Serine/threonine protein phosphatase 2A regulatory subunit

Overview
NameSerine/threonine protein phosphatase 2A regulatory subunit
Smed IDSMED30023859
Length (bp)1993
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine protein phosphatase 2A regulatory subunit (SMED30023859) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine protein phosphatase 2A regulatory subunit (SMED30023859) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine protein phosphatase 2A regulatory subunit (SMED30023859) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine protein phosphatase 2A regulatory subunit (SMED30023859) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023859

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30023859h1SMcG0019077 Contig33217newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023859h1SMcG0019077 Contig33217uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30023859h1SMcG0019077 dd_Smed_v4_6134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023859h1SMcG0019077 dd_Smed_v4_6134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023859h1SMcG0019077 dd_Smed_v4_6134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023859h1SMcG0019077 dd_Smed_v4_6134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023859h1SMcG0019077 dd_Smed_v4_6134_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Human
Match: PPP2R5D (protein phosphatase 2 regulatory subunit B'delta [Source:HGNC Symbol;Acc:HGNC:9312])

HSP 1 Score: 472.626 bits (1215), Expect = 2.838e-159
Identity = 257/488 (52.66%), Postives = 351/488 (71.93%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSEN-GKKDVESALRDLELETQSNSNDMKKIRLM 1708
            K+ RQ SSRF +S  RE+Q+LP+ K+  + ERE L I+KLRQC V+FDF SD +SD+K+K++K+  L E+ EY + +  V+++A+Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRA+IR+QIN+IFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  QLAYC+++F++K++SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQK     K+  + W  + E+A+ NP Y    +      P+  M +E    +D++   R +E E      D+KK +++
Sbjct:   75 KERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIV-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLP-PVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVL 560          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Human
Match: PPP2R5D (protein phosphatase 2 regulatory subunit B'delta [Source:HGNC Symbol;Acc:HGNC:9312])

HSP 1 Score: 472.626 bits (1215), Expect = 3.667e-159
Identity = 257/488 (52.66%), Postives = 351/488 (71.93%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSEN-GKKDVESALRDLELETQSNSNDMKKIRLM 1708
            K+ RQ SSRF +S  RE+Q+LP+ K+  + ERE L I+KLRQC V+FDF SD +SD+K+K++K+  L E+ EY + +  V+++A+Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRA+IR+QIN+IFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  QLAYC+++F++K++SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQK     K+  + W  + E+A+ NP Y    +      P+  M +E    +D++   R +E E      D+KK +++
Sbjct:   83 KERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIV-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLP-PVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVL 568          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Human
Match: PPP2R5C (protein phosphatase 2 regulatory subunit B'gamma [Source:HGNC Symbol;Acc:HGNC:9311])

HSP 1 Score: 466.077 bits (1198), Expect = 2.152e-157
Identity = 259/482 (53.73%), Postives = 346/482 (71.78%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSE-----NGKKDVESALRDLELETQSN 1678
            KD RQ SSRF  S+ RE+Q+LPS K+V   ++E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  + + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +K KE    K+  + WV +  +AK NP   K   +   D P+    SE     + KK +E+  R  EL +Q  
Sbjct:   62 KDKRQNSSRFSASNNRELQKLPSLKDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQK---DPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDG 539          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Human
Match: PPP2R5D (protein phosphatase 2 regulatory subunit B'delta [Source:HGNC Symbol;Acc:HGNC:9312])

HSP 1 Score: 440.654 bits (1132), Expect = 4.462e-148
Identity = 247/488 (50.61%), Postives = 335/488 (68.65%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSEN-GKKDVESALRDLELETQSNSNDMKKIRLM 1708
            K+ RQ SSRF +S  RE+Q+LP+ K+  + ERE L I+KLRQC V+FDF SD +SD+K+K++K+  L E+ EY + +  V+++A+Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRA+IR+QIN+IFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  Q                   ++ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQK     K+  + W  + E+A+ NP Y    +      P+  M +E    +D++   R +E E      D+KK +++
Sbjct:    3 KERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQ-------------------VIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLP-PVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVL 470          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Human
Match: PPP2R5D (protein phosphatase 2 regulatory subunit B'delta [Source:HGNC Symbol;Acc:HGNC:9312])

HSP 1 Score: 437.958 bits (1125), Expect = 4.125e-147
Identity = 240/454 (52.86%), Postives = 327/454 (72.03%), Query Frame = 2
Query:  356 LLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSEN-GKKDVESALRDLELETQSNSNDMKKIRLM 1708
            L I+KLRQC V+FDF SD +SD+K+K++K+  L E+ EY + +  V+++A+Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRA+IR+QIN+IFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  QLAYC+++F++K++SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQK     K+  + W  + E+A+ NP Y    +      P+  M +E    +D++   R +E E      D+KK +++
Sbjct:   11 LFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIV-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLP-PVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVL 462          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Celegans
Match: pptr-2 (Serine/threonine protein phosphatase 2A regulatory subunit [Source:UniProtKB/TrEMBL;Acc:A9UJN4])

HSP 1 Score: 441.039 bits (1133), Expect = 1.204e-147
Identity = 241/469 (51.39%), Postives = 330/469 (70.36%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFS-DLMSDIKYKDIKKRALIEISEYFSSNT-GVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALR 1651
            ++ RQ SS F IS  RE+Q LP+ K+   +ERE+L I+KLRQC VVFDF+ D +SD+K+K++K+ AL E+ ++ S    G LSDAVY E + M  TN+FR L P     G + D D+++P LEA+WPHLQ VYE FLRF+E  +F + +A+ +IDQNFIL ++ + D EDPRERD+LKT LHRIYGK +  RA+IRKQINNIFY  IYE E  NG AELLEILGSIINGF +PLK+EHK FL RVLLPLHKV SL V+  QLAYC+++FI+KD+SL   VI  G+L++WPK  S KE+M LNELEE L++ +  +FQ +   +FSQI+RC+ S HFQV ERAL +WNNE +  L   N  +++P  FP L+  +K HWNKTIHGL++N LK+ M++NQKLFDEC+  +++D+ +E  + ++    W  + + A  NP Y ++ +      P +E+ S   +  V+  ++
Sbjct:   44 RERRQSSSMFNISQNRELQRLPAIKDADPSERETLFIQKLRQCCVVFDFANDALSDLKFKEVKRAALNELVDHVSGAPKGSLSDAVYPEAIGMFSTNLFRPLSPPTNPIGAEFDPDEDEPTLEAAWPHLQLVYEFFLRFLECPDFQSQVAKRYIDQNFILRLLMIMDSEDPRERDFLKTTLHRIYGKFLGHRAYIRKQINNIFYSFIYETERHNGIAELLEILGSIINGFALPLKEEHKTFLLRVLLPLHKVKSLSVYHPQLAYCVVQFIEKDSSLTEPVI-SGMLRFWPKQHSPKEVMFLNELEEVLDVIEPNEFQKIMTPLFSQIARCVSSPHFQVAERALYYWNNEYVMSLVADNARVIIPIMFPVLFKNSKSHWNKTIHGLIYNALKMFMEMNQKLFDECSQAYQKDRVQEKTLNEEKERIWNNIEKQAMGNPQYVEVKALFARFNP-DEIISSRQQNGVDENMK 510          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Celegans
Match: pptr-2 (Serine/threonine protein phosphatase 2A regulatory subunit [Source:UniProtKB/TrEMBL;Acc:A9UJN4])

HSP 1 Score: 440.269 bits (1131), Expect = 1.443e-147
Identity = 241/469 (51.39%), Postives = 330/469 (70.36%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFS-DLMSDIKYKDIKKRALIEISEYFSSNT-GVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALR 1651
            ++ RQ SS F IS  RE+Q LP+ K+   +ERE+L I+KLRQC VVFDF+ D +SD+K+K++K+ AL E+ ++ S    G LSDAVY E + M  TN+FR L P     G + D D+++P LEA+WPHLQ VYE FLRF+E  +F + +A+ +IDQNFIL ++ + D EDPRERD+LKT LHRIYGK +  RA+IRKQINNIFY  IYE E  NG AELLEILGSIINGF +PLK+EHK FL RVLLPLHKV SL V+  QLAYC+++FI+KD+SL   VI  G+L++WPK  S KE+M LNELEE L++ +  +FQ +   +FSQI+RC+ S HFQV ERAL +WNNE +  L   N  +++P  FP L+  +K HWNKTIHGL++N LK+ M++NQKLFDEC+  +++D+ +E  + ++    W  + + A  NP Y ++ +      P +E+ S   +  V+  ++
Sbjct:   31 RERRQSSSMFNISQNRELQRLPAIKDADPSERETLFIQKLRQCCVVFDFANDALSDLKFKEVKRAALNELVDHVSGAPKGSLSDAVYPEAIGMFSTNLFRPLSPPTNPIGAEFDPDEDEPTLEAAWPHLQLVYEFFLRFLECPDFQSQVAKRYIDQNFILRLLMIMDSEDPRERDFLKTTLHRIYGKFLGHRAYIRKQINNIFYSFIYETERHNGIAELLEILGSIINGFALPLKEEHKTFLLRVLLPLHKVKSLSVYHPQLAYCVVQFIEKDSSLTEPVI-SGMLRFWPKQHSPKEVMFLNELEEVLDVIEPNEFQKIMTPLFSQIARCVSSPHFQVAERALYYWNNEYVMSLVADNARVIIPIMFPVLFKNSKSHWNKTIHGLIYNALKMFMEMNQKLFDECSQAYQKDRVQEKTLNEEKERIWNNIEKQAMGNPQYVEVKALFARFNP-DEIISSRQQNGVDENMK 497          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Celegans
Match: pptr-2 (Serine/threonine protein phosphatase 2A regulatory subunit [Source:UniProtKB/TrEMBL;Acc:A9UJN4])

HSP 1 Score: 440.269 bits (1131), Expect = 1.443e-147
Identity = 241/469 (51.39%), Postives = 330/469 (70.36%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFS-DLMSDIKYKDIKKRALIEISEYFSSNT-GVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALR 1651
            ++ RQ SS F IS  RE+Q LP+ K+   +ERE+L I+KLRQC VVFDF+ D +SD+K+K++K+ AL E+ ++ S    G LSDAVY E + M  TN+FR L P     G + D D+++P LEA+WPHLQ VYE FLRF+E  +F + +A+ +IDQNFIL ++ + D EDPRERD+LKT LHRIYGK +  RA+IRKQINNIFY  IYE E  NG AELLEILGSIINGF +PLK+EHK FL RVLLPLHKV SL V+  QLAYC+++FI+KD+SL   VI  G+L++WPK  S KE+M LNELEE L++ +  +FQ +   +FSQI+RC+ S HFQV ERAL +WNNE +  L   N  +++P  FP L+  +K HWNKTIHGL++N LK+ M++NQKLFDEC+  +++D+ +E  + ++    W  + + A  NP Y ++ +      P +E+ S   +  V+  ++
Sbjct:   31 RERRQSSSMFNISQNRELQRLPAIKDADPSERETLFIQKLRQCCVVFDFANDALSDLKFKEVKRAALNELVDHVSGAPKGSLSDAVYPEAIGMFSTNLFRPLSPPTNPIGAEFDPDEDEPTLEAAWPHLQLVYEFFLRFLECPDFQSQVAKRYIDQNFILRLLMIMDSEDPRERDFLKTTLHRIYGKFLGHRAYIRKQINNIFYSFIYETERHNGIAELLEILGSIINGFALPLKEEHKTFLLRVLLPLHKVKSLSVYHPQLAYCVVQFIEKDSSLTEPVI-SGMLRFWPKQHSPKEVMFLNELEEVLDVIEPNEFQKIMTPLFSQIARCVSSPHFQVAERALYYWNNEYVMSLVADNARVIIPIMFPVLFKNSKSHWNKTIHGLIYNALKMFMEMNQKLFDECSQAYQKDRVQEKTLNEEKERIWNNIEKQAMGNPQYVEVKALFARFNP-DEIISSRQQNGVDENMK 497          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Celegans
Match: pptr-2 (Serine/threonine protein phosphatase 2A regulatory subunit [Source:UniProtKB/TrEMBL;Acc:A9UJN4])

