAGTATAAAGAAGAAATA
AAGCTGCAATTTCAAGAGGAAATTGATGATTTGAGACATAGATTGAATAG
AGATAAAGAGGAACTGGCTCAAGAGATTATTACAATCCAAAGAGAAAGAG
ACGATTGTTTATTGGAAGCAGAAATGGGAAAACAGCACGCTATTAATTTG
CTGGAGCAGGAAAAAATGTCAATGTATGAGAAGATTTCCCAATTGACAGA
TCTACTCAGAACTTCTGAATCTGATCTAGAGCGTACTCGAAATGAATGTG
AAATTCGAGCCCAACAAGATCAAAATACAATTCAAACATTTAATGGCGAT
TTAAAGAAATTCCGTCTTCAATTTGAACAAATTCACATCGATCATGATCG
GGAAATAAAAAATTTACAATGTGCCTACAAAGAACTTGAAAATCAAAAAT
ATCAAGATATGAGAGAAAATGAAGAATTGAAGTCACTATTGAAAATTGCA
GAAGAAACAAGGGATAATTTACGACAAGATCTATCAGAGTCAATGGGGAA
AATCAGAGAAACCGAAGACCAAAGGGAAAGATTGCGCCGGGAATTAATGG
ACGAAAAACGAAATTATTTCGAAGTGAAAAAAGAATTGGAAACTATTCAG
TTGTCAAATAAGGAACTTAGAGAAAAATTGAAAACATCTGAAATGCAAAA
AATTGATATCCAAAGACAATTACAAGATTTACAAAATAAATTATCAATTC
TTGAAGAGCAGAAACAAGTGTTACAAAAAGAAGTAAAAGATACCAGATAT
AATTTACAGGATACTGAAAAAGCTCGAGTTGATGTTCGTCGCGAATTGGA
AGAATTACGAAGTCAGGTCAAGAAACTTGATACTGAACGTGGGAAATTGG
TAAATGAAGTGAGCGGATTACAAGTGCGTGTAGCAACTGATGAAAATAAA
GAAGTAGAAGCTAGACGAGAGAACTTTGGATTGAAACAGAAAGTAATAGA
ATCTGAAGCGACCAAAGAAGAATTATCTAAACAGCTTTATCAATCGCTTC
GAAAGAATGAGGAACTTGAAGAAATTCTCAATTCCAAAGAGAAAACCACT
AAACAATATTACGATGAAGTGTTAAAAGATTACAAGTCATTAGAAGAAAG
TAAATTAAATCTCGAGAATCAATTGGAAATCACAAATCACAATTTTGAGG
AATTAAATTCAACTTTATCTACTAAAGAAAATAGAATAAGTCTTCTGGAA
AATCAAATAAATATTTTGGATCAAAAGCGAAAAGGTGCAGAAAATCGGTT
GGCAACTATACATAGTCATTTAAGAAAACTGATTGGATTTCGTCAGCAAA
TTTGTCAGACATTAAGGAACAGATCTCCGAGTCCTGGCAGACGTTCTCGA
TCAGTGTCTCCTGAAAAAGGACGAGTTTCCAGTAGGAATTCTGTTGAATT
TAATTTCTCTGAAGATCGTAAAAGAGTTGGAAGATTTGGTGATGTGAATC
AATATTCAGAATCTGTTATTCCCGGTTCTGATCTGGATCCAGAAGCAGTT
CGGATAGCATTGAGAGACATTACTCAACACATTGTTTCCATAGAAAGAGA
ACGCGACGATATGGAAATCAAAGCTAAAAATTCCGCTTTGAAAAGTGATG
AAACATCGGTTCAGTTAGATCAAGCTTTACAAAGAATCAATCAACTGCAG
AAAAACTTTGGAGAAGTTGAAGAAGATAAAAAAGGAATTGATAGTAGATT
GTCAAGCGCCCAGACTGCTCTGATGATGCAGGAGGAAACCATTCACAGAA
ATGAGCGCGAAAGAAAATCTTTGATTGATAAAGTTGGGAAACTCGAAAGA
CAATTAGCCCACGTAGAAACTGAAAAGAAATATTTACAAGAACGCGTTGA
TAAAATGAGAACAGGTGAATCCTATCACGAAGAAGAAAGAAGAGGTTTAA
TTAAAGCGGTTGATGATGCAGAAAATAGATGTACACAATTAGAACTTCTG
CGTCGAGGTTTGGAAGGTGAGTTGCAGAGACTGAAAATGGGATTTAATGA
TAAAGAAACTGAAAACCAAGTCTTGAGGGATAGAGTAGATGCTCTAACAA
AACAGATTTCCGATTTAGAATCTAAAGCTCAAAGTTTACAATTAACTATA
GATAGATTATCAATGAATCTTGCAAGAACCGAAGAAGAGGAGAACACGCA
AAAAGATAAAGTTCACCAACTTAATCTTTCGTTAAGTGAACATCAAGGAA
ACCTTCAAAGTATGCAAGATAAATTAGTTCAACTTCAGAGTACTTTGGCA
AGTTCGGAACATGATCGAAGAGTGCTTCAGGAAAGATTAGAGTCTGTCAA
ACATAATTTATCAGAAGCTAAATCCCAAAATCATACTCTTGTGGATAGAA
TGAAGGCCACGCAGCAAGAATTGATGGAATCTGAATCCAGGAAACACGAA
ATTGAAGGTGAAATAAAACGACTAAGCCAAATTCTTTCTCAGCGACAAGA
AATTGAACAAGAACTTCAATCTAAAATTCATCGCTCAGCAATGGAGAAGA
ATTTGCTAACAGAAAGATTAAATAGTTTAACAGCTTCTCTTGCTGGCCTA
GAATCCGAAAGAAGAGATATTGAGAAAGTTCATATAAAAACTGAAAAAGA
AAAGAATTCACTTAAAAAGACATTAGACAAACTTGAAAAAGAGAAAAATC
