Aminoacylase-1

Overview
NameAminoacylase-1
Smed IDSMED30023874
Length (bp)1260
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aminoacylase-1 (SMED30023874) t-SNE clustered cells

Violin plots show distribution of expression levels for Aminoacylase-1 (SMED30023874) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aminoacylase-1 (SMED30023874) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aminoacylase-1 (SMED30023874) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023874

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gamma neoblastSMED30023874SMESG000028017.1 SMED30023874smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30023874SMESG000028017.1 SmedASXL_008846SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30023874SMESG000028017.1 dd_Smed_v4_1519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023874SMESG000028017.1 dd_Smed_v4_1519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023874SMESG000028017.1 dd_Smed_v4_1519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30023874SMESG000028017.1 dd_Smed_v4_1519_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ACY1 (aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177])

HSP 1 Score: 298.13 bits (762), Expect = 1.207e-97
Identity = 147/333 (44.14%), Postives = 211/333 (63.36%), Query Frame = 2
Query:  215 ILEEYRTQLSYGCRSGIPDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
              EE   QL  GC+  + + W + PF A+ D  G IYARGAQDMKCV  QYLEA+R++K +   +   R I + FVPDEEVGG +GMEL V+   F  +  G  +DEG+ANPT++F+ FY +R  WW++V  +G  GH S+F++++A  K+H+++   +  R  E  R++ N +L  G VT+VNLT   GGV +NV+P+  +  FD R+ P  D   F+  L SW +  G G+  EF Q      +T TD +N WW  F  VC+  N+ + P+I PA TD+R++R+ G+ A+GFSP+N TP+LLHDH+E L+  VFL G++ Y  L+ ALA V
Sbjct:   37 FFEETARQLGLGCQK-VEEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 366          
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ACY1 (aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177])

HSP 1 Score: 289.271 bits (739), Expect = 2.166e-94
Identity = 141/315 (44.76%), Postives = 203/315 (64.44%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF A+ D  G IYARGAQDMKCV  QYLEA+R++K +   +   R I + FVPDEEVGG +GMEL V+   F  +  G  +DEG+ANPT++F+ FY +R  WW++V  +G  GH S+F++++A  K+H+++   +  R  E  R++ N +L  G VT+VNLT   GGV +NV+P+  +  FD R+ P  D   F+  L SW +  G G+  EF Q      +T TD +N WW  F  VC+  N+ + P+I PA TD+R++R+ G+ A+GFSP+N TP+LLHDH+E L+  VFL G++ Y  L+ ALA V
Sbjct:   89 EHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 401          

HSP 2 Score: 77.411 bits (189), Expect = 2.166e-94
Identity = 36/77 (46.75%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P PDY  AV F  E A QL L     E+ P   +  + W G + +L SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ACY1 (aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177])

HSP 1 Score: 289.271 bits (739), Expect = 2.166e-94
Identity = 141/315 (44.76%), Postives = 203/315 (64.44%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF A+ D  G IYARGAQDMKCV  QYLEA+R++K +   +   R I + FVPDEEVGG +GMEL V+   F  +  G  +DEG+ANPT++F+ FY +R  WW++V  +G  GH S+F++++A  K+H+++   +  R  E  R++ N +L  G VT+VNLT   GGV +NV+P+  +  FD R+ P  D   F+  L SW +  G G+  EF Q      +T TD +N WW  F  VC+  N+ + P+I PA TD+R++R+ G+ A+GFSP+N TP+LLHDH+E L+  VFL G++ Y  L+ ALA V
Sbjct:   89 EHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 401          

HSP 2 Score: 77.411 bits (189), Expect = 2.166e-94
Identity = 36/77 (46.75%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P PDY  AV F  E A QL L     E+ P   +  + W G + +L SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ACY1 (aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177])

HSP 1 Score: 289.656 bits (740), Expect = 2.401e-94
Identity = 141/315 (44.76%), Postives = 203/315 (64.44%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF A+ D  G IYARGAQDMKCV  QYLEA+R++K +   +   R I + FVPDEEVGG +GMEL V+   F  +  G  +DEG+ANPT++F+ FY +R  WW++V  +G  GH S+F++++A  K+H+++   +  R  E  R++ N +L  G VT+VNLT   GGV +NV+P+  +  FD R+ P  D   F+  L SW +  G G+  EF Q      +T TD +N WW  F  VC+  N+ + P+I PA TD+R++R+ G+ A+GFSP+N TP+LLHDH+E L+  VFL G++ Y  L+ ALA V
Sbjct:   54 EHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 366          
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ABHD14A-ACY1 (ABHD14A-ACY1 readthrough [Source:HGNC Symbol;Acc:HGNC:38856])

HSP 1 Score: 284.263 bits (726), Expect = 5.567e-93
Identity = 137/309 (44.34%), Postives = 199/309 (64.40%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLI 1192
            + W + PF A+ D  G IYARGAQDMKCV  QYLEA+R++K +   +   R I + FVPDEEVGG +GMEL V+   F  +  G  +DEG+ANPT++F+ FY +R  WW++V  +G  GH S+F++++A  K+H+++   +  R  E  R++ N +L  G VT+VNLT   GGV +NV+P+  +  FD R+ P  D   F+  L SW +  G G+  EF Q      +T TD +N WW  F  VC+  N+ + P+I PA TD+R++R+ G+ A+GFSP+N TP+LLHDH+E L+  VFL G++ Y  L+
Sbjct:  279 EHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLL 585          

HSP 2 Score: 77.7962 bits (190), Expect = 5.567e-93
Identity = 36/77 (46.75%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P PDY  AV F  E A QL L     E+ P   +  + W G + +L SI+LNSH DVVPVF+
Sbjct:  202 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK 278          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C10C5.5 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q17900])

HSP 1 Score: 263.462 bits (672), Expect = 3.362e-84
Identity = 138/315 (43.81%), Postives = 198/315 (62.86%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + P+SA+ DE GNI+ARGAQDMKCVG Q +EA+R +  +      +R I +++ PDEE+ G  GM+   +TD F+ +N+G  +DEG+ +  + +  FY +RVAWW+KV   GN GHGSQF++N+A  K+ R L      R  +++ ++ N NLT+GDVTT+N+    GGVQ NV+P  F    D+R+TP  D +  + ML+ WA+  G G+ YEF QY+    ++A    N +W  FE      N +    I  A TDSRFVR +G+++I FSP+ NTP L HDHNE+LN  VFL G+E Y+ +I  L  V
Sbjct:   84 EHWTHDPYSAFKDEDGNIFARGAQDMKCVGVQQMEALRNLFAQGIRQW-KRTIHLVWGPDEEIFGINGMKGFAKTDEFKKLNLGFSLDEGMPSDDDVYKVFYAERVAWWVKVTFPGNPGHGSQFMENTAMEKLERFLASARKFRNEQKVVLESNPNLTLGDVTTLNVNIVNGGVQFNVIPEKFEAYVDMRLTPHEDFNKIREMLDQWAKNAGEGVTYEFSQYSDQKPISAHTRDNSFWAAFEDSLNQENCKFEKGIMVASTDSRFVRYEGVNSINFSPMINTPFLPHDHNEYLNEKVFLRGLEIYQTIINNLGNV 397          

HSP 2 Score: 62.3882 bits (150), Expect = 2.305e-10
Identity = 33/77 (42.86%), Postives = 44/77 (57.14%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            AV  F EYLR+NT  P+P+Y+   +FL + A++L +     E  P   +V M   G    L SI+L SH DVVP FR
Sbjct:    7 AVTRFREYLRVNTEQPNPNYAACRDFLFKYADELGIARRSIETAPGVFLVIMTIPGSQPELPSIMLYSHTDVVPTFR 83          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C06A6.4 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4])

HSP 1 Score: 256.529 bits (654), Expect = 1.208e-81
Identity = 139/313 (44.41%), Postives = 193/313 (61.66%), Query Frame = 2
Query:  275 WKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            W + P+SA+ DE GNI+ARGAQDMKCVG QY+EA+R    K       R I +++ PDEE+G   GM+    T+ F+ +NI   +DEG+A   + +  FY +R+ WW+KV + G+ GHGS+FI+ +A  K+H+++      R  ++  + E+   T+GDVTT N+T   GGVQ NVVP  F    DIR+TP  DL      ++ WA+E G G+ YEF+Q++    ++     + +W   +   Q    +   +IF   TDSRFVR++GI AIGFSPI NTP LLHDHNEFLN   FL G+E YE LI  LA V
Sbjct:   85 WTHDPYSAFKDEDGNIFARGAQDMKCVGVQYMEALRNWFAKGVKQWT-RTIHIVWGPDEEIGHINGMKGFAVTEEFKKLNIDFALDEGIATEDDVYKIFYAERIPWWVKVTLPGHPGHGSKFIEKTAIEKLHKLIASVDEFRNEQKSLLAEHPEWTVGDVTTSNITIINGGVQVNVVPEKFEAYIDIRVTPLQDLDAVLARVDQWAKEAGEGVTYEFMQFSNFKLISPNTREDPFWAAIDDALQKEGCKYKKEIFIGATDSRFVRAQGIRAIGFSPIINTPSLLHDHNEFLNEKTFLRGVEIYETLINKLANV 396          

HSP 2 Score: 65.0846 bits (157), Expect = 2.941e-11
Identity = 34/77 (44.16%), Postives = 41/77 (53.25%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
             V  F EYLR+NT  P PDY    +FL + A++L +E    E  P    V M   G    L SI+L SH DVVP FR
Sbjct:    6 GVTRFREYLRVNTEQPKPDYEACRDFLFKYADELGIERRSVETAPGTYFVIMTIPGSKPDLPSIMLYSHTDVVPTFR 82          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C06A6.4 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4])

HSP 1 Score: 256.529 bits (654), Expect = 1.208e-81
Identity = 139/313 (44.41%), Postives = 193/313 (61.66%), Query Frame = 2
Query:  275 WKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            W + P+SA+ DE GNI+ARGAQDMKCVG QY+EA+R    K       R I +++ PDEE+G   GM+    T+ F+ +NI   +DEG+A   + +  FY +R+ WW+KV + G+ GHGS+FI+ +A  K+H+++      R  ++  + E+   T+GDVTT N+T   GGVQ NVVP  F    DIR+TP  DL      ++ WA+E G G+ YEF+Q++    ++     + +W   +   Q    +   +IF   TDSRFVR++GI AIGFSPI NTP LLHDHNEFLN   FL G+E YE LI  LA V
Sbjct:   85 WTHDPYSAFKDEDGNIFARGAQDMKCVGVQYMEALRNWFAKGVKQWT-RTIHIVWGPDEEIGHINGMKGFAVTEEFKKLNIDFALDEGIATEDDVYKIFYAERIPWWVKVTLPGHPGHGSKFIEKTAIEKLHKLIASVDEFRNEQKSLLAEHPEWTVGDVTTSNITIINGGVQVNVVPEKFEAYIDIRVTPLQDLDAVLARVDQWAKEAGEGVTYEFMQFSNFKLISPNTREDPFWAAIDDALQKEGCKYKKEIFIGATDSRFVRAQGIRAIGFSPIINTPSLLHDHNEFLNEKTFLRGVEIYETLINKLANV 396          