HSP 1 Score: 440.269 bits (1131), Expect = 1.576e-147
Identity = 241/469 (51.39%), Postives = 330/469 (70.36%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFS-DLMSDIKYKDIKKRALIEISEYFSSNT-GVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALR 1651
            ++ RQ SS F IS  RE+Q LP+ K+   +ERE+L I+KLRQC VVFDF+ D +SD+K+K++K+ AL E+ ++ S    G LSDAVY E + M  TN+FR L P     G + D D+++P LEA+WPHLQ VYE FLRF+E  +F + +A+ +IDQNFIL ++ + D EDPRERD+LKT LHRIYGK +  RA+IRKQINNIFY  IYE E  NG AELLEILGSIINGF +PLK+EHK FL RVLLPLHKV SL V+  QLAYC+++FI+KD+SL   VI  G+L++WPK  S KE+M LNELEE L++ +  +FQ +   +FSQI+RC+ S HFQV ERAL +WNNE +  L   N  +++P  FP L+  +K HWNKTIHGL++N LK+ M++NQKLFDEC+  +++D+ +E  + ++    W  + + A  NP Y ++ +      P +E+ S   +  V+  ++
Sbjct:   27 RERRQSSSMFNISQNRELQRLPAIKDADPSERETLFIQKLRQCCVVFDFANDALSDLKFKEVKRAALNELVDHVSGAPKGSLSDAVYPEAIGMFSTNLFRPLSPPTNPIGAEFDPDEDEPTLEAAWPHLQLVYEFFLRFLECPDFQSQVAKRYIDQNFILRLLMIMDSEDPRERDFLKTTLHRIYGKFLGHRAYIRKQINNIFYSFIYETERHNGIAELLEILGSIINGFALPLKEEHKTFLLRVLLPLHKVKSLSVYHPQLAYCVVQFIEKDSSLTEPVI-SGMLRFWPKQHSPKEVMFLNELEEVLDVIEPNEFQKIMTPLFSQIARCVSSPHFQVAERALYYWNNEYVMSLVADNARVIIPIMFPVLFKNSKSHWNKTIHGLIYNALKMFMEMNQKLFDECSQAYQKDRVQEKTLNEEKERIWNNIEKQAMGNPQYVEVKALFARFNP-DEIISSRQQNGVDENMK 493          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Celegans
Match: pptr-2 (Serine/threonine protein phosphatase 2A regulatory subunit [Source:UniProtKB/TrEMBL;Acc:A9UJN4])

HSP 1 Score: 440.269 bits (1131), Expect = 1.576e-147
Identity = 241/469 (51.39%), Postives = 330/469 (70.36%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFS-DLMSDIKYKDIKKRALIEISEYFSSNT-GVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALR 1651
            ++ RQ SS F IS  RE+Q LP+ K+   +ERE+L I+KLRQC VVFDF+ D +SD+K+K++K+ AL E+ ++ S    G LSDAVY E + M  TN+FR L P     G + D D+++P LEA+WPHLQ VYE FLRF+E  +F + +A+ +IDQNFIL ++ + D EDPRERD+LKT LHRIYGK +  RA+IRKQINNIFY  IYE E  NG AELLEILGSIINGF +PLK+EHK FL RVLLPLHKV SL V+  QLAYC+++FI+KD+SL   VI  G+L++WPK  S KE+M LNELEE L++ +  +FQ +   +FSQI+RC+ S HFQV ERAL +WNNE +  L   N  +++P  FP L+  +K HWNKTIHGL++N LK+ M++NQKLFDEC+  +++D+ +E  + ++    W  + + A  NP Y ++ +      P +E+ S   +  V+  ++
Sbjct:   27 RERRQSSSMFNISQNRELQRLPAIKDADPSERETLFIQKLRQCCVVFDFANDALSDLKFKEVKRAALNELVDHVSGAPKGSLSDAVYPEAIGMFSTNLFRPLSPPTNPIGAEFDPDEDEPTLEAAWPHLQLVYEFFLRFLECPDFQSQVAKRYIDQNFILRLLMIMDSEDPRERDFLKTTLHRIYGKFLGHRAYIRKQINNIFYSFIYETERHNGIAELLEILGSIINGFALPLKEEHKTFLLRVLLPLHKVKSLSVYHPQLAYCVVQFIEKDSSLTEPVI-SGMLRFWPKQHSPKEVMFLNELEEVLDVIEPNEFQKIMTPLFSQIARCVSSPHFQVAERALYYWNNEYVMSLVADNARVIIPIMFPVLFKNSKSHWNKTIHGLIYNALKMFMEMNQKLFDECSQAYQKDRVQEKTLNEEKERIWNNIEKQAMGNPQYVEVKALFARFNP-DEIISSRQQNGVDENMK 493          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Fly
Match: wrd (gene:FBgn0042693 transcript:FBtr0083554)

HSP 1 Score: 439.884 bits (1130), Expect = 2.540e-147
Identity = 236/464 (50.86%), Postives = 333/464 (71.77%), Query Frame = 2
Query:  233 ILNISKV----KDNRQFSSRFKISSFREIQEL-PSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPAL-YYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINE 1606
            +LNI+      K+ RQ S+R+  S   E+  L P  ++ +++ERE L I+K++QC  +FDFS+ +SD+K+K++K+ AL E+ ++ ++  GV+++ +Y E + M   N+FRTLPPS    G + D ++++P LE+SWPHLQ VYE+FLRF+ES +F  ++A+  ID  F+L ++DLFD EDPRERD+LKT+LHRIYGK + LRAFIRKQINN+FYR IYE E  NG AELLEILGSIINGF +PLK+EHK FL +VLLPLHK  SL V+  QL YC+++F++KD S LS  +++ LLK+WPKT S KE+M LNELEE L++ +  +FQ V   +F QI++C+ S HFQV ERAL +WNNE +  L   N  ++LP  FPAL   +K HWNKTIHGL++N LK+ M+I+Q+LFDEC+  +K++KQ E E   +  + W  V  +AK NP ++K A    D  P+++
Sbjct:   37 VLNITGTPIVRKEKRQTSARYNASKNCELTALIPLNEKTAASEREELFIQKIQQCCTLFDFSEPLSDLKFKEVKRAALHEMVDFLTNQNGVITEVIYPEAINMFAVNLFRTLPPSSNPNGAEFDPEEDEPTLESSWPHLQLVYELFLRFLESPDFQPSMAKRFIDHQFVLQLLDLFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNVFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKQFLLKVLLPLHKAKSLSVYHPQLTYCVVQFLEKDPS-LSEAVIKSLLKFWPKTHSPKEVMFLNELEELLDVIEPAEFQKVMVPLFRQIAKCVSSPHFQVAERALYYWNNEYIMSLITDNSAVILPIMFPALNRNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVESLAKTNPEWTK-ARRFNDCLPVSD 498          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Fly
Match: wrd (gene:FBgn0042693 transcript:FBtr0306646)

HSP 1 Score: 441.425 bits (1134), Expect = 1.188e-146
Identity = 236/464 (50.86%), Postives = 333/464 (71.77%), Query Frame = 2
Query:  233 ILNISKV----KDNRQFSSRFKISSFREIQEL-PSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPAL-YYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINE 1606
            +LNI+      K+ RQ S+R+  S   E+  L P  ++ +++ERE L I+K++QC  +FDFS+ +SD+K+K++K+ AL E+ ++ ++  GV+++ +Y E + M   N+FRTLPPS    G + D ++++P LE+SWPHLQ VYE+FLRF+ES +F  ++A+  ID  F+L ++DLFD EDPRERD+LKT+LHRIYGK + LRAFIRKQINN+FYR IYE E  NG AELLEILGSIINGF +PLK+EHK FL +VLLPLHK  SL V+  QL YC+++F++KD S LS  +++ LLK+WPKT S KE+M LNELEE L++ +  +FQ V   +F QI++C+ S HFQV ERAL +WNNE +  L   N  ++LP  FPAL   +K HWNKTIHGL++N LK+ M+I+Q+LFDEC+  +K++KQ E E   +  + W  V  +AK NP ++K A    D  P+++
Sbjct:  153 VLNITGTPIVRKEKRQTSARYNASKNCELTALIPLNEKTAASEREELFIQKIQQCCTLFDFSEPLSDLKFKEVKRAALHEMVDFLTNQNGVITEVIYPEAINMFAVNLFRTLPPSSNPNGAEFDPEEDEPTLESSWPHLQLVYELFLRFLESPDFQPSMAKRFIDHQFVLQLLDLFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNVFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKQFLLKVLLPLHKAKSLSVYHPQLTYCVVQFLEKDPS-LSEAVIKSLLKFWPKTHSPKEVMFLNELEELLDVIEPAEFQKVMVPLFRQIAKCVSSPHFQVAERALYYWNNEYIMSLITDNSAVILPIMFPALNRNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVESLAKTNPEWTK-ARRFNDCLPVSD 614          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Fly
Match: wrd (gene:FBgn0042693 transcript:FBtr0290319)

HSP 1 Score: 441.425 bits (1134), Expect = 1.188e-146
Identity = 236/464 (50.86%), Postives = 333/464 (71.77%), Query Frame = 2
Query:  233 ILNISKV----KDNRQFSSRFKISSFREIQEL-PSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPAL-YYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINE 1606
            +LNI+      K+ RQ S+R+  S   E+  L P  ++ +++ERE L I+K++QC  +FDFS+ +SD+K+K++K+ AL E+ ++ ++  GV+++ +Y E + M   N+FRTLPPS    G + D ++++P LE+SWPHLQ VYE+FLRF+ES +F  ++A+  ID  F+L ++DLFD EDPRERD+LKT+LHRIYGK + LRAFIRKQINN+FYR IYE E  NG AELLEILGSIINGF +PLK+EHK FL +VLLPLHK  SL V+  QL YC+++F++KD S LS  +++ LLK+WPKT S KE+M LNELEE L++ +  +FQ V   +F QI++C+ S HFQV ERAL +WNNE +  L   N  ++LP  FPAL   +K HWNKTIHGL++N LK+ M+I+Q+LFDEC+  +K++KQ E E   +  + W  V  +AK NP ++K A    D  P+++
Sbjct:  153 VLNITGTPIVRKEKRQTSARYNASKNCELTALIPLNEKTAASEREELFIQKIQQCCTLFDFSEPLSDLKFKEVKRAALHEMVDFLTNQNGVITEVIYPEAINMFAVNLFRTLPPSSNPNGAEFDPEEDEPTLESSWPHLQLVYELFLRFLESPDFQPSMAKRFIDHQFVLQLLDLFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNVFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKQFLLKVLLPLHKAKSLSVYHPQLTYCVVQFLEKDPS-LSEAVIKSLLKFWPKTHSPKEVMFLNELEELLDVIEPAEFQKVMVPLFRQIAKCVSSPHFQVAERALYYWNNEYIMSLITDNSAVILPIMFPALNRNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVESLAKTNPEWTK-ARRFNDCLPVSD 614          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Fly
Match: wrd (gene:FBgn0042693 transcript:FBtr0083552)

HSP 1 Score: 441.81 bits (1135), Expect = 1.269e-146
Identity = 236/464 (50.86%), Postives = 333/464 (71.77%), Query Frame = 2
Query:  233 ILNISKV----KDNRQFSSRFKISSFREIQEL-PSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPAL-YYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINE 1606
            +LNI+      K+ RQ S+R+  S   E+  L P  ++ +++ERE L I+K++QC  +FDFS+ +SD+K+K++K+ AL E+ ++ ++  GV+++ +Y E + M   N+FRTLPPS    G + D ++++P LE+SWPHLQ VYE+FLRF+ES +F  ++A+  ID  F+L ++DLFD EDPRERD+LKT+LHRIYGK + LRAFIRKQINN+FYR IYE E  NG AELLEILGSIINGF +PLK+EHK FL +VLLPLHK  SL V+  QL YC+++F++KD S LS  +++ LLK+WPKT S KE+M LNELEE L++ +  +FQ V   +F QI++C+ S HFQV ERAL +WNNE +  L   N  ++LP  FPAL   +K HWNKTIHGL++N LK+ M+I+Q+LFDEC+  +K++KQ E E   +  + W  V  +AK NP ++K A    D  P+++
Sbjct:  153 VLNITGTPIVRKEKRQTSARYNASKNCELTALIPLNEKTAASEREELFIQKIQQCCTLFDFSEPLSDLKFKEVKRAALHEMVDFLTNQNGVITEVIYPEAINMFAVNLFRTLPPSSNPNGAEFDPEEDEPTLESSWPHLQLVYELFLRFLESPDFQPSMAKRFIDHQFVLQLLDLFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNVFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKQFLLKVLLPLHKAKSLSVYHPQLTYCVVQFLEKDPS-LSEAVIKSLLKFWPKTHSPKEVMFLNELEELLDVIEPAEFQKVMVPLFRQIAKCVSSPHFQVAERALYYWNNEYIMSLITDNSAVILPIMFPALNRNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVESLAKTNPEWTK-ARRFNDCLPVSD 614          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Fly
Match: wrd (gene:FBgn0042693 transcript:FBtr0083553)

HSP 1 Score: 441.81 bits (1135), Expect = 1.269e-146
Identity = 236/464 (50.86%), Postives = 333/464 (71.77%), Query Frame = 2
Query:  233 ILNISKV----KDNRQFSSRFKISSFREIQEL-PSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPAL-YYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINE 1606
            +LNI+      K+ RQ S+R+  S   E+  L P  ++ +++ERE L I+K++QC  +FDFS+ +SD+K+K++K+ AL E+ ++ ++  GV+++ +Y E + M   N+FRTLPPS    G + D ++++P LE+SWPHLQ VYE+FLRF+ES +F  ++A+  ID  F+L ++DLFD EDPRERD+LKT+LHRIYGK + LRAFIRKQINN+FYR IYE E  NG AELLEILGSIINGF +PLK+EHK FL +VLLPLHK  SL V+  QL YC+++F++KD S LS  +++ LLK+WPKT S KE+M LNELEE L++ +  +FQ V   +F QI++C+ S HFQV ERAL +WNNE +  L   N  ++LP  FPAL   +K HWNKTIHGL++N LK+ M+I+Q+LFDEC+  +K++KQ E E   +  + W  V  +AK NP ++K A    D  P+++
Sbjct:  153 VLNITGTPIVRKEKRQTSARYNASKNCELTALIPLNEKTAASEREELFIQKIQQCCTLFDFSEPLSDLKFKEVKRAALHEMVDFLTNQNGVITEVIYPEAINMFAVNLFRTLPPSSNPNGAEFDPEEDEPTLESSWPHLQLVYELFLRFLESPDFQPSMAKRFIDHQFVLQLLDLFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNVFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKQFLLKVLLPLHKAKSLSVYHPQLTYCVVQFLEKDPS-LSEAVIKSLLKFWPKTHSPKEVMFLNELEELLDVIEPAEFQKVMVPLFRQIAKCVSSPHFQVAERALYYWNNEYIMSLITDNSAVILPIMFPALNRNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVESLAKTNPEWTK-ARRFNDCLPVSD 614          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Zebrafish
Match: ppp2r5d (protein phosphatase 2, regulatory subunit B', delta [Source:ZFIN;Acc:ZDB-GENE-040426-2568])