GATCTGAAGAATCTATCAATCAATCACTTTTGAAACGCAGTGAATTCGAT
GAATTTACCCGCCGGCTTGAGGATGAGAATGAAGTGCTACATCGACAAGT
TCAAAAATTACAAAACCAATTGGCAGAAGCTGAACAGTGCCATGCTCAAA
GAATAATGGAATTAACTTCTCGAATAAAAAATGAAATGCTCTCTGAAATT
GATAGACTAAAATCTGCTCTAAATTCCACTGAAAAAACTCTACAGTTTCG
AGAAAGATCGCACAGACAAAAAGTAAAAAGTTTAGAAGAACAGATTAACA
TTCTCAAAGATCAACTCTCACAGGAACTCAAAAAACGTGAATTGAATTTA
AATAAATCCAATCGTGGCCTTAAAAATGATATTTGTGATATTAAAAGTAT
TTTGGAAAAGAATTCTAACAACATCTCAAAAACATCATTTGACAACTTAC
TTTACGAGCCAGAAATACGAAGGATGAAAGATATATTATCGGAATCTGGT
TATTCTAACAACTGCAATGTAATATCCACTATGAAACAATCTCAGCGTCC
TGGAAGTCGCCTACAAAGCAATTCACTGTCGCGTCAAAACATATCGTCCG
CCAGTCCAACTAGAGCCAAAAAGAAATTATAAATATCCAAATGAAACTTC
AAATATTTCTTTACGAAACAGCACTTAACATAAGACGATGATTATTATTA
TTATTATTATT
back to top

protein sequence of SMED30023882-orf-1

>SMED30023882-orf-1 ID=SMED30023882-orf-1|Name=SMED30023882-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2208bp
MSSANRDERLEQVAQKLNKFTDIFYQRVENVLADRDNQGYLKYNSGRIVS
NTSPGIGGFDLSNGDKPQKMPEVVKDIILRDFGDTDEDEDSIKDLRMPKP
NSQNTQSSSRLQTYGNGLDSVTQLKAENATLKDSLFNVEEELLRLKNERD
NLAIKFNAINEKLNKTFTAEKCGDRRVSNASEELSNANSLASQTIQLRKQ
LDDDHREYKRKLAAQHDHQIKQAELIKRLQQKLEQLEGRNGLVEKLNQQN
SKLRSEISRLKNHFQTTTSDLNRRIDIAENHLKSAETDKNMDLESVVNEL
KEEQSKSMSLLQMTALLRDQLDEATNANQGLTEDVQRLSEENSFLKSELE
QKDMDWKDDEATFSRFLIGEQNRIKSLWNAVVNFKRQFNDIKSSNERDLH
QLRVNIEQSTQSLRLACSNLDTNHVNRLSQLQFQLDTEKNNCSQLENSLS
KMKEEFRKTETQYQKQIESLNEQFVHVNRSNESLTKELADKEKVLTTLHK
LRNGMNGDLDNSIYNNDDSATRQLIIDTDAVHQALRDIAQLVMNDVDQVD
DSPWMQDDYLDESKTTGQLKPTLSINSLHSNRSVSPTRPSKRSHFNSGSL
DRNRVYRNKSPVSIADSTCAAVRSALHKRALQVQDLTSKINSAKNNHNSV
KKQLDDSENERRNLEKQFIELRSEYDSNHRELDDIQRECERMRHTISMLE
EDKLKLDKSRMNSYEECKSYKQDMEKLKTLNYELQRDKENLTDNCQDLDR
NLERQTKEVERLTKSIENSESKSSRLKEEISSLKESLNRALLEKEVLEQE
NSVLTDSLNKTEVLKAEYEVKANKFKTEEARLRDKFHQLESMNHFLVKEN
SEFKTIIDQTESEKHRLSGEKKALEQEKYGIREELMRVENEKEELNQMKD
GLHQSMQNVEKSYENLQDELSKLNYEKGQLETANVTLQRERNALSTELLQ
ARRDAERLSAAVQKSMKDKEVLAKEKIDLISQLTTFEHELRENADAIYVL
QEEKEQLDGSLYESQQNISQLEAKIEALESNLQQLERKRSIIFDEKQRLQ
HEFDVELQKLSKAKESLQIKLNESEKEWNKILRSEKEAREEDIERLIAER
EELRNEFMKYKEEIKLQFQEEIDDLRHRLNRDKEELAQEIITIQRERDDC
LLEAEMGKQHAINLLEQEKMSMYEKISQLTDLLRTSESDLERTRNECEIR
AQQDQNTIQTFNGDLKKFRLQFEQIHIDHDREIKNLQCAYKELENQKYQD
MRENEELKSLLKIAEETRDNLRQDLSESMGKIRETEDQRERLRRELMDEK
RNYFEVKKELETIQLSNKELREKLKTSEMQKIDIQRQLQDLQNKLSILEE
QKQVLQKEVKDTRYNLQDTEKARVDVRRELEELRSQVKKLDTERGKLVNE
VSGLQVRVATDENKEVEARRENFGLKQKVIESEATKEELSKQLYQSLRKN
EELEEILNSKEKTTKQYYDEVLKDYKSLEESKLNLENQLEITNHNFEELN
STLSTKENRISLLENQINILDQKRKGAENRLATIHSHLRKLIGFRQQICQ
TLRNRSPSPGRRSRSVSPEKGRVSSRNSVEFNFSEDRKRVGRFGDVNQYS
ESVIPGSDLDPEAVRIALRDITQHIVSIERERDDMEIKAKNSALKSDETS
VQLDQALQRINQLQKNFGEVEEDKKGIDSRLSSAQTALMMQEETIHRNER
ERKSLIDKVGKLERQLAHVETEKKYLQERVDKMRTGESYHEEERRGLIKA
VDDAENRCTQLELLRRGLEGELQRLKMGFNDKETENQVLRDRVDALTKQI