HSP 2 Score: 65.0846 bits (157), Expect = 2.941e-11
Identity = 34/77 (44.16%), Postives = 41/77 (53.25%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
             V  F EYLR+NT  P PDY    +FL + A++L +E    E  P    V M   G    L SI+L SH DVVP FR
Sbjct:    6 GVTRFREYLRVNTEQPKPDYEACRDFLFKYADELGIERRSVETAPGTYFVIMTIPGSKPDLPSIMLYSHTDVVPTFR 82          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C10C5.3 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q17898])

HSP 1 Score: 254.218 bits (648), Expect = 2.034e-81
Identity = 135/317 (42.59%), Postives = 195/317 (61.51%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARVEE 1216
            + W + P+SA+ DE GNI+ARGAQDMKCVG Q +EA+R +  +      +R I +++ PDEE+ G  GM+   +TD F+ +N+G  +DEG+ +  + +  FY +RVAWW+KV   GN GHGSQF++N+A  K+ R L      R  ++  ++ N +LTIGDVTT+N+    GGVQ NV+P  F    DIR+TP  D +  +N L+ W ++ G G+ YEF +++    +T     + +W  FE   +    +   ++    TDSR VR  G+ AI FSP+ NTP+L H HNEFLN  VFL GIE Y+ LI  +A V E
Sbjct:   84 EHWTHDPYSAFKDEDGNIFARGAQDMKCVGVQQMEALRNLFAQGIRQW-KRTIHLVWGPDEEIFGINGMKGFAKTDEFKKLNLGFSLDEGMPSDDDVYKVFYAERVAWWVKVTFPGNPGHGSQFMENTAMEKLERYLASARKFRDEQKALLESNPDLTIGDVTTLNVNIVNGGVQFNVIPEKFEAFVDIRLTPSIDFNEMRNKLDQWVKDAGEGVTYEFSKHSDLKLVTPHTRDDPFWVAFEDSLKQEKCKFTTEVLIGSTDSRIVREAGVRAINFSPLINTPLLAHAHNEFLNEKVFLRGIEIYQTLINNVANVNE 399          

HSP 2 Score: 68.1662 bits (165), Expect = 2.034e-81
Identity = 35/77 (45.45%), Postives = 45/77 (58.44%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            AV  F EYLR+NT  P+PDY+   +FL + A++L +    +E VP    V M   G    L SI+L SH DVVP FR
Sbjct:    7 AVTRFREYLRVNTEQPNPDYAACRDFLFKYADELGIARRSFETVPGAIFVIMTIPGSQPELPSIMLYSHTDVVPTFR 83          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C06A6.4 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4])

HSP 1 Score: 248.054 bits (632), Expect = 1.165e-78
Identity = 141/327 (43.12%), Postives = 192/327 (58.72%), Query Frame = 2
Query:  275 WKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATD--------------ATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            W + P+SA+ DE GNI+ARGAQDMKCVG QY+EA+R    K       R I +++ PDEE+G   GM+    T+ F+ +NI   +DEG+A   + +  FY +R+ WW+KV + G+ GHGS+FI+ +A  K+H+++      R  ++  + E+   T+GDVTT N+T   GGVQ NVVP  F    DIR+TP  DL      ++ WA+E G G+ YEF+Q    A  +  D                + +W   +   Q    +   +IF   TDSRFVR++GI AIGFSPI NTP LLHDHNEFLN   FL G+E YE LI  LA V
Sbjct:   85 WTHDPYSAFKDEDGNIFARGAQDMKCVGVQYMEALRNWFAKGVKQWT-RTIHIVWGPDEEIGHINGMKGFAVTEEFKKLNIDFALDEGIATEDDVYKIFYAERIPWWVKVTLPGHPGHGSKFIEKTAIEKLHKLIASVDEFRNEQKSLLAEHPEWTVGDVTTSNITIINGGVQVNVVPEKFEAYIDIRVTPLQDLDAVLARVDQWAKEAGEGVTYEFMQSTNPADKSTIDFETFSNFKLISPNTREDPFWAAIDDALQKEGCKYKKEIFIGATDSRFVRAQGIRAIGFSPIINTPSLLHDHNEFLNEKTFLRGVEIYETLINKLANV 410          

HSP 2 Score: 65.0846 bits (157), Expect = 1.165e-78
Identity = 34/77 (44.16%), Postives = 41/77 (53.25%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
             V  F EYLR+NT  P PDY    +FL + A++L +E    E  P    V M   G    L SI+L SH DVVP FR
Sbjct:    6 GVTRFREYLRVNTEQPKPDYEACRDFLFKYADELGIERRSVETAPGTYFVIMTIPGSKPDLPSIMLYSHTDVVPTFR 82          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG6465 (gene:FBgn0037818 transcript:FBtr0082323)

HSP 1 Score: 277.33 bits (708), Expect = 1.771e-92
Identity = 144/316 (45.57%), Postives = 199/316 (62.97%), Query Frame = 2
Query:  266 PDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            P+ W +PPF A IDE G I+ARG QDMK VG Q+L A+R +K     +  +R I + FV DEE+GG+ GM   V T+ FR +N+G  MDEGLA+P      FY +R  W +  +ISG  GHGS  + N+AG K++ I+ K M  R ++  R++ N  L IGDVTT+NLT   GGVQ NVVP    + FD R+    D   F+  L+ W  +VGGGIE  + Q  P    TA D +N +W  F+      ++ I PQIF  GTDSR++R+ GI A+GFSP+NNTP+LLHDH+EF+  D++L G++ ++ +I  +A V
Sbjct:   88 PENWTHPPFGADIDEEGRIFARGTQDMKSVGMQHLAAVRALKRSGAKF--KRTIHISFVADEEMGGRYGMRPFVPTEDFRALNVGFAMDEGLASPDEQLPLFYAERAVWRVYFNISGTAGHGSLLLPNTAGEKLNYIVGKMMEFRRSQVQRLQNNPELVIGDVTTINLTKLGGGVQSNVVPPLLMVCFDCRLALDVDFEEFEANLHKWCADVGGGIEITYEQKQPKVPPTAIDGSNPFWLAFKKATDEMHISIKPQIFTGGTDSRYIRAVGIPALGFSPMNNTPVLLHDHDEFIQADIYLRGVQIFQKIISNIANV 401          

HSP 2 Score: 82.0333 bits (201), Expect = 1.771e-92
Identity = 40/73 (54.79%), Postives = 49/73 (67.12%), Query Frame = 3
Query:   51 FCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIV-PNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            F EYLRI ++HPDPDY+  VEFL  QA  + L   VY      NP+V + W G++  L SI+LNSHMDVVPVF
Sbjct:   15 FREYLRIPSVHPDPDYAPCVEFLRRQANLMDLPMKVYYPANEQNPVVVLTWKGLNPELPSILLNSHMDVVPVF 87          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG6726 (gene:FBgn0039049 transcript:FBtr0084349)

HSP 1 Score: 279.641 bits (714), Expect = 7.644e-92
Identity = 145/313 (46.33%), Postives = 202/313 (64.54%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALA 1204
            +KW + PFSA +D  G I+ARG+QDMKCVG+QYL A+R +K     Y P+R I + +VPDEEVGG  GM  LV++D F+ +N+G   DEG+++   +++ +Y +R  W ++  ISG  GHGS  + N+AG K++ ++ K M  R ++  ++ +++ L IGDVTTVNLT   GGVQ NVVP      FDIRI    D+  F+  +  W EE GGGIE EF    P    T  D++N +W  F+       ++   ++FP  TDSR++R  GI A+GFSPINNTPILLHDH+EFL  D +L GIE Y+ LI A+A
Sbjct:   89 EKWTHGPFSADLDAEGRIFARGSQDMKCVGTQYLGAVRALKASG--YQPKRTIYLTYVPDEEVGGHLGMRELVKSDYFKKLNVGFSFDEGISSADETYALYYAERTLWHLRFKISGTAGHGSLLLPNTAGEKLNYVVGKMMEFRKSQVQKLADDSSLEIGDVTTVNLTQLRGGVQSNVVPPLLEAVFDIRIAVTVDIPAFEKQIRDWCEEAGGGIELEFEMKNPFVEPTKIDSSNAYWLAFKKALDDLGLKTRVRVFPGATDSRYIRYAGIPALGFSPINNTPILLHDHDEFLKADTYLHGIEVYKKLIPAVA 399          

HSP 2 Score: 77.7962 bits (190), Expect = 7.644e-92
Identity = 40/80 (50.00%), Postives = 49/80 (61.25%), Query Frame = 3
Query:   30 NKQAVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYV-YEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            N + +  F EYLRI T+HP+ DY+   EFL  QA  L L   V Y +   NP+V +KW G    L SI+LNSH DVVPVF
Sbjct:    8 NNEEIKIFREYLRIPTVHPNVDYTVCTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWQGSQPELPSIILNSHTDVVPVF 87          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG6726 (gene:FBgn0039049 transcript:FBtr0084348)

HSP 1 Score: 279.641 bits (714), Expect = 7.644e-92
Identity = 145/313 (46.33%), Postives = 202/313 (64.54%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALA 1204
            +KW + PFSA +D  G I+ARG+QDMKCVG+QYL A+R +K     Y P+R I + +VPDEEVGG  GM  LV++D F+ +N+G   DEG+++   +++ +Y +R  W ++  ISG  GHGS  + N+AG K++ ++ K M  R ++  ++ +++ L IGDVTTVNLT   GGVQ NVVP      FDIRI    D+  F+  +  W EE GGGIE EF    P    T  D++N +W  F+       ++   ++FP  TDSR++R  GI A+GFSPINNTPILLHDH+EFL  D +L GIE Y+ LI A+A
Sbjct:   89 EKWTHGPFSADLDAEGRIFARGSQDMKCVGTQYLGAVRALKASG--YQPKRTIYLTYVPDEEVGGHLGMRELVKSDYFKKLNVGFSFDEGISSADETYALYYAERTLWHLRFKISGTAGHGSLLLPNTAGEKLNYVVGKMMEFRKSQVQKLADDSSLEIGDVTTVNLTQLRGGVQSNVVPPLLEAVFDIRIAVTVDIPAFEKQIRDWCEEAGGGIELEFEMKNPFVEPTKIDSSNAYWLAFKKALDDLGLKTRVRVFPGATDSRYIRYAGIPALGFSPINNTPILLHDHDEFLKADTYLHGIEVYKKLIPAVA 399          