HSP 1 Score: 480.715 bits (1236), Expect = 4.826e-162
Identity = 272/568 (47.89%), Postives = 384/568 (67.61%), Query Frame = 2
Query:   50 STNSANSTAKRPVGK-RPEKPVITVTTKPTSNEIKPKPVEKLDLNVNSKKASAPTTKKPNIDILNISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELG---DDY--------PINEMTSENGK-KDVESALRDLELETQSNSNDMKKIRLM 1708
            ST ++N++A + VG    E+   T + +P+++   P  + K+      K +  P   K           K+ RQ SSRF +S  RE+Q+LP+ K+    +RE L ++KLRQC V+FDF +D +SD+KYK++K+  L E+ EY + N  V+++++Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKTILHRIYGK + LRA+IR+QINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  QLAYC+++F++KD+SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQKE    K+  + W  +  +AK+NP  +K+    G   ++Y        PI  M +E    +D++   + +E E      ++KK +++
Sbjct:   48 STKNSNASAGKDVGTDNSEEAQQTASKRPSNSTPPPTQLNKI------KYSGGPQIVK-----------KERRQSSSRFNLSKNRELQKLPALKDAPPIDREELFVQKLRQCCVLFDFVTDPLSDLKYKEVKRAGLNEMVEYITHNRDVVTESIYPEAVIMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLSLLELFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSSLTEPVIM-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPALYKNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKEKYKVKEREEMWHKIEALAKQNPQSTKVQLRPGLAQEEYMMYNEGGMPIYSMETETPTVEDIQLLKKTVESEASQGMKEIKKDKVL 597          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Zebrafish
Match: ppp2r5cb (protein phosphatase 2, regulatory subunit B', gamma b [Source:ZFIN;Acc:ZDB-GENE-041014-4])

HSP 1 Score: 465.307 bits (1196), Expect = 8.351e-157
Identity = 243/438 (55.48%), Postives = 328/438 (74.89%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLY 1561
            K+ R  SSRF +S+ RE+Q+LP F +V   E+E L ++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +F+ +K KE    K+  + W+ +  +AK NP +
Sbjct:   60 KEKRPNSSRFSLSNNRELQKLPVFTDVPPAEQEKLFVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKNKEKAKWKEREEAWIKIENLAKSNPQF 496          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Zebrafish
Match: ppp2r5eb (protein phosphatase 2, regulatory subunit B', epsilon isoform b [Source:ZFIN;Acc:ZDB-GENE-030904-6])

HSP 1 Score: 405.986 bits (1042), Expect = 3.140e-135
Identity = 224/420 (53.33%), Postives = 298/420 (70.95%), Query Frame = 2
Query:  302 EIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPL 1558
            E+  LP  K+VS+ E+  L ++KL+QC  VFDF D +SD+K K+ K+  L E+ +Y + + G L++  Y EVV MV  N+FRTLPPS +      + +     LEASWPHLQ VYE F+RF+ES EF  +IA+ +IDQ F+L +++LFD EDPRERDYLKT+LHRIYGK + LRAFIRKQINNIF R +YE E FNG AELLEILGSIINGF +PLK EHK FL +VL+PLH V SL +F AQLAYCI++F++KD +L   VI +GLLK+WPKT S KE+M L ELEE L++ +  QF  + + +F QISRC+ S HFQV ERAL +WNNE +  L  +N +++LP  F +LY  +K+HWN  I  LV+NVLK  M++N  LFDE T  +K D+Q+E + +K+  + W  + ++  K  L
Sbjct:   44 ELTPLPLLKDVSAQEQPELFLKKLQQCCAVFDFMDTLSDLKMKEYKRSTLNELVDYVTVSRGYLTEQAYPEVVKMVSYNIFRTLPPSDSNEFDPEEDEPT---LEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPALTEPVI-RGLLKFWPKTCSQKEVMFLGELEEILDVIEPTQFVKIQEPLFKQISRCVSSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFASLYRISKEHWNPAIVALVYNVLKAFMEMNSTLFDELTSTYKSDRQREKKKEKEREELWKRLEDLELKRSL 459          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Zebrafish
Match: ppp2r5ea (protein phosphatase 2, regulatory subunit B', epsilon isoform a [Source:ZFIN;Acc:ZDB-GENE-030904-7])

HSP 1 Score: 404.831 bits (1039), Expect = 9.546e-135
Identity = 228/454 (50.22%), Postives = 306/454 (67.40%), Query Frame = 2
Query:  182 VNSKKASAPTTKKPNIDILNISKVKDNRQFSSRFKISSFR------EIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWW 1522
            ++S   +AP+  K  +D  +   V+  RQ  ++   S FR      E+  LP  K+VS+ E+  L ++KL+QC  +FDF D +SD+K K+ K+  L E+ +Y + + G L++  Y EVV MV  N+FRTLPPS +      + +     LEASWPHLQ VYE F+RF+ES EF  + A+ +IDQ F+L +++LFD EDPRERD LKT+LHRIYGK + LRAFIRKQINNIF   +YE E FNG AELLEILGSIINGF +PLK EHK FL +VLLPLH V SL +F AQLAYCI++F++KD +L   VI +GLLK+WPKT S KE+M L ELEE L++ +  QF  + + +F QI+RC+ S HFQV ERAL +WNNE +  L  +N   +LP  F +LY  +K+HWN  I  L++NVLK  M++N  LFDE    +K D+Q+E +  K+  D W
Sbjct:    1 MSSAATTAPSVDK--VDGFSRKSVRKARQKRAQ-SSSQFRSQDKPIELVALPLLKDVSAQEQPELFLKKLQQCCTLFDFMDTLSDLKMKEYKRSTLNELVDYVTLSRGYLTEQTYPEVVKMVSYNIFRTLPPSDSNEFDPEEDEPT---LEASWPHLQLVYEFFIRFLESQEFQPSAAKKYIDQKFVLQLLELFDSEDPRERDCLKTVLHRIYGKFLGLRAFIRKQINNIFLCFVYETERFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLLPLHTVRSLSLFHAQLAYCIVQFLEKDPTLTEPVI-RGLLKFWPKTCSQKEVMFLGELEEILDVIEPTQFVKIQELLFKQIARCVSSPHFQVAERALYYWNNEYIMSLIEENCSAILPIMFASLYRISKEHWNPAISALIYNVLKAFMEMNSALFDELAASYKSDRQRERKKDKEREDLW 447          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Zebrafish
Match: ppp2r5ea (protein phosphatase 2, regulatory subunit B', epsilon isoform a [Source:ZFIN;Acc:ZDB-GENE-030904-7])

HSP 1 Score: 404.831 bits (1039), Expect = 9.546e-135
Identity = 228/454 (50.22%), Postives = 306/454 (67.40%), Query Frame = 2
Query:  182 VNSKKASAPTTKKPNIDILNISKVKDNRQFSSRFKISSFR------EIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWW 1522
            ++S   +AP+  K  +D  +   V+  RQ  ++   S FR      E+  LP  K+VS+ E+  L ++KL+QC  +FDF D +SD+K K+ K+  L E+ +Y + + G L++  Y EVV MV  N+FRTLPPS +      + +     LEASWPHLQ VYE F+RF+ES EF  + A+ +IDQ F+L +++LFD EDPRERD LKT+LHRIYGK + LRAFIRKQINNIF   +YE E FNG AELLEILGSIINGF +PLK EHK FL +VLLPLH V SL +F AQLAYCI++F++KD +L   VI +GLLK+WPKT S KE+M L ELEE L++ +  QF  + + +F QI+RC+ S HFQV ERAL +WNNE +  L  +N   +LP  F +LY  +K+HWN  I  L++NVLK  M++N  LFDE    +K D+Q+E +  K+  D W
Sbjct:    1 MSSAATTAPSVDK--VDGFSRKSVRKARQKRAQ-SSSQFRSQDKPIELVALPLLKDVSAQEQPELFLKKLQQCCTLFDFMDTLSDLKMKEYKRSTLNELVDYVTLSRGYLTEQTYPEVVKMVSYNIFRTLPPSDSNEFDPEEDEPT---LEASWPHLQLVYEFFIRFLESQEFQPSAAKKYIDQKFVLQLLELFDSEDPRERDCLKTVLHRIYGKFLGLRAFIRKQINNIFLCFVYETERFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLLPLHTVRSLSLFHAQLAYCIVQFLEKDPTLTEPVI-RGLLKFWPKTCSQKEVMFLGELEEILDVIEPTQFVKIQELLFKQIARCVSSPHFQVAERALYYWNNEYIMSLIEENCSAILPIMFASLYRISKEHWNPAISALIYNVLKAFMEMNSALFDELAASYKSDRQRERKKDKEREDLW 447          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Xenopus
Match: sds (serine dehydratase [Source:Xenbase;Acc:XB-GENE-921978])

HSP 1 Score: 470.315 bits (1209), Expect = 1.352e-158
Identity = 255/485 (52.58%), Postives = 348/485 (71.75%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIR 1702
            K+ RQ SSRF +S+ RE+Q+LP+ K+V   E+E L ++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +KQKE    K+  + W+ +  +AK NP Y         + P+   T     +DV+   + ++ E      D+KK R
Sbjct:   60 KEKRQSSSRFNVSNNRELQKLPALKDVPPAEQEKLFVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKQKEKLKLKEREEAWIKIENLAKSNPQYPMYTDTSALNSPVAMETDGPLLEDVQMLKKTVKEEASQAQKDLKKER 543          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Xenopus
Match: sds (serine dehydratase [Source:Xenbase;Acc:XB-GENE-921978])

HSP 1 Score: 469.929 bits (1208), Expect = 1.540e-158
Identity = 255/485 (52.58%), Postives = 348/485 (71.75%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIR 1702
            K+ RQ SSRF +S+ RE+Q+LP+ K+V   E+E L ++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +KQKE    K+  + W+ +  +AK NP Y         + P+   T     +DV+   + ++ E      D+KK R
Sbjct:   59 KEKRQSSSRFNVSNNRELQKLPALKDVPPAEQEKLFVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKQKEKLKLKEREEAWIKIENLAKSNPQYPMYTDTSALNSPVAMETDGPLLEDVQMLKKTVKEEASQAQKDLKKER 542          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Xenopus
Match: sds (serine dehydratase [Source:Xenbase;Acc:XB-GENE-921978])

HSP 1 Score: 468.389 bits (1204), Expect = 5.345e-158
Identity = 255/485 (52.58%), Postives = 348/485 (71.75%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIR 1702
            K+ RQ SSRF +S+ RE+Q+LP+ K+V   E+E L ++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +KQKE    K+  + W+ +  +AK NP Y         + P+   T     +DV+   + ++ E      D+KK R
Sbjct:   53 KEKRQSSSRFNVSNNRELQKLPALKDVPPAEQEKLFVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKQKEKLKLKEREEAWIKIENLAKSNPQYPMYTDTSALNSPVAMETDGPLLEDVQMLKKTVKEEASQAQKDLKKER 536          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Xenopus
Match: sds (serine dehydratase [Source:Xenbase;Acc:XB-GENE-921978])

HSP 1 Score: 459.914 bits (1182), Expect = 1.184e-155
Identity = 245/436 (56.19%), Postives = 330/436 (75.69%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNP 1555
            K+ RQ SSRF +S+ RE+Q+LP+ K+V   E+E L ++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +KQKE    K+  + W+ +  +AK NP
Sbjct:   59 KEKRQSSSRFNVSNNRELQKLPALKDVPPAEQEKLFVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKQKEKLKLKEREEAWIKIENLAKSNP 493          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Xenopus
Match: sds (serine dehydratase [Source:Xenbase;Acc:XB-GENE-921978])

HSP 1 Score: 459.914 bits (1182), Expect = 3.254e-155
Identity = 250/457 (54.70%), Postives = 338/457 (73.96%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSE 1618
            K+ RQ SSRF +S+ RE+Q+LP+ K+V   E+E L ++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +KQKE    K+  + W+ +  +AK NP   K   +L  + P+    SE
Sbjct:   55 KEKRQSSSRFNVSNNRELQKLPALKDVPPAEQEKLFVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKQKEKLKLKEREEAWIKIENLAKSNPQAQK---DLKKERPLVRRKSE 507          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Mouse
Match: Ppp2r5d (protein phosphatase 2, regulatory subunit B', delta [Source:MGI Symbol;Acc:MGI:2388481])