SDLESKAQSLQLTIDRLSMNLARTEEEENTQKDKVHQLNLSLSEHQGNLQ
SMQDKLVQLQSTLASSEHDRRVLQERLESVKHNLSEAKSQNHTLVDRMKA
TQQELMESESRKHEIEGEIKRLSQILSQRQEIEQELQSKIHRSAMEKNLL
TERLNSLTASLAGLESERRDIEKVHIKTEKEKNSLKKTLDKLEKEKNRSE
ESINQSLLKRSEFDEFTRRLEDENEVLHRQVQKLQNQLAEAEQCHAQRIM
ELTSRIKNEMLSEIDRLKSALNSTEKTLQFRERSHRQKVKSLEEQINILK
DQLSQELKKRELNLNKSNRGLKNDICDIKSILEKNSNNISKTSFDNLLYE
PEIRRMKDILSESGYSNNCNVISTMKQSQRPGSRLQSNSLSRQNISSASP
TRAKKKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007098centrosome cycle
GO:0051297centrosome organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026733Rootletin
Vocabulary: cellular component
TermDefinition
GO:0035253ciliary rootlet
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1162..1196
NoneNo IPR availableCOILSCoilCoilcoord: 1436..1530
NoneNo IPR availableCOILSCoilCoilcoord: 219..263
NoneNo IPR availableCOILSCoilCoilcoord: 717..807
NoneNo IPR availableCOILSCoilCoilcoord: 1011..1052
NoneNo IPR availableCOILSCoilCoilcoord: 1057..1077
NoneNo IPR availableCOILSCoilCoilcoord: 857..961
NoneNo IPR availableCOILSCoilCoilcoord: 2082..2109
NoneNo IPR availableCOILSCoilCoilcoord: 314..355
NoneNo IPR availableCOILSCoilCoilcoord: 1079..1146
NoneNo IPR availableCOILSCoilCoilcoord: 1226..1400
NoneNo IPR availableCOILSCoilCoilcoord: 1751..1771
NoneNo IPR availableCOILSCoilCoilcoord: 1618..1638
NoneNo IPR availableCOILSCoilCoilcoord: 2057..2077
NoneNo IPR availableCOILSCoilCoilcoord: 121..162
NoneNo IPR availableCOILSCoilCoilcoord: 1646..1673
NoneNo IPR availableCOILSCoilCoilcoord: 1779..1935
NoneNo IPR availableCOILSCoilCoilcoord: 1695..1729
NoneNo IPR availableCOILSCoilCoilcoord: 815..835
NoneNo IPR availableCOILSCoilCoilcoord: 428..487
NoneNo IPR availableCOILSCoilCoilcoord: 2017..2044
NoneNo IPR availableCOILSCoilCoilcoord: 268..303
NoneNo IPR availableCOILSCoilCoilcoord: 1947..2009
NoneNo IPR availableCOILSCoilCoilcoord: 633..674
NoneNo IPR availableCOILSCoilCoilcoord: 682..702
NoneNo IPR availablePFAMPF15035Rootletincoord: 209..409
e-value: 3.7E-36
score: 124.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2175..2207
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1552..1578
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 579..606
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..112
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 640..659
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2175..2201
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 86..112
NoneNo IPR availablePANTHERPTHR23159CENTROSOMAL PROTEIN 2coord: 282..2110
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 628..848
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 1620..1838
IPR026733RootletinPANTHERPTHR23159:SF34CILIARY ROOTLET COILED-COIL, ROOTLETIN FAMILY MEMBER 2coord: 282..2110