HSP 2 Score: 77.7962 bits (190), Expect = 7.644e-92
Identity = 40/80 (50.00%), Postives = 49/80 (61.25%), Query Frame = 3
Query:   30 NKQAVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYV-YEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            N + +  F EYLRI T+HP+ DY+   EFL  QA  L L   V Y +   NP+V +KW G    L SI+LNSH DVVPVF
Sbjct:    8 NNEEIKIFREYLRIPTVHPNVDYTVCTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWQGSQPELPSIILNSHTDVVPVF 87          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG6726 (gene:FBgn0039049 transcript:FBtr0344300)

HSP 1 Score: 279.641 bits (714), Expect = 7.644e-92
Identity = 145/313 (46.33%), Postives = 202/313 (64.54%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALA 1204
            +KW + PFSA +D  G I+ARG+QDMKCVG+QYL A+R +K     Y P+R I + +VPDEEVGG  GM  LV++D F+ +N+G   DEG+++   +++ +Y +R  W ++  ISG  GHGS  + N+AG K++ ++ K M  R ++  ++ +++ L IGDVTTVNLT   GGVQ NVVP      FDIRI    D+  F+  +  W EE GGGIE EF    P    T  D++N +W  F+       ++   ++FP  TDSR++R  GI A+GFSPINNTPILLHDH+EFL  D +L GIE Y+ LI A+A
Sbjct:   89 EKWTHGPFSADLDAEGRIFARGSQDMKCVGTQYLGAVRALKASG--YQPKRTIYLTYVPDEEVGGHLGMRELVKSDYFKKLNVGFSFDEGISSADETYALYYAERTLWHLRFKISGTAGHGSLLLPNTAGEKLNYVVGKMMEFRKSQVQKLADDSSLEIGDVTTVNLTQLRGGVQSNVVPPLLEAVFDIRIAVTVDIPAFEKQIRDWCEEAGGGIELEFEMKNPFVEPTKIDSSNAYWLAFKKALDDLGLKTRVRVFPGATDSRYIRYAGIPALGFSPINNTPILLHDHDEFLKADTYLHGIEVYKKLIPAVA 399          

HSP 2 Score: 77.7962 bits (190), Expect = 7.644e-92
Identity = 40/80 (50.00%), Postives = 49/80 (61.25%), Query Frame = 3
Query:   30 NKQAVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYV-YEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            N + +  F EYLRI T+HP+ DY+   EFL  QA  L L   V Y +   NP+V +KW G    L SI+LNSH DVVPVF
Sbjct:    8 NNEEIKIFREYLRIPTVHPNVDYTVCTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWQGSQPELPSIILNSHTDVVPVF 87          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG17110 (gene:FBgn0039050 transcript:FBtr0084350)

HSP 1 Score: 262.692 bits (670), Expect = 2.247e-90
Identity = 138/314 (43.95%), Postives = 193/314 (61.46%), Query Frame = 2
Query:  266 PDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAE-ELRMKENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALA 1204
            P+KW + PF A+ID  G IYARGAQDMK VG QY+ A+R +K     Y P+R + + FVPDEE GG  GM   V+ D F+ MN+G  +DEG+A+  +++  FY +R  W ++   SG +GHGS    ++AG K H ++ K M  R  + +L  ++++L  GDVTT+NLT   GGVQ NVVP      FDIRI    +    +N +  W  EVGGG+E +F    PS  +T  D +N +W  F+       +    ++FP  TDS +VR  GI A+GFSPINNTP+LLH+H+E+L  D +L GI+ Y  LI ++A
Sbjct:   90 PEKWTHEPFGAHIDAQGRIYARGAQDMKSVGCQYMAAVRALKASG--YQPKRTVYLTFVPDEETGGHMGMAEFVKGDYFKAMNVGFSLDEGIASEDDTYPVFYAERTLWQLRFKFSGTSGHGSLLHKSTAGEKFHFVMDKLMKFRETQVKLLAEDSSLQSGDVTTLNLTQLNGGVQSNVVPPVLEATFDIRIAINQNADAMENQIREWCNEVGGGVELDFTLKCPSV-VTKIDDSNPYWLGFKKGLDELGLITHTRVFPGATDSFYVRQVGIPALGFSPINNTPVLLHNHDEYLRADTYLHGIQVYRKLIPSIA 400          

HSP 2 Score: 90.1225 bits (222), Expect = 2.247e-90
Identity = 45/80 (56.25%), Postives = 55/80 (68.75%), Query Frame = 3
Query:   30 NKQAVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEF-YVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            N + +  F EYLRI ++HPD DY+  VEFL  QA +L L    VY +VP+ P+V MKW G    LKSI+LNSHMDVVPVF
Sbjct:   10 NDEEIIIFQEYLRIPSVHPDVDYTACVEFLKRQANKLNLRVDVVYPVVPSKPVVIMKWLGKHPELKSIILNSHMDVVPVF 89          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 312.768 bits (800), Expect = 5.204e-103
Identity = 158/315 (50.16%), Postives = 211/315 (66.98%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + WK+ PF+A  D  GNIYARGAQDMK V  QY+EAIR++K     +   R I + FVPDEEVGG KGME  V+   F+ +N+G  +DEGLANPTN+++ FYG+R  WWI V   G+ GHGS+F++N+A  K+ R++  F+  R  E+ R+  +   T+GDVTT+N+T   GGV +NVVP+   + FD+RI P  +L  F+  +  W  E G  + Y+F Q      LT+TD  + WW+ F S C++ NM +  +IFPA TDSRF+R  G+ AIGFSP+N TPILLHDHNE+LN  VFL GI+ YE LI ALA V
Sbjct:  101 EHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRF--SRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGERNPWWITVRCPGSPGHGSRFVENTAAEKLRRVINSFLEFREKEKQRLNTSECFTLGDVTTINMTMVKGGVAYNVVPAEMDVSFDLRIPPTVNLQEFEEKIKVWCREAGEDVTYDFAQKHMDQNLTSTDENDPWWQAFSSTCKAMNMTLKKEIFPAATDSRFIREVGLPAIGFSPMNLTPILLHDHNEYLNEQVFLQGIQVYERLIPALAGV 413          

HSP 2 Score: 79.7221 bits (195), Expect = 8.242e-16
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFRINGNIHHFQLI 302
            +V  F EYLR+ T+HP+PDY  A++FL   AE+L L     E+ P   +  + W G    LKS+VLNSH DVVPV+  +   H F  +
Sbjct:   24 SVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAV 111          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 312.768 bits (800), Expect = 5.204e-103
Identity = 158/315 (50.16%), Postives = 211/315 (66.98%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + WK+ PF+A  D  GNIYARGAQDMK V  QY+EAIR++K     +   R I + FVPDEEVGG KGME  V+   F+ +N+G  +DEGLANPTN+++ FYG+R  WWI V   G+ GHGS+F++N+A  K+ R++  F+  R  E+ R+  +   T+GDVTT+N+T   GGV +NVVP+   + FD+RI P  +L  F+  +  W  E G  + Y+F Q      LT+TD  + WW+ F S C++ NM +  +IFPA TDSRF+R  G+ AIGFSP+N TPILLHDHNE+LN  VFL GI+ YE LI ALA V
Sbjct:  101 EHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRF--SRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGERNPWWITVRCPGSPGHGSRFVENTAAEKLRRVINSFLEFREKEKQRLNTSECFTLGDVTTINMTMVKGGVAYNVVPAEMDVSFDLRIPPTVNLQEFEEKIKVWCREAGEDVTYDFAQKHMDQNLTSTDENDPWWQAFSSTCKAMNMTLKKEIFPAATDSRFIREVGLPAIGFSPMNLTPILLHDHNEYLNEQVFLQGIQVYERLIPALAGV 413          

HSP 2 Score: 79.7221 bits (195), Expect = 8.242e-16
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFRINGNIHHFQLI 302
            +V  F EYLR+ T+HP+PDY  A++FL   AE+L L     E+ P   +  + W G    LKS+VLNSH DVVPV+  +   H F  +
Sbjct:   24 SVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAV 111          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 312.768 bits (800), Expect = 5.204e-103
Identity = 158/315 (50.16%), Postives = 211/315 (66.98%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + WK+ PF+A  D  GNIYARGAQDMK V  QY+EAIR++K     +   R I + FVPDEEVGG KGME  V+   F+ +N+G  +DEGLANPTN+++ FYG+R  WWI V   G+ GHGS+F++N+A  K+ R++  F+  R  E+ R+  +   T+GDVTT+N+T   GGV +NVVP+   + FD+RI P  +L  F+  +  W  E G  + Y+F Q      LT+TD  + WW+ F S C++ NM +  +IFPA TDSRF+R  G+ AIGFSP+N TPILLHDHNE+LN  VFL GI+ YE LI ALA V
Sbjct:  101 EHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRF--SRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGERNPWWITVRCPGSPGHGSRFVENTAAEKLRRVINSFLEFREKEKQRLNTSECFTLGDVTTINMTMVKGGVAYNVVPAEMDVSFDLRIPPTVNLQEFEEKIKVWCREAGEDVTYDFAQKHMDQNLTSTDENDPWWQAFSSTCKAMNMTLKKEIFPAATDSRFIREVGLPAIGFSPMNLTPILLHDHNEYLNEQVFLQGIQVYERLIPALAGV 413          

HSP 2 Score: 79.7221 bits (195), Expect = 8.242e-16
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFRINGNIHHFQLI 302
            +V  F EYLR+ T+HP+PDY  A++FL   AE+L L     E+ P   +  + W G    LKS+VLNSH DVVPV+  +   H F  +
Sbjct:   24 SVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAV 111          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 308.916 bits (790), Expect = 1.951e-101
Identity = 156/315 (49.52%), Postives = 210/315 (66.67%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + WK+ PF+A  D  GNIYARGAQDMK V  QY+EAIR++K     +   R I + FVPDEEVGG+KGM+  V+   F+ +NIG  +DEGLANPTN+++ FYG+R  WWI V   G+ GHGS+F++N+A  K+ R++  F+  R  E  R+  +   T+GDVTT+N+T   GGV +NVVP+   + FD+RI P  +L  F+  +  W  E G  + Y+F Q      LT+TD ++ WW+ F S C++ NM +  +IFPA TDS F+R  G+ A GFSP+N TPILLHDHNE+LN  VFL GI+ YE LI ALA V
Sbjct:  101 EHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGNRF--SRTIHLTFVPDEEVGGEKGMKAFVKHPEFQKLNIGFALDEGLANPTNAYTVFYGERNLWWITVRCPGSPGHGSRFVENTAAEKLRRVINSFLEFREKENQRLNTSECFTLGDVTTINMTMVKGGVAYNVVPAEMDVSFDLRIPPTVNLQEFEEQIKVWCREAGEDVTYDFAQKNTDQNLTSTDESDPWWQAFSSTCKAMNMTLKKEIFPAATDSSFIREVGLPAFGFSPMNLTPILLHDHNEYLNEQVFLQGIQVYERLIPALADV 413          