HSP 1 Score: 465.692 bits (1197), Expect = 1.009e-156
Identity = 255/488 (52.25%), Postives = 348/488 (71.31%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSEN-GKKDVESALRDLELETQSNSNDMKKIRLM 1708
            K+ RQ S  F ++  RE+Q+LP+ K+  + ERE L I+KLRQC V+FDF SD +SD+K K++K+  L E+ EY + +  V+++A+Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRA+IR+QIN+IFYR IYE E  NG AELLEILGSIINGF +PLK+EHKVFL RVLLPLHKV SL V+  QLAYC+++F++K++SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQK     K+  + W  + E+A+ NP Y    +      P+  M +E    +D++   R +E E      D+KK +++
Sbjct:   75 KERRQSSFPFNLNKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKCKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKVFLVRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIV-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARILPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLP-PVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKDKVL 560          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Mouse
Match: Ppp2r5d (protein phosphatase 2, regulatory subunit B', delta [Source:MGI Symbol;Acc:MGI:2388481])

HSP 1 Score: 465.692 bits (1197), Expect = 1.238e-156
Identity = 255/488 (52.25%), Postives = 348/488 (71.31%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSEN-GKKDVESALRDLELETQSNSNDMKKIRLM 1708
            K+ RQ S  F ++  RE+Q+LP+ K+  + ERE L I+KLRQC V+FDF SD +SD+K K++K+  L E+ EY + +  V+++A+Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRA+IR+QIN+IFYR IYE E  NG AELLEILGSIINGF +PLK+EHKVFL RVLLPLHKV SL V+  QLAYC+++F++K++SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQK     K+  + W  + E+A+ NP Y    +      P+  M +E    +D++   R +E E      D+KK +++
Sbjct:   76 KERRQSSFPFNLNKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKCKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKVFLVRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIV-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARILPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLP-PVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKDKVL 561          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Mouse
Match: Ppp2r5c (protein phosphatase 2, regulatory subunit B', gamma [Source:MGI Symbol;Acc:MGI:1349475])

HSP 1 Score: 436.032 bits (1120), Expect = 4.118e-146
Identity = 239/461 (51.84%), Postives = 328/461 (71.15%), Query Frame = 2
Query:  326 KEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIR 1702
            ++V   ++E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  + + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +K KE    K+  + WV +  +AK NP Y+  +       P+   T     +DV+   + +  E +    ++KK R
Sbjct:   31 RDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEAVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYAVYSQASAVSIPVAMETDGPQFEDVQMLKKTVSDEARQAQKELKKDR 490          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Mouse
Match: Ppp2r5c (protein phosphatase 2, regulatory subunit B', gamma [Source:MGI Symbol;Acc:MGI:1349475])

HSP 1 Score: 432.95 bits (1112), Expect = 1.870e-145
Identity = 243/458 (53.06%), Postives = 328/458 (71.62%), Query Frame = 2
Query:  326 KEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSE-----NGKKDVESALRDLELETQSN 1678
            ++V   ++E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  + + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +K KE    K+  + WV +  +AK NP   K   EL  D P+    SE     + +K +E+  R  EL +Q  
Sbjct:   31 RDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEAVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQK---ELKKDRPLVRRKSELPQDPHTEKALEAHCRASELLSQDG 484          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Mouse
Match: Ppp2r5c (protein phosphatase 2, regulatory subunit B', gamma [Source:MGI Symbol;Acc:MGI:1349475])

HSP 1 Score: 431.409 bits (1108), Expect = 9.934e-145
Identity = 235/440 (53.41%), Postives = 319/440 (72.50%), Query Frame = 2
Query:  326 KEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVE 1639
            ++V   ++E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  + + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +K KE    K+  + WV +  +AK NP Y+  +       P+   T     +DV+
Sbjct:   31 RDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEAVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYAVYSQASAVSIPVAMETDGPQFEDVQ 469          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. UniProt/SwissProt
Match: sp|Q28653|2A5D_RABIT (Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Oryctolagus cuniculus OX=9986 GN=PPP2R5D PE=2 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 6.070e-159
Identity = 257/488 (52.66%), Postives = 351/488 (71.93%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSEN-GKKDVESALRDLELETQSNSNDMKKIRLM 1708
            K+ RQ SSRF +S  RE+Q+LP+ K+  + ERE L I+KLRQC V+FDF SD +SD+K+K++K+  L E+ EY + +  V+++A+Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRA+IR+QIN+IFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  QLAYC+++F++K++SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQK     K+  + W  + E+A+ NP Y    +      P+  M +E    +D++   R +E E      D+KK +++
Sbjct:   67 KERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIV-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLP-PVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVL 552          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. UniProt/SwissProt
Match: sp|Q14738|2A5D_HUMAN (Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 1.761e-158
Identity = 257/488 (52.66%), Postives = 351/488 (71.93%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSEN-GKKDVESALRDLELETQSNSNDMKKIRLM 1708
            K+ RQ SSRF +S  RE+Q+LP+ K+  + ERE L I+KLRQC V+FDF SD +SD+K+K++K+  L E+ EY + +  V+++A+Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRA+IR+QIN+IFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  QLAYC+++F++K++SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQK     K+  + W  + E+A+ NP Y    +      P+  M +E    +D++   R +E E      D+KK +++
Sbjct:   83 KERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIV-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLP-PVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVL 568          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. UniProt/SwissProt
Match: sp|Q28651|2A5G_RABIT (Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Oryctolagus cuniculus OX=9986 GN=PPP2R5C PE=2 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 2.038e-145
Identity = 242/461 (52.49%), Postives = 328/461 (71.15%), Query Frame = 2
Query:  326 KEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIR 1702
            ++V   ++E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  + + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +K KE    K+  + WV +  +AK NP YS  +       P+   T     +DV+   + +  E +    D KK R
Sbjct:   31 RDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYSLCSHASTVSMPLAMETDGPLFEDVQMLRKTVSDEARQAQKDPKKER 490          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. UniProt/SwissProt
Match: sp|Q13362|2A5G_HUMAN (Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3)

HSP 1 Score: 436.417 bits (1121), Expect = 2.152e-145
Identity = 241/461 (52.28%), Postives = 328/461 (71.15%), Query Frame = 2
Query:  326 KEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIR 1702
            ++V   ++E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  + + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +K KE    K+  + WV +  +AK NP Y+  +       P+   T     +DV+   + ++ E      D KK R
Sbjct:   31 RDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDR 490          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. UniProt/SwissProt
Match: sp|Q60996|2A5G_MOUSE (Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Mus musculus OX=10090 GN=Ppp2r5c PE=1 SV=2)

HSP 1 Score: 436.032 bits (1120), Expect = 2.881e-145
Identity = 239/461 (51.84%), Postives = 328/461 (71.15%), Query Frame = 2
Query:  326 KEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIR 1702
            ++V   ++E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  + + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +FK +K KE    K+  + WV +  +AK NP Y+  +       P+   T     +DV+   + +  E +    ++KK R
Sbjct:   31 RDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEAVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYAVYSQASAVSIPVAMETDGPQFEDVQMLKKTVSDEARQAQKELKKDR 490          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. TrEMBL
Match: A0A0L8HHQ1 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22014251mg PE=4 SV=1)

HSP 1 Score: 483.797 bits (1244), Expect = 1.437e-161
Identity = 269/514 (52.33%), Postives = 361/514 (70.23%), Query Frame = 2
Query:  191 KKASA------PTTKKPNIDILNISKVK-DNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINE----------MTSENGKKDVESALRDLELETQSN 1678
            KKASA      PTT+   I     + +K D RQ SSRF +S  RE+Q+L   ++    ERE L I+K++QC V+FDF  D +SD+K+K++K+ AL E+ EY S N G+L++ +Y E + M   N+FRTLPPS   +G + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKTILHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHKVFL +VLLPLHKV SL V+  QLAYC+++F++KD SL   VI+  LLK+WPK  S KE+M LNELEE L++ +  +F  V + +F Q+S+C+ S HFQV ERAL FWNNE +  L  +N+ ++LP  FPALY +K+HWNKTIHGL++N LK+ M+INQKLFDECT+++K ++QKE E  K+  D W T+  +A  NP + K+  +   D   N           ++ E G  DV ++L  LE E  ++
Sbjct:    4 KKASANTENHPPTTQLTKIKYSGPAHIKKDKRQNSSRFSVSKNRELQKLTPMRDAPLTEREQLFIQKIQQCGVLFDFVQDPLSDLKWKEVKRAALNEMVEYVSQNRGILTEHIYPEAIQMFAGNLFRTLPPSSNPSGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFVPNIAKRYIDQKFVLQLLELFDSEDPRERDFLKTILHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKVFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDPSLTEPVIM-TLLKFWPKVHSPKEVMFLNELEEILDVIEPGEFVKVVQPLFRQLSKCVSSPHFQVAERALYFWNNEYILSLINENVAVILPIMFPALYMSKEHWNKTIHGLIYNALKLFMEINQKLFDECTIQYKAERQKEKERNKQRDDAWNTLQNLAMTNPKFGKVLHKSSSDSVSNPENNGHSNPNCVSEEEG--DVVASLDKLESEVHAD 514          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. TrEMBL
Match: A0A0L8HHR6 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22014251mg PE=4 SV=1)

HSP 1 Score: 483.411 bits (1243), Expect = 1.498e-161
Identity = 269/513 (52.44%), Postives = 360/513 (70.18%), Query Frame = 2
Query:  191 KKASA------PTTKKPNIDILNISKVK-DNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINE----------MTSENGKKDVESALRDLELETQS 1675
            KKASA      PTT+   I     + +K D RQ SSRF +S  RE+Q+L   ++    ERE L I+K++QC V+FDF  D +SD+K+K++K+ AL E+ EY S N G+L++ +Y E + M   N+FRTLPPS   +G + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKTILHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHKVFL +VLLPLHKV SL V+  QLAYC+++F++KD SL   VI+  LLK+WPK  S KE+M LNELEE L++ +  +F  V + +F Q+S+C+ S HFQV ERAL FWNNE +  L  +N+ ++LP  FPALY +K+HWNKTIHGL++N LK+ M+INQKLFDECT+++K ++QKE E  K+  D W T+  +A  NP + K+  +   D   N           ++ E G  DV ++L  LE E  +
Sbjct:    4 KKASANTENHPPTTQLTKIKYSGPAHIKKDKRQNSSRFSVSKNRELQKLTPMRDAPLTEREQLFIQKIQQCGVLFDFVQDPLSDLKWKEVKRAALNEMVEYVSQNRGILTEHIYPEAIQMFAGNLFRTLPPSSNPSGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFVPNIAKRYIDQKFVLQLLELFDSEDPRERDFLKTILHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKVFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDPSLTEPVIM-TLLKFWPKVHSPKEVMFLNELEEILDVIEPGEFVKVVQPLFRQLSKCVSSPHFQVAERALYFWNNEYILSLINENVAVILPIMFPALYMSKEHWNKTIHGLIYNALKLFMEINQKLFDECTIQYKAERQKEKERNKQRDDAWNTLQNLAMTNPKFGKVLHKSSSDSVSNPENNGHSNPNCVSEEEG--DVVASLDKLESEVHA 513          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. TrEMBL
Match: A0A1S3HSW8 (Serine/threonine protein phosphatase 2A regulatory subunit OS=Lingula unguis OX=7574 GN=LOC106157885 PE=3 SV=1)