HSP 2 Score: 79.337 bits (194), Expect = 1.094e-15
Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 3
Query:   24 SINKQAVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFRINGNIHHFQLI 302
            S    +V  F EYLR+ T+HP+PDY  A++FL   A++L L     E+ P   +  + W G    LKS+VLNSH DVVPV+  +   H F  +
Sbjct:   19 SAEDPSVTLFREYLRLKTVHPEPDYDAALKFLERMADELALPMQKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAV 111          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 120.168 bits (300), Expect = 1.295e-31
Identity = 57/104 (54.81%), Postives = 74/104 (71.15%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGD 580
            + WK+ PF+A  D  GNIYARGAQDMK V  QY+EAIR++K     +   R I + FVPDEEVGG KGME  V+   F+ +N+G  +DEGLANPTN+++ FYG+
Sbjct:  101 EHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRF--SRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGE 202          

HSP 2 Score: 79.7221 bits (195), Expect = 6.028e-17
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFRINGNIHHFQLI 302
            +V  F EYLR+ T+HP+PDY  A++FL   AE+L L     E+ P   +  + W G    LKS+VLNSH DVVPV+  +   H F  +
Sbjct:   24 SVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAV 111          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: ENSXETT00000004778.1 (aminoacylase-1-like [Source:NCBI gene;Acc:101735201])

HSP 1 Score: 293.508 bits (750), Expect = 2.001e-95
Identity = 151/315 (47.94%), Postives = 207/315 (65.71%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRM-KENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W YPPFSA+ D+ GNIY RGAQDMKCV  QYLEA+R++K+    +   R I +  VPDEE+GGK GMEL V+   F+ +N G+ +DEGLANP+   S FYG+R    + VH  G+TGHGS+ I+++A  K + +++  ++ R  E  R+  + NLT+GDVT+VNLT  +GGV HN+VPS    +FD RI    D   F++ L SW    G  +  EF        +T+T+ +N WW+ F +  +   +++ P+IFPAGTDSRFVR  G  A+GFSP+NNTPILLHDHNE+LN  +FL GI  Y  +I +LA V
Sbjct:   88 ESWMYPPFSAHKDKAGNIYGRGAQDMKCVSIQYLEAVRRLKSMGRCF--PRTIHLTLVPDEEMGGKTGMELFVKHPEFQALNPGIALDEGLANPSEESSVFYGERCC--VTVHCRGDTGHGSRLIEDTAAAKFYSVISSVLDFREKERNRLLSDPNLTLGDVTSVNLTRVSGGVAHNIVPSEMKANFDFRIPYTVDFKEFEHQLESWCRAAGENVTLEFYTKTMIQKVTSTNDSNPWWKAFSTPLKEMGLKLKPEIFPAGTDSRFVREAGFPALGFSPMNNTPILLHDHNEYLNEYIFLRGIHIYTHIISSLASV 398          

HSP 2 Score: 76.6406 bits (187), Expect = 1.313e-14
Identity = 35/76 (46.05%), Postives = 47/76 (61.84%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            A + F EYL+I T+ PDPDY  A+ FL   AE + LE    E+     I+ + W G +   +S++LNSHMDVVPVF
Sbjct:   11 ATSLFREYLKIQTVQPDPDYDGAMNFLTRVAEDIGLESKKIELSSGRVILVLTWRGTEPQFRSVILNSHMDVVPVF 86          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: acy1.1 (aminoacylase 1, gene 1 [Source:NCBI gene;Acc:496883])

HSP 1 Score: 224.942 bits (572), Expect = 3.806e-69
Identity = 109/226 (48.23%), Postives = 153/226 (67.70%), Query Frame = 2
Query:  536 GLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRM-KENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            GLANP+  FS FYG++  WWI VH  G+ GHGS+FI+N+A  K+H ++++F+  R  E+ R+  +  LT+GDVTTVN+T  +GGV  NVVPS  T  FD+RI P  +L  F+  L  W    G  + +E+ Q   +  +T  D +N WW+ F + C+   +++ P+IFPA TDSRF+R+ G SA+GFSP+NNTPILLHDHNE+LN  +FL GI+ Y  +I +LA V
Sbjct:  150 GLANPSEEFSVFYGEKCPWWITVHCGGDPGHGSRFIENTAAAKLHSVISRFLEFREKEKKRLLTDPKLTLGDVTTVNMTQVSGGVSFNVVPSEMTATFDLRIPPTVNLKEFERQLEGWCRAAGDNVTWEYHQKCMNERVTTPDDSNPWWKAFSAPCKEMRLKLKPEIFPAATDSRFIRAAGYSALGFSPMNNTPILLHDHNEYLNESIFLRGIQIYTKIIASLASV 375          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: dock3 (dedicator of cytokinesis 3 [Source:Xenbase;Acc:XB-GENE-855883])

HSP 1 Score: 132.88 bits (333), Expect = 6.823e-45
Identity = 60/108 (55.56%), Postives = 77/108 (71.30%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAW 592
            + W YPPFSA+ D+ GNIY RGAQDMKCV  QYLEA+R++K+    +   R I +  VPDEE+GGK GMEL V+   F+ +N G+ +DEGLANP+  FS FYG+R  W
Sbjct:   84 ESWMYPPFSAHKDKAGNIYGRGAQDMKCVSIQYLEAVRRLKSMGRCF--PRTIHLTLVPDEEMGGKTGMELFVKHPAFQALNPGIALDEGLANPSEEFSVFYGERCCW 189          

HSP 2 Score: 68.5514 bits (166), Expect = 6.823e-45
Identity = 35/74 (47.30%), Postives = 47/74 (63.51%), Query Frame = 3
Query:   51 FCEYLRINTIHPDPDYS--KAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            F EYL+I T+ PDPDY    A+ FL   AE + LE    E++    I+ + W G +  L+S++LNSHMDVVPVF
Sbjct:   10 FREYLKIQTVQPDPDYGNNGAMNFLTRVAEDIGLESKKIEVL-GRVILVLTWRGTEPQLRSVILNSHMDVVPVF 82          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: ENSXETT00000004860.1 (aminoacylase 1 [Source:NCBI gene;Acc:108647469])

HSP 1 Score: 104.375 bits (259), Expect = 1.168e-39
Identity = 50/88 (56.82%), Postives = 63/88 (71.59%), Query Frame = 2
Query:  275 WKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEG 538
            W Y PFSAY D+ GNIYARGAQDMKCV  QYLEA+R++K++   +   R I +  VPDEE+GG KGMEL V+   F  +N G+ +DEG
Sbjct:   92 WTYSPFSAYKDKDGNIYARGAQDMKCVTIQYLEAVRRLKSEGRRF--PRTIHLTLVPDEEIGGHKGMELFVQHPEFHALNPGITLDEG 177          

HSP 2 Score: 79.7221 bits (195), Expect = 1.168e-39
Identity = 36/80 (45.00%), Postives = 50/80 (62.50%), Query Frame = 3
Query:   27 INKQAVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            ++  A + F EYL I T+ PDPDY K ++FL   AE++ LE    E+ P   I+ + W G +  L S++LNSH DVVPVF
Sbjct:    9 LSDPATSLFREYLMIRTVQPDPDYDKGIQFLVRMAEEIGLESKKLELYPGRVILILTWKGTEPQLGSVILNSHTDVVPVF 88          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: b3gat1 (beta-1,3-glucuronyltransferase 1 [Source:Xenbase;Acc:XB-GENE-961613])

HSP 1 Score: 49.2914 bits (116), Expect = 4.040e-6
Identity = 36/96 (37.50%), Postives = 49/96 (51.04%), Query Frame = 2
Query:  266 PDKWKYPPFSAYIDELGNIYARGAQDMK-CVGS--QYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLA 544
            P+ W+ PPFS   +  G IY RG  D K CV    Q LE + K   K     P R+  +    DEE+ G KG + +VE    + + +  V+DEGLA
Sbjct:   75 PESWEVPPFSGE-ERDGYIYGRGTLDDKNCVIGILQSLEFLLKRGHK-----PRRSFYIGLGHDEEISGHKGAQKIVEKLQSQGVKLAFVLDEGLA 164          

HSP 2 Score: 21.1718 bits (43), Expect = 4.040e-6
Identity = 10/23 (43.48%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  195 KWNGMDKSLKSIVLNSHMDVVPV 263
            K  G D +L   +L +H+DVVP 
Sbjct:   51 KVQGSDHNLLPYMLLAHIDVVPA 73          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 313.923 bits (803), Expect = 4.938e-104
Identity = 161/351 (45.87%), Postives = 225/351 (64.10%), Query Frame = 2
Query:  167 CPKQPNCLYEMEWNGQI--LEEYRTQLSYGCRSGIPDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            C  QPN  Y     G I  LEE   QL   C+  I + W + PF A+ D  G IYARG+QDMK V  QYLEA+R++K++   +   R I + FVPDEEVGG KGMEL V+   F+ +  G V+DEGLANPT++F+ FY +R  WW++V  +G  GH S+FI+++A  K+H++++  +  R  E  R++ N +L  G VT+VNLT   GGV +NVVP+  +  FD R+ P  D+  F+  L  W +E G G+ +EF Q      +T TD ++ WW  F   C++ N+ + P+IFPA TDSRF+R+ GI A+GFSP+N TP+LLHDHNE L+ D+FL G++ Y  L+ ALA V
Sbjct:   23 CTVQPNPDY----GGAITFLEERARQLGLSCQK-IEEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 366          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 303.138 bits (775), Expect = 7.165e-100
Identity = 147/315 (46.67%), Postives = 210/315 (66.67%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF A+ D  G IYARG+QDMK V  QYLEA+R++K++   +   R I + FVPDEEVGG KGMEL V+   F+ +  G V+DEGLANPT++F+ FY +R  WW++V  +G  GH S+FI+++A  K+H++++  +  R  E  R++ N +L  G VT+VNLT   GGV +NVVP+  +  FD R+ P  D+  F+  L  W +E G G+ +EF Q      +T TD ++ WW  F   C++ N+ + P+IFPA TDSRF+R+ GI A+GFSP+N TP+LLHDHNE L+ D+FL G++ Y  L+ ALA V
Sbjct:   89 EHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 401          

HSP 2 Score: 81.6481 bits (200), Expect = 7.165e-100
Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P+PDY  A+ FL E+A QL L     E+VP   I  + W G + SL SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 191.045 bits (484), Expect = 3.295e-66
Identity = 115/315 (36.51%), Postives = 161/315 (51.11%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDF-DIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF A+ D  G IYARG+QDMK V  QYLEA+R++K++   +   R I + FVPDEEVGG KGMEL V+   F+ +  G V+DEGLANPT++F+ FY +R  WW++V  +G  GH S+FI+++A  K            LA E +++      G+                 V   F   F + R+TP  D        + W     G  +   +   P  +  ATD                              SRF+R+ GI A+GFSP+N TP+LLHDHNE L+ D+FL G++ Y  L+ ALA V
Sbjct:   89 EHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEK------------LAFEKQLQRWCQEAGEG----------------VTFEFAQKFTEPRMTPTDD-------SDPWWAAFSGACKAMNLTLEPEIFPAATD------------------------------SRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 336          

HSP 2 Score: 81.6481 bits (200), Expect = 3.295e-66
Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P+PDY  A+ FL E+A QL L     E+VP   I  + W G + SL SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 214.542 bits (545), Expect = 7.459e-66
Identity = 103/227 (45.37%), Postives = 151/227 (66.52%), Query Frame = 2
Query:  533 EGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            EGLANPT++F+ FY +R  WW++V  +G  GH S+FI+++A  K+H++++  +  R  E  R++ N +L  G VT+VNLT   GGV +NVVP+  +  FD R+ P  D+  F+  L  W +E G G+ +EF Q      +T TD ++ WW  F   C++ N+ + P+IFPA TDSRF+R+ GI A+GFSP+N TP+LLHDHNE L+ D+FL G++ Y  L+ ALA V
Sbjct:  103 EGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 329          

HSP 2 Score: 81.6481 bits (200), Expect = 1.131e-16
Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P+PDY  A+ FL E+A QL L     E+VP   I  + W G + SL SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 146.747 bits (369), Expect = 5.264e-53
Identity = 66/133 (49.62%), Postives = 93/133 (69.92%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKM 667
            + W + PF A+ D  G IYARG+QDMK V  QYLEA+R++K++   +   R I + FVPDEEVGG KGMEL V+   F+ +  G V+DEGLANPT++F+ FY +R  WW++V  +G  GH S+FI+++A  K+
Sbjct:   89 EHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKL 219          

HSP 2 Score: 81.2629 bits (199), Expect = 5.264e-53
Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P+PDY  A+ FL E+A QL L     E+VP   I  + W G + SL SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|Q99JW2|ACY1_MOUSE (Aminoacylase-1 OS=Mus musculus OX=10090 GN=Acy1 PE=1 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 3.117e-98
Identity = 145/315 (46.03%), Postives = 209/315 (66.35%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF A+ D  G IYARG+QDMK V  QYLEA+R++K++   +   R I + FVPDEEVGG KGMEL V+   F+ +  G  +DEGLANPT++F+ FY +R  WW++V  +G  GH S+FI+++A  K+H++++  +  R  E  R++ N +L  G VT+VNLT   GGV +NVVP+  +  FD R+ P  D+  F+  L  W +E G G+ +EF Q      +T TD ++ WW  F   C++ N+ + P+IFPA TDSR++R+ GI A+GFSP+N TP+LLHDHNE L+ D+FL G++ Y  L+ ALA V
Sbjct:   89 EHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 401          

HSP 2 Score: 81.6481 bits (200), Expect = 3.117e-98
Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P+PDY  A+ FL E+A QL L     E+VP   I  + W G + SL SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|Q6AYS7|ACY1A_RAT (Aminoacylase-1A OS=Rattus norvegicus OX=10116 GN=Acy1a PE=1 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.033e-97
Identity = 149/315 (47.30%), Postives = 207/315 (65.71%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF A+ D  G IYARGAQDMK V  QYLEA+R++K++   +   R I + FVPDEEVGG KGMEL V+   F+ +  G  +DEGLANPT++F+ FY +R  WWI+V  +G  GH S+FI+++A  K+H+++   +  R  E  R++ N +L  G VT+VNLT   GGV +NVVP+  +  FD R+ P  D+  F+  L SW +E G G+ +EF Q      +T TD T+ WW  F   C+  N+ + P+IFPA TDSR++R+ GI A+GFSP+N TP+LLHDHNE L+  VFL G++ Y  L+ ALA V
Sbjct:   89 EHWHHDPFEAFKDSEGYIYARGAQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWIRVTSTGKPGHASRFIEDTAAEKLHKVVNSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSACFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQKFTEPRMTPTDDTDPWWAAFSGACKEMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEAVFLRGVDIYTRLVAALASV 401          

HSP 2 Score: 78.5666 bits (192), Expect = 1.599e-14
Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P+PDY  AV FL E+A QL L     E+ P   I  + W G +  L SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGSAVTFLEERARQLGLSCQKIEVAPGYVITVLTWPGTNPLLHSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|Q6PTT0|ACY1B_RAT (Aminoacylase-1B OS=Rattus norvegicus OX=10116 GN=Acy1b PE=1 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 7.891e-96
Identity = 144/315 (45.71%), Postives = 204/315 (64.76%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF A+ D  G IY RGAQDMKCV  QYLEA++++K +   +   R I + FVPDEEVGG +GMEL V+   F  +  G  +DEGLANPT++F+ FY +R  WW++V  +G  GH S+F++++A  K+H+++   +  R  E  R++ N +L  G VT+VNLT   GGV +NVVP+  +  FD R+ P  D+  F+  L SW +E G G+ +EF Q      +T TD T+ WW  F   C+   + + P+IFPA TDSR++R+ GI A+GFSP+N TP+LLHDHNE L+  VFL G++ Y  L+ ALA V
Sbjct:   89 EHWSHDPFEAFKDSEGYIYTRGAQDMKCVSIQYLEAVKRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRHEFHALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVVPATMSACFDFRVAPDVDMKAFEEQLQSWCQEAGEGVTFEFAQKFTEPRMTPTDDTDPWWAAFSGACKEMTLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEAVFLRGVDIYTRLVAALASV 401          

HSP 2 Score: 77.7962 bits (190), Expect = 7.891e-96
Identity = 36/77 (46.75%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P PDY  AV F  E A QL L     E+ P   +  + W G + +L SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|P37111|ACY1_PIG (Aminoacylase-1 OS=Sus scrofa OX=9823 GN=ACY1 PE=1 SV=2)

HSP 1 Score: 287.73 bits (735), Expect = 3.922e-95
Identity = 139/314 (44.27%), Postives = 205/314 (65.29%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF  + D  G IY RGAQDMKCV  QYLEA+R++K +   +   R I + FVPDEEVGG +GMEL V+   F+ +  G  +DEGLA+PT++F+ FY +R  WW++V  +G  GHGS+FI+++A  K+H+++   +  R  E+ R++ N L  G VT+VNLT   GGV +NVVP+  +  FD R+ P  DL  F+  L SW +  G G+ +EF+Q      +T+TD ++ WW  F  V +   + +  +I PA TD+R++R+ G+ A+GFSP+N+TP+LLHDH+E L+  VFL G++ Y  L+ ALA V
Sbjct:   89 EHWSHDPFEGFKDADGYIYGRGAQDMKCVSIQYLEAVRRLKVEGHHF--PRTIHMTFVPDEEVGGHQGMELFVKRPEFQALRAGFALDEGLASPTDAFTVFYSERSPWWLRVTSTGKPGHGSRFIEDTAAEKLHKVINSILAFREKEKQRLQSNQLKPGAVTSVNLTMLEGGVAYNVVPATMSACFDFRVAPDVDLKAFEEQLQSWCQAAGEGVTFEFVQKWMETQVTSTDDSDPWWAAFSGVFKDMKLALELEICPASTDARYIRAAGVPALGFSPMNHTPVLLHDHDERLHEAVFLRGVDIYTQLLSALASV 400          

HSP 2 Score: 83.5741 bits (205), Expect = 3.922e-95
Identity = 38/77 (49.35%), Postives = 51/77 (66.23%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P+PDY  AV FL E+A QL L     E+VP + +  + W G + +L SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRIRTVQPEPDYGAAVAFLEERARQLGLGCQKVEVVPGHVVTVLTWPGTNPTLSSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|Q03154|ACY1_HUMAN (Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1 PE=1 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 9.452e-94
Identity = 141/315 (44.76%), Postives = 203/315 (64.44%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKEN-NLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + W + PF A+ D  G IYARGAQDMKCV  QYLEA+R++K +   +   R I + FVPDEEVGG +GMEL V+   F  +  G  +DEG+ANPT++F+ FY +R  WW++V  +G  GH S+F++++A  K+H+++   +  R  E  R++ N +L  G VT+VNLT   GGV +NV+P+  +  FD R+ P  D   F+  L SW +  G G+  EF Q      +T TD +N WW  F  VC+  N+ + P+I PA TD+R++R+ G+ A+GFSP+N TP+LLHDH+E L+  VFL G++ Y  L+ ALA V
Sbjct:   89 EHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 401          

HSP 2 Score: 77.411 bits (189), Expect = 9.452e-94
Identity = 36/77 (46.75%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F +YLRI T+ P PDY  AV F  E A QL L     E+ P   +  + W G + +L SI+LNSH DVVPVF+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK 88          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: A0A2D4M8G4 (M20_dimer domain-containing protein OS=Micrurus spixii OX=129469 PE=4 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 6.475e-111
Identity = 170/313 (54.31%), Postives = 221/313 (70.61%), Query Frame = 2
Query:  275 WKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMK-ENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            W++ PF A+ D  GNIY RGAQDMKCV  QYLEAIR++K +   +   R I + FVPDEE+GG KGMEL V+T  F  +N+G  +DEGLANPT++F+ FYG++  WWIKV + GN GHGS+FI+N+A  KMHR++T F+  R  E+ R+K E +LT+GDVT+VNLT   GGV  NVVPS  ++ FDIR+ P  DL  F+  L SW +  G G+ YEF Q      +T+T+ ++ WW+TF   C+  NM++  +IFPA TDSR++R+ G  AIGFSP+N TP+LLHDHNEFLN  VFL GIE Y  LI ALA V
Sbjct:   97 WQHDPFLAFKDSEGNIYGRGAQDMKCVSIQYLEAIRRLKAEGKHF--PRTIHMSFVPDEEIGGHKGMELFVKTPEFAALNVGFALDEGLANPTDTFTVFYGEKCPWWIKVKVEGNPGHGSRFIENTAAEKMHRVITSFLEFREHEKQRLKSEGHLTLGDVTSVNLTMLNGGVSFNVVPSELSVAFDIRLPPTEDLKAFEEQLKSWCKAAGEGVTYEFQQKCMDQTVTSTEESDPWWKTFSDTCKDMNMKLKCEIFPAATDSRYIRAAGHPAIGFSPMNYTPVLLHDHNEFLNEQVFLHGIEIYAHLIPALASV 407          