HSP 1 Score: 485.723 bits (1249), Expect = 3.362e-161
Identity = 259/476 (54.41%), Postives = 351/476 (73.74%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGD-DYPINEMTSENGKK-DVESALRDLELETQ 1672
            KD RQ SSRF IS  RE+Q+LP  K+ +  ERE L ++K+RQC V+FDF  D +SD+K+K++K+ AL E+ EY   N GV++DA+Y E + M  +N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N A+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHKVFL +VLLPLHKV SL V+  QLAYC+++F++KD SL   VI+ GLLK+WPK  S KE+M LNELEE L++ +  +F  +   +F ++++C+ S HFQV ERAL +WNNE +  L   N+  +LP  FPALY  KQHWNKTIHGL++N LK+ M++NQKLFD+CT ++K ++QKE E  K+  D WV +  +A+ NP Y K+A +  + + P++ + ++ G   +++ +L  LE E +
Sbjct:   69 KDKRQSSSRFNISKNRELQKLPMLKDATPAEREDLFVQKIRQCCVMFDFVQDPLSDLKWKEVKRAALNEMVEYVQQNRGVITDAIYPECIQMFSSNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNTAKRYIDQKFVLQLLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRKQINNIFYRFIYETERHNGIAELLEILGSIINGFALPLKEEHKVFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDPSLTEPVIM-GLLKFWPKVHSPKEVMFLNELEEILDVIEPAEFTKIMVPLFKRLAKCVSSPHFQVAERALYYWNNEYILSLISDNVQTILPIMFPALYRTKQHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAERQKEKEKLKEREDAWVKLQGLAQVNPQYKKVAIKADNSNRPVDALMNDEGDPTELDMSLDKLETEAR 543          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. TrEMBL
Match: A0A293N0H5 (Protein phosphatase 2A B56 regulatory subunit gamma 3 isoform (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 6.583e-161
Identity = 262/496 (52.82%), Postives = 354/496 (71.37%), Query Frame = 2
Query:  239 NISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINE--------MTSENGKKDVESALRDLELETQSNSNDMKK 1696
            N +  KD RQ SSRF +S  RE+Q+LP+ K+ +S ERE LL++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY +S  GVL++A+Y EVV M   NVFRTLPPS    G + D ++++P LEA+WPHLQ VYE+FLRF+ES +F  N+A+ HIDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA++RKQINN+FYR IYE E  NG AELLEILGSIINGF +PLK+EHKVFL +VL+PLHKV SL V+  QLAYC+++F++KD SL   VIL  LLK+WPK  S KE+M LNELEE L++ +  +F  V   +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTI+GL++N LK+ M++NQKLFDEC   +K+++Q E    ++  D W  +  +A+KNP + ++AS+L    P+N          T+++  +D +     LE E +  S  M K
Sbjct:   42 NPAVRKDKRQNSSRFNVSHNRELQKLPALKDAASAEREDLLVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALHEMVEYITSQRGVLTEAIYPEVVHMFSVNVFRTLPPSSNPNGAEFDPEEDEPTLEAAWPHLQLVYELFLRFLESPDFQPNVAKRHIDQRFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYVRKQINNMFYRFIYETEHHNGVAELLEILGSIINGFALPLKEEHKVFLLKVLMPLHKVKSLSVYHPQLAYCVVQFLEKDPSLTEPVIL-TLLKFWPKVHSPKEVMFLNELEEILDVIEPAEFAKVMVPLFRQLAKCVASPHFQVAERALYYWNNEYIMSLISDNAAHILPIMFPALYKNSKSHWNKTIYGLIYNALKLFMEMNQKLFDECVQTYKQERQNEKMRLREREDAWTKIEVLAEKNPQFQQVASQLQ---PLNSSSGSSSGVQTNDSPPEDDDMIYDKLETEAKEASRQMAK 533          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. TrEMBL
Match: A0A2T7NZ14 (Serine/threonine protein phosphatase 2A regulatory subunit OS=Pomacea canaliculata OX=400727 GN=C0Q70_14087 PE=3 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 1.215e-160
Identity = 255/478 (53.35%), Postives = 348/478 (72.80%), Query Frame = 2
Query:  179 NVNSKKASAPTTKKPNIDI----LNISKVK---------DNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKI 1570
            NV+++ A   T++ PN +      +ISK+K         D RQ SSRF +S  RE+Q+LP  K+ +  ERE L I+K+RQC+V+FDF  D +SD+K+K++K+ AL E+ EY + N GV+++A+Y EV+ M   N+FRTLPPS   +G + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N A+ +IDQ F+L ++DLFD EDPRERD+LKTILHRIYGK + LRAFIRK INNIFY  IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  QLAYC+++F++KD SL   VI+ GLLK+WPK  S KE+M LNELEE L++ +  +F  V   +F Q+++C+ S HFQV ERAL FWNNE +  L   ++  ++P  FPALY +K+HWNKTIHGL++N LK+ M++NQKLFD+CT ++K ++QKE E  K+  + W  ++ +A+ NP +  +
Sbjct:   28 NVDNETAKRKTSQTPNAETHPPPSSISKLKYQGPPHIKKDKRQNSSRFNVSKNRELQKLPLLKDATPAEREELFIQKIRQCTVLFDFVQDPLSDLKWKEVKRAALNEMVEYVTQNRGVITEAIYPEVIQMYACNLFRTLPPSSNPSGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNTAKRYIDQKFVLQLLDLFDSEDPRERDFLKTILHRIYGKFLGLRAFIRKHINNIFYSFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLRVLLPLHKVKSLSVYHPQLAYCVVQFLEKDPSLTEQVIM-GLLKFWPKVHSPKEVMFLNELEEILDVIEPAEFTKVMVPLFKQLAKCVSSPHFQVAERALYFWNNEYILSLISDSVASIMPIMFPALYKSKEHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAERQKEKEKSKQRDEAWNRISSLAQDNPQWENV 504          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Cavefish
Match: ppp2r5d (protein phosphatase 2, regulatory subunit B', delta [Source:ZFIN;Acc:ZDB-GENE-040426-2568])

HSP 1 Score: 471.085 bits (1211), Expect = 5.647e-160
Identity = 247/436 (56.65%), Postives = 330/436 (75.69%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNP 1555
            K+ RQ SSRF +S  RE+Q+LP+ K+    +RE L ++KLRQC V+FDF +D +SD+KYK++K+  L E+ EY + N  V+++++Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKTILHRIYGK + LRA+IR+QINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  QLAYC+++F++KD+SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQKE    K+  + W  + E+AK+NP
Sbjct:   44 KERRQSSSRFNLSKNRELQKLPALKDAPPIDREELFVQKLRQCCVLFDFVTDPLSDLKYKEVKRAGLNEMVEYITHNRDVVTESIYPEAVIMFSMNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLSLLELFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSSLTEPVIM-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPALYKNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKEKYKLKEREEIWHKIEELAKQNP 478          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Cavefish
Match: ppp2r5cb (serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform-like [Source:NCBI gene;Acc:103025090])

HSP 1 Score: 471.085 bits (1211), Expect = 3.610e-159
Identity = 253/485 (52.16%), Postives = 344/485 (70.93%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIR 1702
            K+ RQ SSRF +S+ RE+Q+LP+FK+V   E+E L ++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F++ +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +F+ +K KE    K+  + W+ +  +AK NP +           P+   T      DV    + +E E      D +K R
Sbjct:   62 KEKRQSSSRFSLSNNRELQKLPAFKDVPPAEQEKLFVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAINMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQRFVMQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKNKEKMKWKEREEAWIKIENLAKSNPQFLMYIDSSSLSSPMEIETDGTMMDDVMMLKKTVEEEATPIQRDQRKER 545          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Cavefish
Match: ppp2r5cb (serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform-like [Source:NCBI gene;Acc:103025090])

HSP 1 Score: 469.159 bits (1206), Expect = 5.976e-159
Identity = 244/436 (55.96%), Postives = 330/436 (75.69%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNP 1555
            K+ RQ SSRF +S+ RE+Q+LP+FK+V   E+E L ++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F++ +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +F+ +K KE    K+  + W+ +  +AK NP
Sbjct:   62 KEKRQSSSRFSLSNNRELQKLPAFKDVPPAEQEKLFVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAINMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQRFVMQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKNKEKMKWKEREEAWIKIENLAKSNP 496          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Cavefish
Match: ENSAMXT00000036192.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:4458162:4486163:1 gene:ENSAMXG00000020244.2 transcript:ENSAMXT00000036192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 459.144 bits (1180), Expect = 5.847e-155
Identity = 243/448 (54.24%), Postives = 330/448 (73.66%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDD 1591
            ++ R   S F IS+ RE+ +L +FK+VS  E+E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F++ +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +F+ +K KE    K+  + W+ +  +AK NP    +  E+  D
Sbjct:   31 REKRLSISCFPISTNRELHKLSAFKDVSPAEQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVMQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPALYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKNKERAKLKEREEAWIKIENLAKSNPQVRLLPVEMETD 477          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Cavefish
Match: ENSAMXT00000031308.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:4456212:4486163:1 gene:ENSAMXG00000020244.2 transcript:ENSAMXT00000031308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 459.144 bits (1180), Expect = 8.276e-155
Identity = 245/458 (53.49%), Postives = 335/458 (73.14%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSEN 1621
            ++ R   S F IS+ RE+ +L +FK+VS  E+E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F++ +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +F+ +K KE    K+  + W+ +  +AK NP +       G + P+ EM ++ 
Sbjct:   39 REKRLSISCFPISTNRELHKLSAFKDVSPAEQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVMQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPALYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKNKERAKLKEREEAWIKIENLAKSNPQFLMYVDSSGLNSPV-EMETDG 494          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Sea Lamprey
Match: PPP2R5C (protein phosphatase 2 regulatory subunit B'gamma [Source:HGNC Symbol;Acc:HGNC:9311])

HSP 1 Score: 464.537 bits (1194), Expect = 1.392e-157
Identity = 240/438 (54.79%), Postives = 329/438 (75.11%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLY 1561
            K+ RQ SS F +S  RE+Q+LP+ K+ S+ ERE L ++KL+QC V+FDF SD +SD+K+K++K+ AL E+ EY + + GV+++ +Y EVV +   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F++ ++DLFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHKVFL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  L+K+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FP+LY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K ++Q+E    K   + W  +  +AK NP Y
Sbjct:   33 KEKRQSSSHFNVSKDRELQKLPALKDASAAEREELFVQKLQQCCVLFDFVSDPLSDLKWKEVKRAALNEMVEYITHSRGVITEPIYPEVVHVFSVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVMQLLDLFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKVFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALMKFWPKTHSPKEVMFLNELEEILDVIEPAEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLVSDNAAKILPVMFPSLYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAERQQEKLKLKDRDEAWTKIESLAKTNPQY 469          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Sea Lamprey
Match: PPP2R5C (protein phosphatase 2 regulatory subunit B'gamma [Source:HGNC Symbol;Acc:HGNC:9311])

HSP 1 Score: 461.455 bits (1186), Expect = 4.242e-156
Identity = 242/441 (54.88%), Postives = 331/441 (75.06%), Query Frame = 2
Query:  239 NISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNP 1555
            NI K K+ RQ SSRF ++  RE+Q+LP+ K+    ERE L ++KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + + GV+++ +Y EVV +   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F+L +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHKVFL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++ GLLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K ++QK+   + +       ++ +A+ +P
Sbjct:   56 NIVK-KEKRQSSSRFNVTKNRELQKLPALKDAPPGEREELFVQKLRQCCVLFDFVSDPLSDLKWKEVKRAALNEMVEYITHSRGVITEPIYPEVVHVFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKVFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-GLLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLVSDNAAKILPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAERQKQARGQVRGGSCRTQMSTLARCDP 494          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009244.1 (pep scaffold:Pmarinus_7.0:GL476614:294291:304031:1 gene:ENSPMAG00000008342.1 transcript:ENSPMAT00000009244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 420.624 bits (1080), Expect = 1.505e-142
Identity = 223/417 (53.48%), Postives = 301/417 (72.18%), Query Frame = 2
Query:  329 EVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIAS 1576
            +V++ E+  L ++KL+QC V+FDF D +SD+K K+IK+ AL E+ +Y ++  G+LS+AVY ++V M+  N+FRTLPPS        + +     LEASWPHLQ VYE+FLRF+E+ EF  +IA+ +IDQ F+L ++DLFD EDPRERD+LKT+LHRIYGK + LRAFIRKQINNIF R IYE E FNG  ELLEILGSIINGF +PLK EHK FL +VL+PLH    L +F AQLAYC+++F++KD +L   VI +GLLKYWPKT S KE+M L E EE L++ +  QF  V + +F QI++C+ S HFQV ERAL +WNNE +  L  +N +++LP  FP LY  +K+HWN+TI  LV+NVLK  M++N +LFDE T  FK D+Q+E + +K   D W  + E+  +N   +KI +
Sbjct:    1 DVAALEQPELFVKKLQQCCVIFDFMDSVSDLKGKEIKRAALNELVDYITTGRGILSEAVYPDMVRMIAGNIFRTLPPSDNPEFDPEEDEPT---LEASWPHLQIVYEIFLRFLENQEFQPSIAKKYIDQKFVLQLLDLFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFIRFIYETEHFNGVGELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTAKGLSLFHAQLAYCVVQFLEKDATLTEPVI-RGLLKYWPKTCSQKEVMFLGEAEEILDVIEPSQFVKVQEALFKQIAKCVASPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFPNLYRISKEHWNQTIVALVYNVLKSFMEMNSQLFDELTASFKADRQREKKKEKDREDLWKKLEELELRNAQNNKILA 413          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004802.1 (pep scaffold:Pmarinus_7.0:GL477853:33619:54992:1 gene:ENSPMAG00000004280.1 transcript:ENSPMAT00000004802.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 392.889 bits (1008), Expect = 6.395e-131
Identity = 216/430 (50.23%), Postives = 308/430 (71.63%), Query Frame = 2
Query:  266 QFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKN 1552
            Q SS+F+  +  E+  LP+  +  ++E+E L  +KL+QC V+FDF D +SD+K K+IK+ AL E+ +Y ++  GVL+++VY +++ MV  N+FRTLPPS     P+ D ++++P LEASWPHLQ VYE FLRF+E  EF  +IA+ +IDQ F+L +++LFD EDPRERD+L+T+LHRIYGK++ LRAFIR QINNI  R IYE E FNG  E+LEILGSII+GF +PLK EHK FL RVLLPLH    L +F AQLAYC++ F++KD +L  +V+ +GLLKYWPKT S KE+M L E+EE L++ +  QF  + + +F QISRC+ S H  V E AL +WNN+ +  L  +N +++LP  F  LY  +++HWN+TI GL FNV+K MMD+N +LF E T  +  ++Q+E + +++  + W  + ++  KN
Sbjct:   30 QGSSQFRTRAHLELAPLPALADTPASEQEELFCKKLQQCCVIFDFLDSVSDLKGKEIKRAALNELVDYITAGRGVLTESVYPDIIRMVAYNIFRTLPPS---ENPEFDPEEDEPTLEASWPHLQIVYEFFLRFLEQQEFQPSIAKKYIDQKFVLQLLELFDSEDPRERDFLRTVLHRIYGKLLGLRAFIRTQINNILLRYIYETERFNGVGEMLEILGSIIDGFALPLKTEHKQFLVRVLLPLHTARGLSIFHAQLAYCVMLFLEKDATLAEIVV-RGLLKYWPKTCSQKEVMFLGEVEEVLDVIEPTQFVKIQEPLFKQISRCVASPHLHVAEHALYYWNNKYILSLIEENSNVILPIMFGNLYKMSEEHWNQTILGLNFNVMKTMMDMNCELFGELTESYNNERQREKKKEEEREELWKKLEDLELKN 455          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004256.1 (pep scaffold:Pmarinus_7.0:GL484287:17817:24558:-1 gene:ENSPMAG00000003872.1 transcript:ENSPMAT00000004256.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 1.314e-58
Identity = 120/228 (52.63%), Postives = 162/228 (71.05%), Query Frame = 2
Query:  860 RQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEV 1540
            R IYE E FNG AELLEILGSIINGF +PLK EHK FL +VLLPLH V  L +F AQLAYC+++F++KD  L   VI + LLK+WPKT S KE+M L ELEE L++ +  QF  + + +F QI++C+ S HFQV ERA+ +WNNE +  L  +NI  +LP  F +LY  +K+HWN+TI  LV+N+LK  M++N KLFDE T  +K ++Q+E + +K+  D W  + E+
Sbjct:    4 RFIYETEHFNGVAELLEILGSIINGFAMPLKSEHKQFLVKVLLPLHTVKVLSLFHAQLAYCVVQFLEKDPQLTEPVI-RALLKFWPKTCSQKEVMFLGELEEILDVIESNQFVKIQEPLFRQIAKCVSSPHFQVAERAMYYWNNEYILGLMEENISTILPIVFGSLYRVSKEHWNQTIVALVYNILKTFMEMNSKLFDELTASYKAERQRERKREKEREDLWQRLEEL 230          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Yeast
Match: RTS1 (B-type regulatory subunit of protein phosphatase 2A (PP2A); Rts1p and Cdc55p are alternative regulatory subunits for PP2A catalytic subunits, Pph21p and Pph22p; PP2A-Rts1p protects cohesin when recruited by Sgo1p to the pericentromere; highly enriched at centromeres in the absence of Cdc55p; required for maintenance of septin ring organization during cytokinesis, for ring disassembly in G1 and for dephosphorylation of septin, Shs1p; homolog of the mammalian B' subunit of PP2A [Source:SGD;Acc:S000005540])