HSP 2 Score: 78.9518 bits (193), Expect = 2.985e-12
Identity = 37/76 (48.68%), Postives = 48/76 (63.16%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            +V  F EYLRI T+ P PDY  AV+FL   A +L L+    E+ P+  I  + W G +  L+SI+LNSH DVVPVF
Sbjct:   18 SVTLFREYLRIKTVQPQPDYETAVKFLERIASELDLQCLKVEVCPDRVITILTWKGTNPQLRSILLNSHTDVVPVF 93          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: A0A0K8S300 (Aminoacylase-1A-like protein OS=Crotalus horridus OX=35024 PE=4 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 2.510e-110
Identity = 169/313 (53.99%), Postives = 219/313 (69.97%), Query Frame = 2
Query:  275 WKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKE-NNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            W+Y PFSA+ D  GNIY RG QDMKCV  QYLEAIR++K +   +   R I + FVPDEE+GG KGMEL V+T  F  +N+G  +DEGLANPT++F+ FYG++  WWIKV + GN GHGS+FI+N+A  KMHR++T F+  R  E+ R+K   +LT+GDVT+VNLT   GGV  NVVPS  ++ FDIRI P  DL  F+  L SW +  G G+ YEF Q      +T+T+ ++ WW+ F   C+  NM++  +IFPA TDSR++R+ G  AIGFSP+N TP+LLHDHNEFLN  +FL GIE Y  LI ALA V
Sbjct:   99 WQYDPFSAFKDSEGNIYGRGTQDMKCVSIQYLEAIRRLKAEGRHF--SRTIHMSFVPDEEIGGHKGMELFVKTPEFAALNVGFALDEGLANPTDTFTVFYGEKCPWWIKVKVQGNPGHGSRFIENTAAEKMHRVITSFLEFREHEKQRLKTGEHLTLGDVTSVNLTMLNGGVSFNVVPSELSVAFDIRIPPTADLKEFEEQLTSWCKTAGEGVTYEFQQKYMDQTVTSTEESDPWWKAFSDTCKDMNMKLKCEIFPAATDSRYIRATGRPAIGFSPMNYTPVLLHDHNEFLNEQIFLHGIEIYTHLIPALASV 409          

HSP 2 Score: 78.9518 bits (193), Expect = 3.425e-12
Identity = 36/76 (47.37%), Postives = 48/76 (63.16%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            +V  F EYLRI T+ P PDY  A++FL   A +L L+    E+ P+  I  + W G +  L+SI+LNSH DVVPVF
Sbjct:   20 SVTLFREYLRIKTVQPQPDYDTAIKFLERIASELGLQCLKVEVCPDRVITILTWQGTNPQLRSILLNSHTDVVPVF 95          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: A0A0F7ZDY8 (Aminoacylase-1A-like protein OS=Crotalus adamanteus OX=8729 PE=2 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 2.565e-110
Identity = 169/313 (53.99%), Postives = 219/313 (69.97%), Query Frame = 2
Query:  275 WKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKE-NNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            W+Y PFSA+ D  GNIY RG QDMKCV  QYLEAIR++K +   +   R I + FVPDEE+GG KGMEL V+T  F  +N+G  +DEGLANPT++F+ FYG++  WWIKV + GN GHGS+FI+N+A  KMHR++T F+  R  E+ R+K   +LT+GDVT+VNLT   GGV  NVVPS  ++ FDIRI P  DL  F+  L SW +  G G+ YEF Q      +T+T+ ++ WW+ F   C+  NM++  +IFPA TDSR++R+ G  AIGFSP+N TP+LLHDHNEFLN  +FL GIE Y  LI ALA V
Sbjct:   99 WQYDPFSAFKDSEGNIYGRGTQDMKCVSIQYLEAIRRLKAEGRHF--SRTIHMSFVPDEEIGGHKGMELFVKTPEFTALNVGFALDEGLANPTDTFTVFYGEKCPWWIKVKVQGNPGHGSRFIENTAAEKMHRVITSFLEFREHEKQRLKTGEHLTLGDVTSVNLTMLNGGVSFNVVPSELSVAFDIRIPPTVDLKEFEEQLTSWCKTAGEGVTYEFQQKYMDQTVTSTEESDPWWKAFSDTCKDMNMKLKCEIFPAATDSRYIRATGRPAIGFSPMNYTPVLLHDHNEFLNEQIFLHGIEIYARLIPALASV 409          

HSP 2 Score: 78.9518 bits (193), Expect = 3.184e-12
Identity = 36/76 (47.37%), Postives = 48/76 (63.16%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            +V  F EYLRI T+ P PDY  A++FL   A +L L+    E+ P+  I  + W G +  L+SI+LNSH DVVPVF
Sbjct:   20 SVTLFREYLRIKTVQPQPDYDTAIKFLERIASELGLQCLKVEVCPDRVITILTWQGTNPQLRSILLNSHTDVVPVF 95          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: A0A0K8RY46 (Aminoacylase-1A-like protein OS=Crotalus horridus OX=35024 PE=4 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 2.622e-110
Identity = 169/313 (53.99%), Postives = 219/313 (69.97%), Query Frame = 2
Query:  275 WKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKE-NNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            W+Y PFSA+ D  GNIY RG QDMKCV  QYLEAIR++K +   +   R I + FVPDEE+GG KGMEL V+T  F  +N+G  +DEGLANPT++F+ FYG++  WWIKV + GN GHGS+FI+N+A  KMHR++T F+  R  E+ R+K   +LT+GDVT+VNLT   GGV  NVVPS  ++ FDIRI P  DL  F+  L SW +  G G+ YEF Q      +T+T+ ++ WW+ F   C+  NM++  +IFPA TDSR++R+ G  AIGFSP+N TP+LLHDHNEFLN  +FL GIE Y  LI ALA V
Sbjct:   99 WQYDPFSAFKDSEGNIYGRGTQDMKCVSIQYLEAIRRLKAEGRHF--SRTIHMSFVPDEEIGGHKGMELFVKTPEFAALNVGFALDEGLANPTDTFTVFYGEKCPWWIKVKVQGNPGHGSRFIENTAAEKMHRVITSFLEFREHEKQRLKTGEHLTLGDVTSVNLTMLNGGVSFNVVPSELSVAFDIRIPPTADLKEFEEQLTSWCKTAGEGVTYEFQQKYMDQTVTSTEESDPWWKAFSDTCKDMNMKLKCEIFPAATDSRYIRATGRPAIGFSPMNYTPVLLHDHNEFLNEQIFLHGIEIYTXLIPALASV 409          

HSP 2 Score: 78.9518 bits (193), Expect = 3.272e-12
Identity = 36/76 (47.37%), Postives = 48/76 (63.16%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            +V  F EYLRI T+ P PDY  A++FL   A +L L+    E+ P+  I  + W G +  L+SI+LNSH DVVPVF
Sbjct:   20 SVTLFREYLRIKTVQPQPDYDTAIKFLERIASELGLQCLKVEVCPDRVITILTWQGTNPQLRSILLNSHTDVVPVF 95          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: T1DMF5 (Aminoacylase-1A-like protein OS=Crotalus horridus OX=35024 PE=2 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 2.650e-110
Identity = 169/313 (53.99%), Postives = 219/313 (69.97%), Query Frame = 2
Query:  275 WKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKE-NNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            W+Y PFSA+ D  GNIY RG QDMKCV  QYLEAIR++K +   +   R I + FVPDEE+GG KGMEL V+T  F  +N+G  +DEGLANPT++F+ FYG++  WWIKV + GN GHGS+FI+N+A  KMHR++T F+  R  E+ R+K   +LT+GDVT+VNLT   GGV  NVVPS  ++ FDIRI P  DL  F+  L SW +  G G+ YEF Q      +T+T+ ++ WW+ F   C+  NM++  +IFPA TDSR++R+ G  AIGFSP+N TP+LLHDHNEFLN  +FL GIE Y  LI ALA V
Sbjct:   99 WQYDPFSAFKDSEGNIYGRGTQDMKCVSIQYLEAIRRLKAEGRHF--SRTIHMSFVPDEEIGGHKGMELFVKTPEFAALNVGFALDEGLANPTDTFTVFYGEKCPWWIKVKVQGNPGHGSRFIENTAAEKMHRVITSFLEFREHEKQRLKTGEHLTLGDVTSVNLTMLNGGVSFNVVPSELSVAFDIRIPPTADLKEFEEQLTSWCKTAGEGVTYEFQQKYMDQTVTSTEESDPWWKAFSDTCKDMNMKLKCEIFPAATDSRYIRATGRPAIGFSPMNYTPVLLHDHNEFLNEQIFLHGIEIYTRLIPALASV 409          

HSP 2 Score: 78.9518 bits (193), Expect = 3.242e-12
Identity = 36/76 (47.37%), Postives = 48/76 (63.16%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            +V  F EYLRI T+ P PDY  A++FL   A +L L+    E+ P+  I  + W G +  L+SI+LNSH DVVPVF
Sbjct:   20 SVTLFREYLRIKTVQPQPDYDTAIKFLERIASELGLQCLKVEVCPDRVITILTWQGTNPQLRSILLNSHTDVVPVF 95          
BLAST of Aminoacylase-1 vs. Ensembl Cavefish
Match: acy1 (aminoacylase 1 [Source:NCBI gene;Acc:103031539])

HSP 1 Score: 309.301 bits (791), Expect = 1.253e-101
Identity = 155/315 (49.21%), Postives = 210/315 (66.67%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + WKY  F+A  D  GNIY RG+QDMK V  QY+EAIR++K     +   R I + FVPDEEVGG KGME  +    F+ +N+G  +DEGLANPT +F+ FYG+R  WWI +   G+ GHGS+F++N+A  K+ RI+  F++ R +E+ R+  +   T+GDVTTVN+T   GGV +NV+P+   + FD+RI P  +L  F+  + +W  E G GI Y+F Q       T+T+ ++ WW  F S C++ NM +  +IFPA TDSRF+R+ G+ AIGFSP+N TPILLHDHNEFLN  VFL GI  YE L+L LA V
Sbjct:   99 EHWKYDAFAAVKDAEGNIYGRGSQDMKSVTIQYIEAIRRLKAAGKRF--PRTIHLSFVPDEEVGGHKGMETFINHPEFQKLNVGFALDEGLANPTEAFTVFYGERNPWWITIRCPGSPGHGSRFVENTAAEKLRRIINSFLDFRASEKQRLDTSECFTLGDVTTVNMTMVNGGVAYNVIPAEMDVSFDMRIPPTVNLQEFEEQIKAWCAEAGEGITYKFAQKFMHQNTTSTEDSDPWWNAFSSTCKAMNMTLQKEIFPAATDSRFIRAAGLPAIGFSPMNCTPILLHDHNEFLNEGVFLRGITVYERLLLTLASV 411          

HSP 2 Score: 77.0258 bits (188), Expect = 5.319e-15
Identity = 33/77 (42.86%), Postives = 52/77 (67.53%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            AV+ F EYL++ T+HP+PDY  A++FL   +E+L L     E+ P   +  + W G + ++KS++LNSH DVVPV++
Sbjct:   22 AVSLFREYLQLKTVHPEPDYDAALKFLTRISEELGLPMKKIEVCPGRVVTIITWTGTNPAVKSVLLNSHTDVVPVYQ 98          
BLAST of Aminoacylase-1 vs. Ensembl Cavefish
Match: pm20d1.2 (peptidase M20 domain containing 1 [Source:NCBI gene;Acc:103024030])