HSP 1 Score: 358.992 bits (920), Expect = 2.352e-114
Identity = 209/479 (43.63%), Postives = 295/479 (61.59%), Query Frame = 2
Query:  191 KKASAPTTKKPNIDILNISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQH---------------------------WNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAK 1546
            ++   PT   P+ D+  I   +  R  SSRF+ S +  + +LP+F EVS  ER  L I K+ QC+ +FDF+D   DI+ K+IK+  L E+ E+  +N    ++ +Y  VV M   N+FR +PP     G   D D+++P  E +WPH+Q VYE FLRFVES +F+  IA+ +IDQ+FIL +++LFD ED RERD LKT LHRIYGK ++LR+FIR+ +NNIF + IYE E FNG AELLEILGSIINGF +PLK+EHKVFL R+L+PLHKV  L ++  QLAYCI++F++KD  LL+  ++ GLL+YWPK  S KEIM LNE+E+  E+ +  +F  V   +F Q+++CI S HFQV E+ L +WNNE    L ++N  ++LP  FPALY                                WN+ IH + F  LKI ++ N  L++ C   +    ++  + K +  + W  + E  K
Sbjct:  238 ERLPTPTKLNPDTDLELIKTPQ--RHSSSRFEPSRYTPLTKLPNFNEVSPEERIPLFIAKVDQCNTMFDFNDPSFDIQGKEIKRSTLDELIEFLVTNRFTYTNEMYAHVVNMFKINLFRPIPPPVNPVGDIYDPDEDEPVNELAWPHMQAVYEFFLRFVESPDFNHQIAKQYIDQDFILKLLELFDSEDIRERDCLKTTLHRIYGKFLSLRSFIRRSMNNIFLQFIYETEKFNGVAELLEILGSIINGFALPLKEEHKVFLVRILIPLHKVRCLSLYHPQLAYCIVQFLEKD-PLLTEEVVMGLLRYWPKINSTKEIMFLNEIEDIFEVIEPLEFIKVEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVILPIIFPALYELTSQLELDTANGEDSISDPYMLVEQAINSGSWNRAIHAMAFKALKIFLETNPVLYENCNALYLSSVKETQQRKVQREENWSKLEEYVK 713          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Nematostella
Match: EDO30733 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZY8])

HSP 1 Score: 409.068 bits (1050), Expect = 6.625e-138
Identity = 212/383 (55.35%), Postives = 289/383 (75.46%), Query Frame = 2
Query:  344 ERESLLIEKLRQCSVVFDFS-DLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQK 1486
            ERE+L ++K++QC V+FDF+ D +SD+KYK++K+  L E+ ++ + N G++++ +Y E + M   N FR LPP     G + D ++++P LEASWPHLQ VYE FLRF+ES +F  ++A+ H+DQ F+L +++LFD EDPRERD+LKTILHRIYGK + LRAFIRK INNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHKVFL +VL+PLHK  SLG++  QLAYC+++F++KD  L   V++  LLK+WPK  S KE+M LNELEE L++ +  +F  + + +F Q+++C+ S HFQV ERAL +WNNE +  L   N  I+LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFDECT ++K +K K
Sbjct:   26 EREALFVQKVQQCCVIFDFAVDPLSDLKYKEVKRATLNELVDFVTHNKGIITEPIYMEAIRMFSLNTFRALPPPSNPNGAEFDPEEDEPNLEASWPHLQIVYEFFLRFLESTDFQPSMAKKHVDQKFVLQLLELFDSEDPRERDFLKTILHRIYGKFLGLRAFIRKYINNIFYRFIYETERHNGVAELLEILGSIINGFALPLKEEHKVFLMKVLMPLHKTKSLGMYHPQLAYCVVQFLEKDPGLTESVVM-SLLKFWPKVHSPKEVMFLNELEEILDVIEPTEFVKIIEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNATIILPLMFPALYKNSKNHWNKTIHGLIYNALKLFMEMNQKLFDECTQQYKAEKLK 407          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Nematostella
Match: EDO48646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJB0])

HSP 1 Score: 404.831 bits (1039), Expect = 1.882e-134
Identity = 228/434 (52.53%), Postives = 301/434 (69.35%), Query Frame = 2
Query:  272 SSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQH-----VYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQ----------IYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXX-XXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALY-YAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWW 1522
            SSRF+  +  EIQ L   K+    E++ L I+KL+QC +VFDF D + ++K K+IK+  L E+ +Y +S  GVL++ VY E+V MV  N+FRTLPPS        + D     LEASWPHLQ      VYE FLRF+ES EF  +IA+  IDQ F+L +++LFD EDPRERD+LKT+LHRIYGK + LRA+IRKQINNIF             ++E E FNG  ELLEILGSIINGF +PLK EHK FL+RVL+PLHKV  LG++ AQLAYCI++F++KD +L   VIL GLL+YWPKT S KE+  L  E+EE L+++D  QFQ + + +F QI++C+ S HFQV ERAL FWNNE +  L  +N +++LP  F +LY  +K HWN+TI  LV+NVLK  M++N KLFDE T  +K D+QKE + +K+  + W
Sbjct:   46 SSRFRTKAITEIQPLNLLKDTPPVEQQELFIQKLQQCCIVFDFMDAVGELKGKEIKRATLNELVDYVTSGRGVLTENVYPEIVKMVACNIFRTLPPSENPDFDPEEDDPT---LEASWPHLQASSSNLVYEFFLRFLESPEFQPSIAKKFIDQKFVLQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAYIRKQINNIFLNMLGGRKSVGTFVFETEHFNGVGELLEILGSIINGFALPLKAEHKQFLKRVLIPLHKVKCLGLYHAQLAYCIVQFLEKDAALTDEVIL-GLLRYWPKTSSQKEVSILQAEIEEILDVNDPAQFQKIEEALFKQIAKCVSSPHFQVAERALYFWNNEYIMSLIEENSNVILPIMFSSLYRISKDHWNQTIVALVYNVLKTFMEMNGKLFDELTSSYKADRQKEKKKEKERDELW 475          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Nematostella
Match: EDO30734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZZ0])

HSP 1 Score: 176.792 bits (447), Expect = 1.564e-50
Identity = 107/265 (40.38%), Postives = 163/265 (61.51%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFS-DLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDL-FDCEDPRERDY---LKTILHRIYGKMITLRAFIRKQIN-NIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQ 1030
            K+ R  SS F IS  RE+ +LP  K+  + ERE+L ++K++QC V+FDF+ D +SD+KYK++K+  L E+ ++ + N G++++ +Y E + M   N FR LPP     G + D ++++P LEASWPHLQ   +  L+ ++       I +   D++ I  ++ + +D +   +RD+    K +L       + L   +    N +I  R IYE E  NG AELLEILGSIINGF +PLK+EHKVFL +VL+PLHK  SLG++  Q
Sbjct:   20 KEKRHSSSTFHISDNRELVKLPLLKDCPAPEREALFVQKVQQCCVIFDFAVDPLSDLKYKEVKRATLNELVDFVTHNKGIITEPIYMEAIRMFSLNTFRALPPPSNPNGAEFDPEEDEPNLEASWPHLQLTVQYDLQTIQYKCLYYRITK--CDRSNICTLLTVRYDSQTIYQRDFEGFSKNVLIIHVRPTLGLEFMMCSCYNYSISPRFIYETERHNGVAELLEILGSIINGFALPLKEEHKVFLMKVLMPLHKTKSLGMYHPQ 282          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Medaka
Match: ppp2r5cb (serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform [Source:NCBI gene;Acc:101169753])

HSP 1 Score: 470.315 bits (1209), Expect = 7.018e-159
Identity = 252/481 (52.39%), Postives = 342/481 (71.10%), Query Frame = 2
Query:  179 NVNSKKASAPTT-----KKPNIDILNISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPI 1600
            N  S  ++ PTT     K+P       S  KD R  S+RF +S+ RE+Q+LP+F++V   E E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F++ ++DLFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFY  IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L    ++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +F+ +K KE    K+  + W+ +  +AK NP +      +G   P+
Sbjct:   32 NRKSGNSAPPTTQLLKGKQPGS---QTSAKKDKRPNSTRFSLSNNRELQKLPAFEDVPPEEEEKLFIQKLRQCCVLFDFISDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFSVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVMQLLDLFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYTFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPTVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKSKEKAKWKEREEAWIKIENLAKSNPQFLVYVEPVGPGSPM 508          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Medaka
Match: ppp2r5cb (serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform [Source:NCBI gene;Acc:101169753])

HSP 1 Score: 469.929 bits (1208), Expect = 2.736e-158
Identity = 252/481 (52.39%), Postives = 342/481 (71.10%), Query Frame = 2
Query:  179 NVNSKKASAPTT-----KKPNIDILNISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPI 1600
            N  S  ++ PTT     K+P       S  KD R  S+RF +S+ RE+Q+LP+F++V   E E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  N+A+ +IDQ F++ ++DLFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFY  IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L    ++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +F+ +K KE    K+  + W+ +  +AK NP +      +G   P+
Sbjct:   64 NRKSGNSAPPTTQLLKGKQPGS---QTSAKKDKRPNSTRFSLSNNRELQKLPAFEDVPPEEEEKLFIQKLRQCCVLFDFISDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFSVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNVAKKYIDQKFVMQLLDLFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYTFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPTVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKSKEKAKWKEREEAWIKIENLAKSNPQFLVYVEPVGPGSPM 540          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Medaka
Match: ppp2r5d (protein phosphatase 2 regulatory subunit B'delta [Source:NCBI gene;Acc:101169633])

HSP 1 Score: 468.774 bits (1205), Expect = 6.472e-158
Identity = 247/441 (56.01%), Postives = 331/441 (75.06%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKI 1570
            K+ RQ SSRF ++  RE+Q+LP+ K+    ERE L ++KLRQC V+FDF SD +SD+KYK++K+  L E+ EY + N+ VL++A+Y E V M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+ES +F  NIA+ +IDQ F+L +++LFD EDPRERD+LKTILHRIYGK + LRA+IR+QINNIFY  IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHKV SL V+  QLAYC+++F++KD+SL   VI+ GLLK+WPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT ++K +KQ+E    K+  + W  +  +A++NP   K+
Sbjct:   64 KERRQSSSRFSLTRNRELQKLPALKDAPPVEREELFVQKLRQCCVLFDFVSDPLSDLKYKEVKRAGLNEMVEYITHNSDVLTEAIYPEAVIMFSMNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLSLLELFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINNIFYSFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSSLTEPVIM-GLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFVKVQEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPALYKNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQREKYKLKERDEIWQKIEVLAQQNPQSQKL 503          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Medaka
Match: PPP2R5C (protein phosphatase 2 regulatory subunit B'gamma [Source:NCBI gene;Acc:101172117])

HSP 1 Score: 462.996 bits (1190), Expect = 2.292e-156
Identity = 248/487 (50.92%), Postives = 345/487 (70.84%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIRLM 1708
            ++ R  +S F +S  RE+Q+LPS ++V+  E+E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+E+ +F  NIA+ +IDQ F++ +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +F+ +K KE    K+  + W+ +  +AK NP +         + P+   T     +DV+   + +E       ++ +K R M
Sbjct:   35 REKRLSTSTFPLSVNRELQKLPSLRDVAPAEQEKLFIQKLRQCCVLFDFLSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLEAPDFQPNIAKKYIDQKFVMQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVQEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPALYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKNKEKAKSKEREEAWMKIENLAKSNPQFFVYVDSSDLNSPVAMETDVPLIEDVQRLKKTVEEGATQPQHEQRKERAM 520          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Medaka
Match: PPP2R5C (protein phosphatase 2 regulatory subunit B'gamma [Source:NCBI gene;Acc:101172117])

HSP 1 Score: 462.996 bits (1190), Expect = 4.384e-156
Identity = 248/487 (50.92%), Postives = 345/487 (70.84%), Query Frame = 2
Query:  254 KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYY-AKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIRLM 1708
            ++ R  +S F +S  RE+Q+LPS ++V+  E+E L I+KLRQC V+FDF SD +SD+K+K++K+ AL E+ EY + N  V+++ +Y EVV M   N+FRTLPPS   TG + D ++++P LEA+WPHLQ VYE FLRF+E+ +F  NIA+ +IDQ F++ +++LFD EDPRERD+LKT LHRIYGK + LRA+IRKQINNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL +VLLPLHKV SL V+  QLAYC+++F++KD++L   V++  LLKYWPKT S KE+M LNELEE L++ +  +F  V + +F Q+++C+ S HFQV ERAL +WNNE +  L   N   +LP  FPALY  +K HWNKTIHGL++N LK+ M++NQKLFD+CT +F+ +K KE    K+  + W+ +  +AK NP +         + P+   T     +DV+   + +E       ++ +K R M
Sbjct:   49 REKRLSTSTFPLSVNRELQKLPSLRDVAPAEQEKLFIQKLRQCCVLFDFLSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLEAPDFQPNIAKKYIDQKFVMQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVM-ALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKVQEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPALYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKNKEKAKSKEREEAWMKIENLAKSNPQFFVYVDSSDLNSPVAMETDVPLIEDVQRLKKTVEEGATQPQHEQRKERAM 534          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Planmine SMEST
Match: SMESG000026797.1 (SMESG000026797.1)

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 573/573 (100.00%), Postives = 573/573 (100.00%), Query Frame = 2
Query:   41 MPFSTNSANSTAKRPVGKRPEKPVITVTTKPTSNEIKPKPVEKLDLNVNSKKASAPTTKKPNIDILNISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIRLMDXXXXXXXXXXXXXFKN 1759
            MPFSTNSANSTAKRPVGKRPEKPVITVTTKPTSNEIKPKPVEKLDLNVNSKKASAPTTKKPNIDILNISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTGPDPDGDDEDPFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKEIMLLNELEECLELSDIEQFQVVSKQVFSQISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIRLMDKTWKSGGTKSSKSFKN
Sbjct:    1 MPFSTNSANSTAKRPVGKRPEKPVITVTTKPTSNEIKPKPVEKLDLNVNSKKASAPTTKKPNIDILNISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTGPDPDGDDEDPFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKEIMLLNELEECLELSDIEQFQVVSKQVFSQISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALRDLELETQSNSNDMKKIRLMDKTWKSGGTKSSKSFKN 573          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Planmine SMEST
Match: SMESG000000767.1 (SMESG000000767.1)

HSP 1 Score: 467.233 bits (1201), Expect = 1.313e-157
Identity = 255/507 (50.30%), Postives = 356/507 (70.22%), Query Frame = 2
Query:  221 PNIDILNISKV------KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKI------------ASELGDDYPINEMT-----SENGKKDVESALRDLELET 1669
            P +D+L +         K+ +Q SS F IS  RE+ +LP+ K+V + ERE+LL++K++QCSVVFDF ++ +SD+K K++K+ AL E+ ++ ++  GV+S+ +Y E + M   NVFRTLPP    TG + D ++++P LEA+WPH+Q +YE FLRF+ES +F  N+A+  IDQ F+L +++LFD EDPRERD LKTILHRIYGK + LRA+IRKQ+NNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK FL+RVL+PLHKV SL V+  QLAYC+++F++KD++L   VI+ GLLKYWPK  S KE+M LNELEE +E+ D ++FQ V K +F+Q++RC+ SQ FQV ERAL +WNNE +  L  +++  + P  FPALY +K HWNKTIH LVFN LK+ M++NQ+LFDE T  +K ++QKE E K++    W  +   AK NPLY+ I               + +D   N +      SEN  +++  AL+++ +E 
Sbjct:   31 PPVDLLKLKNAELYVPRKEKKQNSSHFNISKNRELIKLPNLKDVPTEERENLLLQKIKQCSVVFDFINEPLSDVKDKEVKRAALHELVDFLAATRGVISEPIYPEAINMFAINVFRTLPPPSNPTGLEYDPEEDEPSLEAAWPHVQLIYEFFLRFLESLDFQPNLAKRFIDQKFVLQLLELFDAEDPRERDLLKTILHRIYGKFLGLRAYIRKQVNNIFYRFIYETERHNGIAELLEILGSIINGFALPLKEEHKTFLKRVLIPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEHVII-GLLKYWPKVHSPKEVMFLNELEEIMEVLDTKEFQKVIKPLFNQLARCVSSQQFQVAERALYYWNNEYILALITEHMEEIFPIMFPALYKSKLHWNKTIHTLVFNALKLFMEMNQQLFDERTQNYKNERQKEKEDKRRREIEWENLISSAKNNPLYTSIKEKSLKDQIDAQGDSVQNDITSNSLATAEEISENSGENISQALKNMTIEV 536          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Planmine SMEST
Match: SMESG000000767.1 (SMESG000000767.1)

HSP 1 Score: 467.233 bits (1201), Expect = 1.476e-157
Identity = 255/507 (50.30%), Postives = 356/507 (70.22%), Query Frame = 2
Query:  221 PNIDILNISKV------KDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDF-SDLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKI------------ASELGDDYPINEMT-----SENGKKDVESALRDLELET 1669
            P +D+L +         K+ +Q SS F IS  RE+ +LP+ K+V + ERE+LL++K++QCSVVFDF ++ +SD+K K++K+ AL E+ ++ ++  GV+S+ +Y E + M   NVFRTLPP    TG + D ++++P LEA+WPH+Q +YE FLRF+ES +F  N+A+  IDQ F+L +++LFD EDPRERD LKTILHRIYGK + LRA+IRKQ+NNIFYR IYE E  NG AELLEILGSIINGF +PLK+EHK FL+RVL+PLHKV SL V+  QLAYC+++F++KD++L   VI+ GLLKYWPK  S KE+M LNELEE +E+ D ++FQ V K +F+Q++RC+ SQ FQV ERAL +WNNE +  L  +++  + P  FPALY +K HWNKTIH LVFN LK+ M++NQ+LFDE T  +K ++QKE E K++    W  +   AK NPLY+ I               + +D   N +      SEN  +++  AL+++ +E 
Sbjct:   36 PPVDLLKLKNAELYVPRKEKKQNSSHFNISKNRELIKLPNLKDVPTEERENLLLQKIKQCSVVFDFINEPLSDVKDKEVKRAALHELVDFLAATRGVISEPIYPEAINMFAINVFRTLPPPSNPTGLEYDPEEDEPSLEAAWPHVQLIYEFFLRFLESLDFQPNLAKRFIDQKFVLQLLELFDAEDPRERDLLKTILHRIYGKFLGLRAYIRKQVNNIFYRFIYETERHNGIAELLEILGSIINGFALPLKEEHKTFLKRVLIPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEHVII-GLLKYWPKVHSPKEVMFLNELEEIMEVLDTKEFQKVIKPLFNQLARCVSSQQFQVAERALYYWNNEYILALITEHMEEIFPIMFPALYKSKLHWNKTIHTLVFNALKLFMEMNQQLFDERTQNYKNERQKEKEDKRRREIEWENLISSAKNNPLYTSIKEKSLKDQIDAQGDSVQNDITSNSLATAEEISENSGENISQALKNMTIEV 541          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Planmine SMEST
Match: SMESG000000161.1 (SMESG000000161.1)

HSP 1 Score: 464.537 bits (1194), Expect = 2.856e-156
Identity = 267/553 (48.28%), Postives = 369/553 (66.73%), Query Frame = 2
Query:   65 NSTAKRPVGKRPEKPVIT---VTTKPTSNEIKPKPVEKLDLNVNSKKASAPTTKKPNIDILNISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFS-DLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELG--------DDYPINEMTSENGKKDVESALRDL-ELETQSNSN 1684
            N++   P  + PEK V+     T  P +  IK                    T++    I     VK  R+ SS F IS  RE+++LP  K+ S +E+E L ++K+ QCSVVFDF+ D +SD+K K+IK+  L E+ EY + N GVL++ +Y E+V M+  N+FRTLPP+    G + D ++++P LEA+WPHLQ VYE++LRF+ES +F  NIA+ +IDQ F+  +++LFD EDPRERD+LKT+LHRIYGK + LRA IRKQIN  FYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHK  SL V+  QLAYC+++F++KD SL   VIL  +LK+WPK  S KE+M LNELEE L++ D  +F  V K +F+Q+++C+ S HFQV ERAL  WNNE +  L   N+  +LP  FPALY  KQHWNKTIHGLV+N LK+ M++NQKLFDECT K+K+++ KE E +K+    W  +  +A++NPL SKI    G         D  +N   +++  +D+ ++L+++ ++E Q + N
Sbjct:    3 NNSKSSPRKEEPEKKVVAPVEATYPPQTQLIK--------------------TRQAEGTIAGSGAVKRERRASSVFNISQKRELKKLPLLKDTSPSEKEELFMKKIEQCSVVFDFAIDPLSDLKDKEIKRSTLNELIEYINGNQGVLTEPLYPEIVKMLAANLFRTLPPASNPMGAEYDPEEDEPTLEAAWPHLQLVYELYLRFLESSDFQPNIAKKYIDQKFVYQLLELFDTEDPRERDFLKTLLHRIYGKFLGLRANIRKQINYTFYRFIYEQERHNGVAELLEILGSIINGFALPLKEEHKIFLFRVLLPLHKAKSLSVYHPQLAYCVVQFLEKDPSLTQQVIL-SILKFWPKMHSPKEVMFLNELEEILDVIDPNEFLKVLKPLFTQLAKCVASPHFQVSERALYIWNNEYVLSLMSDNVAEILPIMFPALYKTKQHWNKTIHGLVYNALKLFMEMNQKLFDECTQKYKDNRAKEKEEQKRREQAWQKLCSIAQRNPL-SKIIDNDGFIVDRSQLSDSLVNSGDNDSDGEDITTSLKEINKIEIQKSVN 533          
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Planmine SMEST
Match: SMESG000000161.1 (SMESG000000161.1)