HSP 1 Score: 49.6766 bits (117), Expect = 4.068e-6
Identity = 41/130 (31.54%), Postives = 62/130 (47.69%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLA------NPTNSFSAFYG--DRVAWWIKVHISGNTGHGS 634
            D W+ PPFSA  +  G IY RG  D K      L+A+  +  +   YVP R   +    DEEV G  G   +V+    R + +  V+DEGLA      +  +  +A  G  ++ +  +K+ +S   GH S
Sbjct:  152 DGWEAPPFSAK-EMNGFIYGRGTIDNKQSVMGILQALEYLLQRG--YVPRRGFYIGLGHDEEVSGYSGAVNIVKVLKSRGVKLHYVLDEGLAVLDGVIDGLDGPAALIGISEKGSATVKLSVSTKPGHSS 278          
BLAST of Aminoacylase-1 vs. Ensembl Sea Lamprey
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 235.343 bits (599), Expect = 1.273e-78
Identity = 117/246 (47.56%), Postives = 163/246 (66.26%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMK-ENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQ 1003
            + W+Y PF A  D  GNIY RGAQDMK VG QY+EAIR+++ +   +   R + +LFVPDEEVGG +GM L V++  F+ +N+G V+DEGLANPT++++ FYG+R  WW+ V  +G+ GHGS+FI N+A  K+ +I+  F+  R  E+ R+     +T+GDVTTVNLT   GGVQ+NVVP+     FDIR+ P  DL  F+  L SW  E G G+ YEF Q      +T+T  ++ WW  F +VC+
Sbjct:  110 EHWQYDPFEAVKDAEGNIYGRGAQDMKSVGIQYVEAIRRLRDEGKRF--PRTLHLLFVPDEEVGGFRGMSLFVKSPEFKALNVGFVLDEGLANPTDAYTVFYGERSCWWVTVKCTGHPGHGSRFITNTAAEKLQKIINAFLGFREKEKARLDCSACMTLGDVTTVNLTMVHGGVQYNVVPAELAASFDIRVPPAVDLQAFEQQLESWCREAGDGVTYEFAQKGMDQSVTSTSESDPWWGAFSAVCR 353          

HSP 2 Score: 75.8702 bits (185), Expect = 1.273e-78
Identity = 36/76 (47.37%), Postives = 47/76 (61.84%), Query Frame = 3
Query:   42 VANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            V  F EYLRI T+HP PDY  A+ FL   A  L L    YE+ P+   V + W G + +L+S++LNSH DVVP F+
Sbjct:   34 VTLFREYLRIRTVHPKPDYDSAIAFLERVAIDLDLPLKKYELEPSLIAVVITWEGSNPALRSVLLNSHTDVVPAFQ 109          
BLAST of Aminoacylase-1 vs. Ensembl Yeast
Match: CPS1 (Vacuolar carboxypeptidase S; expression is induced under low-nitrogen conditions [Source:SGD;Acc:S000003708])

HSP 1 Score: 44.2838 bits (103), Expect = 1.165e-8
Identity = 41/152 (26.97%), Postives = 66/152 (43.42%), Query Frame = 2
Query:  275 WKYPPFSAYID-ELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGL--VMDEG-----------LANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKF 688
            WK+PPFS + D E   ++ RG+ D K +     EAI ++      + P R I++    DEE  G  G   L      R  + G+  ++DEG           +A P N+   +         +V I G+ GH S   D++       ++T+F
Sbjct:  182 WKFPPFSGHYDPETDFVWGRGSNDCKNLLIAEFEAIEQLLIDG--FKPNRTIVMSLGFDEEASGTLGAASLASFLHERYGDDGIYSIIDEGEGIMEVDKDVFVATPINAEKGYVD------FEVSILGHGGHSSVPPDHTTIGIASELITEF 325          

HSP 2 Score: 31.187 bits (69), Expect = 1.165e-8
Identity = 24/67 (35.82%), Postives = 31/67 (46.27%), Query Frame = 3
Query:   87 DPDYSKAVEFLHEQAEQ--------LKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPV 263
            DPD+ K    LH+  E+        LKLE        N   +   W G D  LK ++L +H DVVPV
Sbjct:  114 DPDFYKHFYELHDYFEKTFPNIHKHLKLEKV------NELGLLYTWEGSDPDLKPLLLMAHQDVVPV 174          
BLAST of Aminoacylase-1 vs. Ensembl Medaka
Match: acy1 (aminoacylase 1 [Source:NCBI gene;Acc:101160548])

HSP 1 Score: 318.931 bits (816), Expect = 1.776e-105
Identity = 157/315 (49.84%), Postives = 215/315 (68.25%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            + WKY  F A+ D  G+IYARG+QDMKCV  QY++A+RK+K +   + P R + ++FVPDEEVGG KGME  V    F+ +NIG  +DEGLANP  +F+ FYG+R  WWI +H  G+ GHGS+F++N+A  K+ +++  F++ R  E+ R+  +   T+GDVTTVN+T   GGV +NV+P+   + FD+RI P  +L +F+  +  W  E G  I YEF Q   +  +T+TD T+ WW  F + C+S NM +  +IFPA TDSRF+R+ GI AIGFSP+N TPILLHDHNE+LN +VFL GI  YE LI AL  V
Sbjct:  100 EHWKYDAFKAFKDAKGDIYARGSQDMKCVTIQYIQAVRKLKAQG--WKPARTVHLMFVPDEEVGGHKGMETFVTQPEFQKLNIGFALDEGLANPGEAFTVFYGERNPWWITIHCPGSPGHGSRFVENTAAEKLRQVINSFLDFREKEKQRLNTSECFTLGDVTTVNMTMVKGGVAYNVIPAEMDVSFDLRIPPTVNLQDFERQIQEWCAEAGQDITYEFAQKHMNQNITSTDDTDPWWSAFSAACKSLNMTLEKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILLHDHNEYLNEEVFLKGIGVYERLIPALTSV 412          

HSP 2 Score: 79.337 bits (194), Expect = 1.070e-15
Identity = 36/77 (46.75%), Postives = 49/77 (63.64%), Query Frame = 3
Query:   39 AVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFR 269
            +V  F EYLR+ T+HP+PDY  AV FL   A +L+L     E+ P   +  M W G +  LKS++LNSH DVVPV++
Sbjct:   23 SVTLFREYLRLKTVHPEPDYDAAVRFLSRIAVELELPLKKIEVCPGRVVSIMTWEGTEPQLKSVLLNSHTDVVPVYQ 99          
BLAST of Aminoacylase-1 vs. Ensembl Medaka
Match: acy1 (aminoacylase 1 [Source:NCBI gene;Acc:101160548])

HSP 1 Score: 302.753 bits (774), Expect = 1.561e-99
Identity = 154/317 (48.58%), Postives = 211/317 (66.56%), Query Frame = 2
Query:  263 IPDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENN-LTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARV 1210
            I + WKY  F A+ D  G+IYARG+QDMKCV  QY++A+RK+K +   + P R + ++FVPDEEVGG KGME  V    F+ +NIG  +DEGLANP  +F+ FYG+R  W  +       GHGS+F++N+A  K+ +++  F++ R  E+ R+  +   T+GDVTTVN+T   GGV +NV+P+   + FD+RI P  +L +F+  +  W  E G  I YEF Q   +  +T+TD T+ WW  F + C+S NM +  +IFPA TDSRF+R+ GI AIGFSP+N TPILLHDHNE+LN +VFL GI  YE LI AL  V
Sbjct:   63 IEEHWKYDAFKAFKDAKGDIYARGSQDMKCVTIQYIQAVRKLKAQG--WKPARTVHLMFVPDEEVGGHKGMETFVTQPEFQKLNIGFALDEGLANPGEAFTVFYGERNPW-CECRTQTIPGHGSRFVENTAAEKLRQVINSFLDFREKEKQRLNTSECFTLGDVTTVNMTMVKGGVAYNVIPAEMDVSFDLRIPPTVNLQDFERQIQEWCAEAGQDITYEFAQKHMNQNITSTDDTDPWWSAFSAACKSLNMTLEKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILLHDHNEYLNEEVFLKGIGVYERLIPALTSV 376          
BLAST of Aminoacylase-1 vs. Ensembl Medaka
Match: pm20d1.2 (peptidase M20 domain containing 1 [Source:NCBI gene;Acc:101164152])

HSP 1 Score: 50.0618 bits (118), Expect = 2.961e-6
Identity = 42/131 (32.06%), Postives = 59/131 (45.04%), Query Frame = 2
Query:  269 DKWKYPPFSAYIDEL-GNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYG--------DRVAWWIKVHISGNTGHGS 634
            D W+ PPFSA   E+ G IY RG  D K      L+A+  +  K   Y P R   + F  DEE+ G  G   +V     R + +  V+DEGLA      S   G        ++ +  +K+ +S   GH S
Sbjct:  184 DGWEAPPFSA--KEINGFIYGRGTIDDKNSLMAILQALEYLLLKG--YAPRRGFYIGFGHDEEIRGFNGAMNIVRVLKQRNVQLSFVLDEGLAVMDGIISGLEGPAALIGLSEKGSANVKLSVSTAPGHSS 310          
BLAST of Aminoacylase-1 vs. Planmine SMEST
Match: SMESG000028017.1 (SMESG000028017.1)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 324/344 (94.19%), Postives = 327/344 (95.06%), Query Frame = 2
Query:  197 MEWNG--QILEEYRTQLSYGCRSGIPDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARVEEDL 1222
            M+WNG  + L+              PDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENNLTIGDVTTVNLTGTTGGVQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARVEEDL
Sbjct:    1 MKWNGMDKSLKSIVLNSHMDVVPVFPDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENNLTIGDVTTVNLTGTTGGVQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARVEEDL 344          

HSP 2 Score: 55.4546 bits (132), Expect = 3.425e-8
Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = 3
Query:  192 MKWNGMDKSLKSIVLNSHMDVVPVF 266
            MKWNGMDKSLKSIVLNSHMDVVPVF
Sbjct:    1 MKWNGMDKSLKSIVLNSHMDVVPVF 25          
BLAST of Aminoacylase-1 vs. Planmine SMEST
Match: SMESG000028073.1 (SMESG000028073.1)

HSP 1 Score: 457.988 bits (1177), Expect = 1.728e-160
Identity = 238/396 (60.10%), Postives = 293/396 (73.99%), Query Frame = 2
Query:   44 CKFLRISSNKHDSSGSRLFEGR*VSP*TSGTIKIGI--LRL*NCPKQPNCLYEMEWNG--QILEEYRTQLSYGCRSGIPDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARVEED 1219
            C++L+  +   +   S+  E       TS +I++G+    +  C K P  +  M+W+G  + L+              PD+WKYPPFSA+ID+ G+IYARG+QDMKC GSQYLEAIR+IK  SP ++PERNI +LFVPDEEVGG KGM+  VE+  F  MNIG+VMDEG+ +  N +  FYGDRV  WIKVHISG+TGHGSQFI N+AGVK+  IL KFM+ R  EE RM ENNLT+GDVTTVNLTG  GGVQHNV+PSPFTLDFDIRI+PK +++ FK M+N WA E G GIEYEFIQ++PSAYLT  D+TNKWW  FES+C+S NM+IIPQ+FPAGTDSR+VR KGI AIGFSPINNTP LLHDHNE LNVD F+ GI+FYE LI   + ++ D
Sbjct:   13 CEYLKCETVHPNPDYSKAVEFL-----TSQSIQLGLELTVIEFCQKNPIVI--MKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNGDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEETRMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLIFEFSSMQVD 401          