HSP 1 Score: 463.766 bits (1192), Expect = 5.732e-156
Identity = 257/501 (51.30%), Postives = 354/501 (70.66%), Query Frame = 2
Query:  212 TKKPNIDILNISKVKDNRQFSSRFKISSFREIQELPSFKEVSSNERESLLIEKLRQCSVVFDFS-DLMSDIKYKDIKKRALIEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTXXXXXXXXXXXFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDCEDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAELLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIEFIKKDTSLLSVVILQGLLKYWPKTQSLKXXXXXXXXXXXXXXSDIEXXXXXXXXXXXXISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFPALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMKKKHHDWWVTVNEVAKKNPLYSKIASELG--------DDYPINEMTSENGKKDVESALRDL-ELETQSNSN 1684
            T++    I     VK  R+ SS F IS  RE+++LP  K+ S +E+E L ++K+ QCSVVFDF+ D +SD+K K+IK+  L E+ EY + N GVL++ +Y E+V M+  N+FRTLPP+    G + D ++++P LEA+WPHLQ VYE++LRF+ES +F  NIA+ +IDQ F+  +++LFD EDPRERD+LKT+LHRIYGK + LRA IRKQIN  FYR IYE E  NG AELLEILGSIINGF +PLK+EHK+FL RVLLPLHK  SL V+  QLAYC+++F++KD SL   VIL  +LK+WPK  S KE+M LNELEE L++ D  +F  V K +F+Q+++C+ S HFQV ERAL  WNNE +  L   N+  +LP  FPALY  KQHWNKTIHGLV+N LK+ M++NQKLFDECT K+K+++ KE E +K+    W  +  +A++NPL SKI    G         D  +N   +++  +D+ ++L+++ ++E Q + N
Sbjct:   42 TRQAEGTIAGSGAVKRERRASSVFNISQKRELKKLPLLKDTSPSEKEELFMKKIEQCSVVFDFAIDPLSDLKDKEIKRSTLNELIEYINGNQGVLTEPLYPEIVKMLAANLFRTLPPASNPMGAEYDPEEDEPTLEAAWPHLQLVYELYLRFLESSDFQPNIAKKYIDQKFVYQLLELFDTEDPRERDFLKTLLHRIYGKFLGLRANIRKQINYTFYRFIYEQERHNGVAELLEILGSIINGFALPLKEEHKIFLFRVLLPLHKAKSLSVYHPQLAYCVVQFLEKDPSLTQQVIL-SILKFWPKMHSPKEVMFLNELEEILDVIDPNEFLKVLKPLFTQLAKCVASPHFQVSERALYIWNNEYVLSLMSDNVAEILPIMFPALYKTKQHWNKTIHGLVYNALKLFMEMNQKLFDECTQKYKDNRAKEKEEQKRREQAWQKLCSIAQRNPL-SKIIDNDGFIVDRSQLSDSLVNSGDNDSDGEDITTSLKEINKIEIQKSVN 540          
The following BLAST results are available for this feature:
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP2R5D2.838e-15952.66protein phosphatase 2 regulatory subunit B'delta [... [more]
PPP2R5D3.667e-15952.66protein phosphatase 2 regulatory subunit B'delta [... [more]
PPP2R5C2.152e-15753.73protein phosphatase 2 regulatory subunit B'gamma [... [more]
PPP2R5D4.462e-14850.61protein phosphatase 2 regulatory subunit B'delta [... [more]
PPP2R5D4.125e-14752.86protein phosphatase 2 regulatory subunit B'delta [... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pptr-21.204e-14751.39Serine/threonine protein phosphatase 2A regulatory... [more]
pptr-21.443e-14751.39Serine/threonine protein phosphatase 2A regulatory... [more]
pptr-21.443e-14751.39Serine/threonine protein phosphatase 2A regulatory... [more]
pptr-21.576e-14751.39Serine/threonine protein phosphatase 2A regulatory... [more]
pptr-21.576e-14751.39Serine/threonine protein phosphatase 2A regulatory... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wrd2.540e-14750.86gene:FBgn0042693 transcript:FBtr0083554[more]
wrd1.188e-14650.86gene:FBgn0042693 transcript:FBtr0306646[more]
wrd1.188e-14650.86gene:FBgn0042693 transcript:FBtr0290319[more]
wrd1.269e-14650.86gene:FBgn0042693 transcript:FBtr0083552[more]
wrd1.269e-14650.86gene:FBgn0042693 transcript:FBtr0083553[more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp2r5d4.826e-16247.89protein phosphatase 2, regulatory subunit B', delt... [more]
ppp2r5cb8.351e-15755.48protein phosphatase 2, regulatory subunit B', gamm... [more]
ppp2r5eb3.140e-13553.33protein phosphatase 2, regulatory subunit B', epsi... [more]
ppp2r5ea9.546e-13550.22protein phosphatase 2, regulatory subunit B', epsi... [more]
ppp2r5ea9.546e-13550.22protein phosphatase 2, regulatory subunit B', epsi... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sds1.352e-15852.58serine dehydratase [Source:Xenbase;Acc:XB-GENE-921... [more]
sds1.540e-15852.58serine dehydratase [Source:Xenbase;Acc:XB-GENE-921... [more]
sds5.345e-15852.58serine dehydratase [Source:Xenbase;Acc:XB-GENE-921... [more]
sds1.184e-15556.19serine dehydratase [Source:Xenbase;Acc:XB-GENE-921... [more]
sds3.254e-15554.70serine dehydratase [Source:Xenbase;Acc:XB-GENE-921... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp2r5d1.009e-15652.25protein phosphatase 2, regulatory subunit B', delt... [more]
Ppp2r5d1.238e-15652.25protein phosphatase 2, regulatory subunit B', delt... [more]
Ppp2r5c4.118e-14651.84protein phosphatase 2, regulatory subunit B', gamm... [more]
Ppp2r5c1.870e-14553.06protein phosphatase 2, regulatory subunit B', gamm... [more]
Ppp2r5c9.934e-14553.41protein phosphatase 2, regulatory subunit B', gamm... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28653|2A5D_RABIT6.070e-15952.66Serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
sp|Q14738|2A5D_HUMAN1.761e-15852.66Serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
sp|Q28651|2A5G_RABIT2.038e-14552.49Serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
sp|Q13362|2A5G_HUMAN2.152e-14552.28Serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
sp|Q60996|2A5G_MOUSE2.881e-14551.84Serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8HHQ11.437e-16152.33Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A0L8HHR61.498e-16152.44Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A1S3HSW83.362e-16154.41Serine/threonine protein phosphatase 2A regulatory... [more]
A0A293N0H56.583e-16152.82Protein phosphatase 2A B56 regulatory subunit gamm... [more]
A0A2T7NZ141.215e-16053.35Serine/threonine protein phosphatase 2A regulatory... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp2r5d5.647e-16056.65protein phosphatase 2, regulatory subunit B', delt... [more]
ppp2r5cb3.610e-15952.16serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
ppp2r5cb5.976e-15955.96serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
ENSAMXT00000036192.15.847e-15554.24pep primary_assembly:Astyanax_mexicanus-2.0:9:4458... [more]
ENSAMXT00000031308.18.276e-15553.49pep primary_assembly:Astyanax_mexicanus-2.0:9:4456... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP2R5C1.392e-15754.79protein phosphatase 2 regulatory subunit B'gamma [... [more]
PPP2R5C4.242e-15654.88protein phosphatase 2 regulatory subunit B'gamma [... [more]
ENSPMAT00000009244.11.505e-14253.48pep scaffold:Pmarinus_7.0:GL476614:294291:304031:1... [more]
ENSPMAT00000004802.16.395e-13150.23pep scaffold:Pmarinus_7.0:GL477853:33619:54992:1 g... [more]
ENSPMAT00000004256.11.314e-5852.63pep scaffold:Pmarinus_7.0:GL484287:17817:24558:-1 ... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RTS12.352e-11443.63B-type regulatory subunit of protein phosphatase 2... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO307336.625e-13855.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486461.882e-13452.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307341.564e-5040.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp2r5cb7.018e-15952.39serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
ppp2r5cb2.736e-15852.39serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
ppp2r5d6.472e-15856.01protein phosphatase 2 regulatory subunit B'delta [... [more]
PPP2R5C2.292e-15650.92protein phosphatase 2 regulatory subunit B'gamma [... [more]
PPP2R5C4.384e-15650.92protein phosphatase 2 regulatory subunit B'gamma [... [more]
back to top
BLAST of Serine/threonine protein phosphatase 2A regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026797.10.000e+0100.00SMESG000026797.1[more]
SMESG000000767.11.313e-15750.30SMESG000000767.1[more]
SMESG000000767.11.476e-15750.30SMESG000000767.1[more]
SMESG000000161.12.856e-15648.28SMESG000000161.1[more]
SMESG000000161.15.732e-15651.30SMESG000000161.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023859 ID=SMED30023859|Name=Serine/threonine protein phosphatase 2A regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1993bp
TATCAAATTTGACCATGAAATAATACAAATCTTTTCAAAAATGCCATTTA
GTACTAATTCAGCTAATTCCACAGCAAAGCGGCCGGTAGGGAAGCGGCCT
GAAAAGCCTGTCATAACTGTCACGACAAAACCCACCTCAAATGAAATCAA
ACCGAAACCCGTTGAAAAACTCGACCTGAATGTAAACAGTAAAAAGGCCT
CGGCTCCAACTACCAAGAAACCGAACATCGACATATTGAATATTTCCAAA
GTCAAAGACAATCGTCAATTTTCCTCTAGGTTCAAAATAAGTTCATTCCG
AGAGATCCAGGAACTACCATCGTTTAAAGAAGTTTCGTCGAATGAGCGAG
AATCTCTTTTGATAGAAAAACTTAGACAATGCAGCGTTGTTTTTGACTTT
TCCGACCTAATGAGCGACATCAAATATAAGGATATCAAGAAAAGAGCACT
CATAGAAATCAGTGAATATTTCTCATCGAATACGGGAGTTTTAAGTGATG
CCGTTTACAAAGAGGTCGTCTGTATGGTAGGGACAAATGTGTTTCGGACA
TTGCCTCCCTCTTGCACCGTCACTGGACCAGACCCGGATGGTGATGACGA
GGATCCGTTTTTGGAAGCTTCATGGCCTCATTTGCAGCATGTATATGAAG
TATTCCTAAGATTTGTTGAATCCCACGAGTTCTCAGCCAACATTGCTCGG
CTTCACATTGACCAAAACTTCATTTTATATATCATGGACTTGTTTGATTG
TGAGGATCCTCGAGAAAGAGATTATTTAAAGACTATTCTTCACAGAATCT
ATGGGAAAATGATCACTCTGAGAGCCTTTATAAGGAAACAAATAAATAAT
ATTTTCTATAGACAAATATATGAAATTGAAGCCTTCAATGGTACTGCAGA
ATTGCTCGAAATTCTTGGAAGCATAATCAACGGGTTTCAAGTGCCTTTAA
AAGACGAACACAAAGTATTCCTGCGACGAGTTTTGCTACCTCTACATAAA
GTGCCGAGTCTCGGAGTTTTCCAAGCCCAGCTTGCCTATTGTATTATCGA
ATTCATCAAAAAAGACACCTCACTATTGAGCGTGGTAATACTTCAAGGTC
TACTAAAATACTGGCCCAAAACTCAGAGTTTAAAAGAGATCATGCTCCTT
AATGAACTAGAAGAATGTCTCGAGCTGAGCGACATTGAGCAATTCCAGGT
GGTCTCCAAGCAAGTCTTTAGTCAGATTTCCCGATGTATTTGTTCGCAAC
ATTTTCAAGTTTGTGAGAGAGCCTTACTTTTCTGGAATAATGAGACCCTT
CATCCTTTATTTGTGAAAAATATTCATATCCTCTTACCTGCTACATTCCC
AGCTCTCTACTATGCAAAACAACATTGGAACAAGACGATTCATGGACTCG
TGTTCAACGTCCTCAAGATTATGATGGACATCAATCAGAAATTATTCGAC
GAATGCACATTGAAATTCAAAGAGGATAAGCAAAAAGAAATCGAAATGAA
AAAAAAACATCATGACTGGTGGGTGACTGTGAACGAGGTAGCGAAAAAAA
ACCCCCTTTATTCAAAAATTGCTTCTGAACTAGGAGACGACTACCCTATA
AATGAGATGACATCAGAAAATGGGAAAAAAGATGTAGAAAGCGCACTAAG
AGATTTAGAATTAGAGACCCAGTCTAATTCAAATGACATGAAAAAGATAA
GATTGATGGACAAAACTTGGAAATCTGGTGGGACAAAGTCCTCAAAGTCC
TTCAAGAATTGAACAGCTCAAAAAATCGGACATCTTTTCATTAATAGATA
TTTTTGATTAATTAACGGTGCCTCTGGCGCCTATTGGTCATGTGTATATA
TCTCCAATGTTTTCTGTGTTCGTTATTTTTTGATGTTGCAGAGGAGAACT
TTGTTCTGTCTTTGAAATAGCAGCAAATAATTATCTTTGAGACTTAGAAT
AAACACAATCTACTAAATAGTCACATATTCATTCAAGGTTGTA
back to top

protein sequence of SMED30023859-orf-1

>SMED30023859-orf-1 ID=SMED30023859-orf-1|Name=SMED30023859-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=587bp
IKFDHEIIQIFSKMPFSTNSANSTAKRPVGKRPEKPVITVTTKPTSNEIK
PKPVEKLDLNVNSKKASAPTTKKPNIDILNISKVKDNRQFSSRFKISSFR
EIQELPSFKEVSSNERESLLIEKLRQCSVVFDFSDLMSDIKYKDIKKRAL
IEISEYFSSNTGVLSDAVYKEVVCMVGTNVFRTLPPSCTVTGPDPDGDDE
DPFLEASWPHLQHVYEVFLRFVESHEFSANIARLHIDQNFILYIMDLFDC
EDPRERDYLKTILHRIYGKMITLRAFIRKQINNIFYRQIYEIEAFNGTAE
LLEILGSIINGFQVPLKDEHKVFLRRVLLPLHKVPSLGVFQAQLAYCIIE
FIKKDTSLLSVVILQGLLKYWPKTQSLKEIMLLNELEECLELSDIEQFQV
VSKQVFSQISRCICSQHFQVCERALLFWNNETLHPLFVKNIHILLPATFP
ALYYAKQHWNKTIHGLVFNVLKIMMDINQKLFDECTLKFKEDKQKEIEMK
KKHHDWWVTVNEVAKKNPLYSKIASELGDDYPINEMTSENGKKDVESALR
DLELETQSNSNDMKKIRLMDKTWKSGGTKSSKSFKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043666regulation of phosphoprotein phosphatase activity
GO:0007165signal transduction
GO:0050790regulation of catalytic activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR002554PP2A_B56
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0008601protein phosphatase type 2A regulator activity
GO:0005488binding
GO:0019888protein phosphatase regulator activity
Vocabulary: cellular component
TermDefinition
GO:0000159protein phosphatase type 2A complex
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 112..513
e-value: 4.0E-164
score: 548.4
IPR002554Protein phosphatase 2A, regulatory B subunit, B56PIRSFPIRSF028043PP2A_B56coord: 4..585
e-value: 3.0E-205
score: 681.5
IPR002554Protein phosphatase 2A, regulatory B subunit, B56PFAMPF01603B56coord: 105..514
e-value: 1.8E-160
score: 534.5
IPR002554Protein phosphatase 2A, regulatory B subunit, B56PANTHERPTHR10257SERINE/THREONINE PROTEIN PHOSPHATASE 2A PP2A REGULATORY SUBUNIT Bcoord: 48..524
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 554..586
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 19..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 554..572
NoneNo IPR availablePANTHERPTHR10257:SF3SERINE/THREONINE-PROTEIN PHOSPHATASE 2A 56 KDA REGULATORY SUBUNIT DELTA ISOFORMcoord: 48..524
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 117..497