HSP 2 Score: 114.39 bits (285), Expect = 7.295e-28
Identity = 54/83 (65.06%), Postives = 62/83 (74.70%), Query Frame = 3
Query:   18 MNSINKQAVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            M S+N QAV NFCEYL+  T+HP+PDYSKAVEFL  Q+ QL LE  V E    NPIV MKW+G +K LKS V NSH+DVVPVF
Sbjct:    1 MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVIEFCQKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVF 83          
BLAST of Aminoacylase-1 vs. Planmine SMEST
Match: SMESG000028073.1 (SMESG000028073.1)

HSP 1 Score: 382.104 bits (980), Expect = 9.492e-134
Identity = 186/263 (70.72%), Postives = 219/263 (83.27%), Query Frame = 2
Query:  266 PDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENNLTIGDXXXXXXXXXXXXXQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDS 1054
            PD+WKYPPFSA+ID+ G+IYARG+QDMKC GSQYLEAIR+IK  SP ++PERNI +LFVPDEEVGG KGM+  VE+  F  MNIG+VMDEG+ +  N +  FYGDRV  WIKVHISG+TGHGSQFI N+AGVK+  IL KFM+ R  EE RM ENNLT+GDVTTVNLTG  GGVQHNV+PSPFTLDFDIRI+PK +++ FK M+N WA E G GIEYEFIQ++PSAYLT  D+TNKWW  FES+C+S NM+IIPQ+FPAGTDS
Sbjct:   84 PDQWKYPPFSAHIDDNGDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEETRMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDS 346          

HSP 2 Score: 114.775 bits (286), Expect = 9.492e-134
Identity = 54/83 (65.06%), Postives = 62/83 (74.70%), Query Frame = 3
Query:   18 MNSINKQAVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEIVPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVF 266
            M S+N QAV NFCEYL+  T+HP+PDYSKAVEFL  Q+ QL LE  V E    NPIV MKW+G +K LKS V NSH+DVVPVF
Sbjct:    1 MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVIEFCQKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVF 83          
The following BLAST results are available for this feature:
BLAST of Aminoacylase-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACY11.207e-9744.14aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177][more]
ACY12.166e-9444.76aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177][more]
ACY12.166e-9444.76aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177][more]
ACY12.401e-9444.76aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177][more]
ABHD14A-ACY15.567e-9344.34ABHD14A-ACY1 readthrough [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C10C5.53.362e-8443.81Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q17900][more]
C06A6.41.208e-8144.41Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4][more]
C06A6.41.208e-8144.41Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4][more]
C10C5.32.034e-8142.59Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q17898][more]
C06A6.41.165e-7843.12Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4][more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG64651.771e-9245.57gene:FBgn0037818 transcript:FBtr0082323[more]
CG67267.644e-9246.33gene:FBgn0039049 transcript:FBtr0084349[more]
CG67267.644e-9246.33gene:FBgn0039049 transcript:FBtr0084348[more]
CG67267.644e-9246.33gene:FBgn0039049 transcript:FBtr0344300[more]
CG171102.247e-9043.95gene:FBgn0039050 transcript:FBtr0084350[more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acy15.204e-10350.16aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
acy15.204e-10350.16aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
acy15.204e-10350.16aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
acy11.951e-10149.52aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
acy11.295e-3154.81aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000004778.12.001e-9547.94aminoacylase-1-like [Source:NCBI gene;Acc:10173520... [more]
acy1.13.806e-6948.23aminoacylase 1, gene 1 [Source:NCBI gene;Acc:49688... [more]
dock36.823e-4555.56dedicator of cytokinesis 3 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000004860.11.168e-3956.82aminoacylase 1 [Source:NCBI gene;Acc:108647469][more]
b3gat14.040e-637.50beta-1,3-glucuronyltransferase 1 [Source:Xenbase;A... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acy14.938e-10445.87aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
Acy17.165e-10046.67aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
Acy13.295e-6636.51aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
Acy17.459e-6645.37aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
Acy15.264e-5349.62aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
back to top
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99JW2|ACY1_MOUSE3.117e-9846.03Aminoacylase-1 OS=Mus musculus OX=10090 GN=Acy1 PE... [more]
sp|Q6AYS7|ACY1A_RAT1.033e-9747.30Aminoacylase-1A OS=Rattus norvegicus OX=10116 GN=A... [more]
sp|Q6PTT0|ACY1B_RAT7.891e-9645.71Aminoacylase-1B OS=Rattus norvegicus OX=10116 GN=A... [more]
sp|P37111|ACY1_PIG3.922e-9544.27Aminoacylase-1 OS=Sus scrofa OX=9823 GN=ACY1 PE=1 ... [more]
sp|Q03154|ACY1_HUMAN9.452e-9444.76Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1 PE=... [more]
back to top
BLAST of Aminoacylase-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D4M8G46.475e-11154.31M20_dimer domain-containing protein OS=Micrurus sp... [more]
A0A0K8S3002.510e-11053.99Aminoacylase-1A-like protein OS=Crotalus horridus ... [more]
A0A0F7ZDY82.565e-11053.99Aminoacylase-1A-like protein OS=Crotalus adamanteu... [more]
A0A0K8RY462.622e-11053.99Aminoacylase-1A-like protein OS=Crotalus horridus ... [more]
T1DMF52.650e-11053.99Aminoacylase-1A-like protein OS=Crotalus horridus ... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
acy11.253e-10149.21aminoacylase 1 [Source:NCBI gene;Acc:103031539][more]
pm20d1.24.068e-631.54peptidase M20 domain containing 1 [Source:NCBI gen... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
acy11.273e-7847.56aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CPS11.165e-826.97Vacuolar carboxypeptidase S; expression is induced... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aminoacylase-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
acy11.776e-10549.84aminoacylase 1 [Source:NCBI gene;Acc:101160548][more]
acy11.561e-9948.58aminoacylase 1 [Source:NCBI gene;Acc:101160548][more]
pm20d1.22.961e-632.06peptidase M20 domain containing 1 [Source:NCBI gen... [more]
back to top
BLAST of Aminoacylase-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000028017.13.425e-894.19SMESG000028017.1[more]
SMESG000028073.11.728e-16060.10SMESG000028073.1[more]
SMESG000028073.19.492e-13470.72SMESG000028073.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023874 ID=SMED30023874|Name=Aminoacylase-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1260bp
GTTTTATATAAAATTGAATGAATTCTATTAATAAACAAGCTGTTGCAAAT
TTCTGCGAATATCTTCGAATAAACACGATTCATCCGGATCCAGATTATTC
GAAGGCCGTTGAGTTTCTCCATGAACAAGCGGAACAATTAAAATTGGAAT
TTTACGTTTATGAAATTGTCCCAAACAACCCAATTGTTTATATGAAATGG
AATGGAATGGACAAATCCTTGAAGAGTATCGTACTCAACTCTCATATGGA
TGTCGTTCCGGTATTCCGGATAAATGGAAATATCCACCATTTTCAGCTTA
TATTGACGAACTGGGCAATATCTATGCTAGGGGAGCCCAAGATATGAAAT
GTGTTGGGAGCCAATATTTAGAGGCTATTCGTAAAATAAAAACAAAATCA
CCTACATACGTTCCGGAAAGAAATATTATAGTTCTATTTGTGCCAGATGA
AGAAGTCGGAGGTAAGAAAGGCATGGAATTGCTTGTCGAGACAGATATAT
TCCGGCTCATGAATATTGGACTAGTAATGGATGAAGGACTTGCTAATCCA
ACCAATTCCTTTTCTGCCTTTTATGGCGATAGAGTTGCATGGTGGATTAA
AGTTCATATTTCTGGAAATACTGGTCATGGGTCACAGTTCATTGACAATT
CTGCTGGAGTAAAGATGCATCGTATTCTTACAAAATTTATGAACTTGCGT
CTGGCTGAGGAACTGCGAATGAAAGAAAACAATTTAACCATTGGAGATGT
GACGACTGTTAATTTGACTGGCACGACAGGTGGAGTTCAACATAATGTGG
TCCCGTCTCCATTTACTTTGGATTTCGATATAAGGATTACTCCTAAAACT
GATTTGTCTAACTTTAAAAATATGCTCAATTCTTGGGCCGAAGAAGTCGG
TGGAGGCATAGAATATGAATTTATCCAATACGCCCCGAGTGCTTACCTGA
CTGCAACCGACGCCACAAATAAATGGTGGGAAACATTCGAATCGGTTTGT
CAATCGAGAAACATGGAAATTATTCCCCAGATTTTCCCGGCAGGGACTGA
CAGCAGATTTGTGAGGTCAAAAGGCATTTCTGCGATTGGATTTTCACCAA
TTAACAATACTCCCATACTGCTTCATGATCACAACGAGTTTCTGAATGTT
GATGTGTTCCTTTGTGGCATTGAGTTCTATGAAGATTTAATATTGGCTTT
AGCGAGAGTTGAAGAAGACTTGTGAAAGAATTATTGTGAAATATATTTGA
GATCGGAAGA
back to top

protein sequence of SMED30023874-orf-1

>SMED30023874-orf-1 ID=SMED30023874-orf-1|Name=SMED30023874-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MNSINKQAVANFCEYLRINTIHPDPDYSKAVEFLHEQAEQLKLEFYVYEI
VPNNPIVYMKWNGMDKSLKSIVLNSHMDVVPVFRINGNIHHFQLILTNWA
ISMLGEPKI*
back to top

protein sequence of SMED30023874-orf-2

>SMED30023874-orf-2 ID=SMED30023874-orf-2|Name=SMED30023874-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MEWNGQILEEYRTQLSYGCRSGIPDKWKYPPFSAYIDELGNIYARGAQDM
KCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETD
IFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFID
NSAGVKMHRILTKFMNLRLAEELRMKENNLTIGDVTTVNLTGTTGGVQHN
VVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAY
LTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFS
PINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARVEEDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002933Peptidase_M20
IPR010159N-acyl_aa_amidohydrolase
IPR011650Peptidase_M20_dimer
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0004046aminoacylase activity
GO:0016787hydrolase activity
GO:0008237metallopeptidase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006520cellular amino acid metabolic process
GO:0008152metabolic process
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 1..109
e-value: 4.7E-33
score: 116.4
NoneNo IPR availablePANTHERPTHR45892:SF1AMINOACYLASE-1coord: 4..109
NoneNo IPR availablePANTHERPTHR45892FAMILY NOT NAMEDcoord: 4..109
NoneNo IPR availableCDDcd05646M20_AcylaseI_likecoord: 6..109
e-value: 1.61161E-58
score: 182.472
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 5..109
IPR002933Peptidase M20PFAMPF01546Peptidase_M20coord: 71..109
e-value: 5.9E-9
score: 35.9